Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tumor necrosis factor receptor superfamily member 3

Gene

LTBR

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Receptor for the heterotrimeric lymphotoxin containing LTA and LTB, and for TNFS14/LIGHT. Promotes apoptosis via TRAF3 and TRAF5. May play a role in the development of lymphoid organs.2 Publications

GO - Molecular functioni

  • identical protein binding Source: IntAct
  • tumor necrosis factor-activated receptor activity Source: GO_Central
  • ubiquitin protein ligase binding Source: UniProtKB

GO - Biological processi

  • apoptotic process Source: UniProtKB-KW
  • cellular response to mechanical stimulus Source: UniProtKB
  • immune response Source: GO_Central
  • inflammatory response Source: GO_Central
  • multicellular organism development Source: GO_Central
  • myeloid dendritic cell differentiation Source: Ensembl
  • positive regulation of extrinsic apoptotic signaling pathway Source: UniProtKB
  • positive regulation of I-kappaB kinase/NF-kappaB signaling Source: UniProtKB
  • positive regulation of JNK cascade Source: UniProtKB
  • regulation of cell proliferation Source: GO_Central
  • response to lipopolysaccharide Source: GO_Central
  • signal transduction Source: ProtInc
  • tumor necrosis factor-mediated signaling pathway Source: Reactome
  • viral process Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Biological processi

Apoptosis, Host-virus interaction

Enzyme and pathway databases

ReactomeiR-HSA-5668541. TNFR2 non-canonical NF-kB pathway.
R-HSA-5676594. TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway.
SignaLinkiP36941.
SIGNORiP36941.

Names & Taxonomyi

Protein namesi
Recommended name:
Tumor necrosis factor receptor superfamily member 3
Alternative name(s):
Lymphotoxin-beta receptor
Tumor necrosis factor C receptor
Tumor necrosis factor receptor 2-related protein
Tumor necrosis factor receptor type III
Short name:
TNF-RIII
Short name:
TNFR-III
Gene namesi
Name:LTBR
Synonyms:D12S370, TNFCR, TNFR3, TNFRSF3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

HGNCiHGNC:6718. LTBR.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini31 – 227197ExtracellularSequence analysisAdd
BLAST
Transmembranei228 – 24821HelicalSequence analysisAdd
BLAST
Topological domaini249 – 435187CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA30481.

Chemistry

ChEMBLiCHEMBL1250360.

Polymorphism and mutation databases

DMDMi549090.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 3030Sequence analysisAdd
BLAST
Chaini31 – 435405Tumor necrosis factor receptor superfamily member 3PRO_0000034552Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi40 – 401N-linked (GlcNAc...)Sequence analysis
Disulfide bondi43 ↔ 58PROSITE-ProRule annotation
Disulfide bondi59 ↔ 72PROSITE-ProRule annotation
Disulfide bondi62 ↔ 80PROSITE-ProRule annotation
Disulfide bondi83 ↔ 98PROSITE-ProRule annotation
Disulfide bondi101 ↔ 116PROSITE-ProRule annotation
Disulfide bondi104 ↔ 124PROSITE-ProRule annotation
Disulfide bondi126 ↔ 132PROSITE-ProRule annotation
Disulfide bondi139 ↔ 148PROSITE-ProRule annotation
Disulfide bondi142 ↔ 167PROSITE-ProRule annotation
Disulfide bondi170 ↔ 185PROSITE-ProRule annotation
Glycosylationi177 – 1771N-linked (GlcNAc...)Sequence analysis
Modified residuei323 – 3231PhosphoserineCombined sources

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiP36941.
PaxDbiP36941.
PeptideAtlasiP36941.
PRIDEiP36941.

PTM databases

iPTMnetiP36941.
PhosphoSiteiP36941.

Expressioni

Gene expression databases

BgeeiENSG00000111321.
CleanExiHS_LTBR.
ExpressionAtlasiP36941. baseline and differential.
GenevisibleiP36941. HS.

Organism-specific databases

HPAiCAB026202.

Interactioni

Subunit structurei

Self-associates. Associates with TRAF3, TRAF4 and TRAF5. Interacts with HCV core protein.4 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
itself2EBI-3509981,EBI-3509981
P298465EBI-3509981,EBI-8847394From a different organism.
TNFSF14O435573EBI-3509981,EBI-524131
ZMYND11Q153265EBI-3509981,EBI-2623509

GO - Molecular functioni

  • identical protein binding Source: IntAct
  • ubiquitin protein ligase binding Source: UniProtKB

Protein-protein interaction databases

BioGridi110233. 75 interactions.
DIPiDIP-2928N.
IntActiP36941. 12 interactions.
STRINGi9606.ENSP00000228918.

Structurei

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1RF3X-ray3.50B385-408[»]
4MXWX-ray3.60R/S41-211[»]
ProteinModelPortaliP36941.
SMRiP36941. Positions 43-211.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP36941.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati42 – 8140TNFR-Cys 1Add
BLAST
Repeati82 – 12443TNFR-Cys 2Add
BLAST
Repeati125 – 16844TNFR-Cys 3Add
BLAST
Repeati169 – 21143TNFR-Cys 4Add
BLAST

Sequence similaritiesi

Contains 4 TNFR-Cys repeats.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IKNN. Eukaryota.
ENOG410YQJW. LUCA.
GeneTreeiENSGT00760000119204.
HOGENOMiHOG000294180.
HOVERGENiHBG023187.
InParanoidiP36941.
KOiK03159.
OMAiQLCRPCD.
OrthoDBiEOG091G03XW.
PhylomeDBiP36941.
TreeFamiTF331157.

Family and domain databases

InterProiIPR001368. TNFR/NGFR_Cys_rich_reg.
IPR017349. TNFR_3_LTBR.
[Graphical view]
PfamiPF00020. TNFR_c6. 3 hits.
[Graphical view]
PIRSFiPIRSF037999. TNFR_3_LTBR. 1 hit.
PRINTSiPR01920. TNFACTORR3.
SMARTiSM00208. TNFR. 4 hits.
[Graphical view]
PROSITEiPS00652. TNFR_NGFR_1. 2 hits.
PS50050. TNFR_NGFR_2. 3 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P36941-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLLPWATSAP GLAWGPLVLG LFGLLAASQP QAVPPYASEN QTCRDQEKEY
60 70 80 90 100
YEPQHRICCS RCPPGTYVSA KCSRIRDTVC ATCAENSYNE HWNYLTICQL
110 120 130 140 150
CRPCDPVMGL EEIAPCTSKR KTQCRCQPGM FCAAWALECT HCELLSDCPP
160 170 180 190 200
GTEAELKDEV GKGNNHCVPC KAGHFQNTSS PSARCQPHTR CENQGLVEAA
210 220 230 240 250
PGTAQSDTTC KNPLEPLPPE MSGTMLMLAV LLPLAFFLLL ATVFSCIWKS
260 270 280 290 300
HPSLCRKLGS LLKRRPQGEG PNPVAGSWEP PKAHPYFPDL VQPLLPISGD
310 320 330 340 350
VSPVSTGLPA APVLEAGVPQ QQSPLDLTRE PQLEPGEQSQ VAHGTNGIHV
360 370 380 390 400
TGGSMTITGN IYIYNGPVLG GPPGPGDLPA TPEPPYPIPE EGDPGPPGLS
410 420 430
TPHQEDGKAW HLAETEHCGA TPSNRGPRNQ FITHD
Length:435
Mass (Da):46,709
Last modified:June 1, 1994 - v1
Checksum:i624626E6022F656F
GO
Isoform 2 (identifier: P36941-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MLLPWATSAPGLAWGPLVLGLFGLLAASQPQA → MEATGISLASQLK

Note: No experimental confirmation available.
Show »
Length:416
Mass (Da):44,810
Checksum:i43DF8C86945A0F3E
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti76 – 761R → W in BAH11468 (PubMed:14702039).Curated
Sequence conflicti410 – 4101W → R in BAH11468 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti274 – 2741V → I.
Corresponds to variant rs35681405 [ dbSNP | Ensembl ].
VAR_052346

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3232MLLPW…SQPQA → MEATGISLASQLK in isoform 2. 1 PublicationVSP_047533Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L04270 mRNA. Translation: AAA36757.1.
AK293187 mRNA. Translation: BAH11468.1.
AC005840 Genomic DNA. No translation available.
CH471116 Genomic DNA. Translation: EAW88801.1.
CH471116 Genomic DNA. Translation: EAW88802.1.
BC026262 mRNA. Translation: AAH26262.1.
CCDSiCCDS59233.1. [P36941-2]
CCDS8544.1. [P36941-1]
PIRiI54182.
RefSeqiNP_001257916.1. NM_001270987.1. [P36941-2]
NP_002333.1. NM_002342.2. [P36941-1]
UniGeneiHs.1116.

Genome annotation databases

EnsembliENST00000228918; ENSP00000228918; ENSG00000111321. [P36941-1]
ENST00000539925; ENSP00000440875; ENSG00000111321. [P36941-2]
GeneIDi4055.
KEGGihsa:4055.
UCSCiuc001qny.3. human. [P36941-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L04270 mRNA. Translation: AAA36757.1.
AK293187 mRNA. Translation: BAH11468.1.
AC005840 Genomic DNA. No translation available.
CH471116 Genomic DNA. Translation: EAW88801.1.
CH471116 Genomic DNA. Translation: EAW88802.1.
BC026262 mRNA. Translation: AAH26262.1.
CCDSiCCDS59233.1. [P36941-2]
CCDS8544.1. [P36941-1]
PIRiI54182.
RefSeqiNP_001257916.1. NM_001270987.1. [P36941-2]
NP_002333.1. NM_002342.2. [P36941-1]
UniGeneiHs.1116.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1RF3X-ray3.50B385-408[»]
4MXWX-ray3.60R/S41-211[»]
ProteinModelPortaliP36941.
SMRiP36941. Positions 43-211.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110233. 75 interactions.
DIPiDIP-2928N.
IntActiP36941. 12 interactions.
STRINGi9606.ENSP00000228918.

Chemistry

ChEMBLiCHEMBL1250360.

PTM databases

iPTMnetiP36941.
PhosphoSiteiP36941.

Polymorphism and mutation databases

DMDMi549090.

Proteomic databases

MaxQBiP36941.
PaxDbiP36941.
PeptideAtlasiP36941.
PRIDEiP36941.

Protocols and materials databases

DNASUi4055.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000228918; ENSP00000228918; ENSG00000111321. [P36941-1]
ENST00000539925; ENSP00000440875; ENSG00000111321. [P36941-2]
GeneIDi4055.
KEGGihsa:4055.
UCSCiuc001qny.3. human. [P36941-1]

Organism-specific databases

CTDi4055.
GeneCardsiLTBR.
HGNCiHGNC:6718. LTBR.
HPAiCAB026202.
MIMi600979. gene.
neXtProtiNX_P36941.
PharmGKBiPA30481.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IKNN. Eukaryota.
ENOG410YQJW. LUCA.
GeneTreeiENSGT00760000119204.
HOGENOMiHOG000294180.
HOVERGENiHBG023187.
InParanoidiP36941.
KOiK03159.
OMAiQLCRPCD.
OrthoDBiEOG091G03XW.
PhylomeDBiP36941.
TreeFamiTF331157.

Enzyme and pathway databases

ReactomeiR-HSA-5668541. TNFR2 non-canonical NF-kB pathway.
R-HSA-5676594. TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway.
SignaLinkiP36941.
SIGNORiP36941.

Miscellaneous databases

ChiTaRSiLTBR. human.
EvolutionaryTraceiP36941.
GeneWikiiLymphotoxin_beta_receptor.
GenomeRNAii4055.
PROiP36941.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000111321.
CleanExiHS_LTBR.
ExpressionAtlasiP36941. baseline and differential.
GenevisibleiP36941. HS.

Family and domain databases

InterProiIPR001368. TNFR/NGFR_Cys_rich_reg.
IPR017349. TNFR_3_LTBR.
[Graphical view]
PfamiPF00020. TNFR_c6. 3 hits.
[Graphical view]
PIRSFiPIRSF037999. TNFR_3_LTBR. 1 hit.
PRINTSiPR01920. TNFACTORR3.
SMARTiSM00208. TNFR. 4 hits.
[Graphical view]
PROSITEiPS00652. TNFR_NGFR_1. 2 hits.
PS50050. TNFR_NGFR_2. 3 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiTNR3_HUMAN
AccessioniPrimary (citable) accession number: P36941
Secondary accession number(s): B7Z1D2, D3DUR2, F5GXE7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 1, 1994
Last sequence update: June 1, 1994
Last modified: September 7, 2016
This is version 162 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.