Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P36941

- TNR3_HUMAN

UniProt

P36941 - TNR3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Tumor necrosis factor receptor superfamily member 3

Gene

LTBR

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Receptor for the heterotrimeric lymphotoxin containing LTA and LTB, and for TNFS14/LIGHT. Promotes apoptosis via TRAF3 and TRAF5. May play a role in the development of lymphoid organs.2 Publications

GO - Molecular functioni

  1. identical protein binding Source: IntAct
  2. ubiquitin protein ligase binding Source: UniProtKB

GO - Biological processi

  1. apoptotic process Source: UniProtKB-KW
  2. cellular response to mechanical stimulus Source: UniProtKB
  3. positive regulation of extrinsic apoptotic signaling pathway Source: UniProtKB
  4. positive regulation of I-kappaB kinase/NF-kappaB signaling Source: UniProtKB
  5. positive regulation of JNK cascade Source: UniProtKB
  6. signal transduction Source: ProtInc
  7. viral process Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Biological processi

Apoptosis, Host-virus interaction

Enzyme and pathway databases

SignaLinkiP36941.

Names & Taxonomyi

Protein namesi
Recommended name:
Tumor necrosis factor receptor superfamily member 3
Alternative name(s):
Lymphotoxin-beta receptor
Tumor necrosis factor C receptor
Tumor necrosis factor receptor 2-related protein
Tumor necrosis factor receptor type III
Short name:
TNF-RIII
Short name:
TNFR-III
Gene namesi
Name:LTBR
Synonyms:D12S370, TNFCR, TNFR3, TNFRSF3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Unplaced

Organism-specific databases

HGNCiHGNC:6718. LTBR.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini31 – 227197ExtracellularSequence AnalysisAdd
BLAST
Transmembranei228 – 24821HelicalSequence AnalysisAdd
BLAST
Topological domaini249 – 435187CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA30481.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 3030Sequence AnalysisAdd
BLAST
Chaini31 – 435405Tumor necrosis factor receptor superfamily member 3PRO_0000034552Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi40 – 401N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi43 ↔ 58PROSITE-ProRule annotation
Disulfide bondi59 ↔ 72PROSITE-ProRule annotation
Disulfide bondi62 ↔ 80PROSITE-ProRule annotation
Disulfide bondi83 ↔ 98PROSITE-ProRule annotation
Disulfide bondi101 ↔ 116PROSITE-ProRule annotation
Disulfide bondi104 ↔ 124PROSITE-ProRule annotation
Disulfide bondi126 ↔ 132PROSITE-ProRule annotation
Disulfide bondi139 ↔ 148PROSITE-ProRule annotation
Disulfide bondi142 ↔ 167PROSITE-ProRule annotation
Disulfide bondi170 ↔ 185PROSITE-ProRule annotation
Glycosylationi177 – 1771N-linked (GlcNAc...)Sequence Analysis
Modified residuei323 – 3231Phosphoserine1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiP36941.
PaxDbiP36941.
PeptideAtlasiP36941.
PRIDEiP36941.

PTM databases

PhosphoSiteiP36941.

Expressioni

Gene expression databases

BgeeiP36941.
CleanExiHS_LTBR.
ExpressionAtlasiP36941. baseline and differential.
GenevestigatoriP36941.

Organism-specific databases

HPAiCAB026202.

Interactioni

Subunit structurei

Self-associates. Associates with TRAF3, TRAF4 and TRAF5. Interacts with HCV core protein.4 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
itself2EBI-3509981,EBI-3509981
P298465EBI-3509981,EBI-8847394From a different organism.
ZMYND11Q153265EBI-3509981,EBI-2623509

Protein-protein interaction databases

BioGridi110233. 71 interactions.
DIPiDIP-2928N.
IntActiP36941. 8 interactions.
STRINGi9606.ENSP00000228918.

Structurei

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1RF3X-ray3.50B385-408[»]
4MXWX-ray3.60R/S41-211[»]
ProteinModelPortaliP36941.
SMRiP36941. Positions 43-211.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP36941.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati42 – 8140TNFR-Cys 1Add
BLAST
Repeati82 – 12443TNFR-Cys 2Add
BLAST
Repeati125 – 16844TNFR-Cys 3Add
BLAST
Repeati169 – 21143TNFR-Cys 4Add
BLAST

Sequence similaritiesi

Contains 4 TNFR-Cys repeats.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG38845.
GeneTreeiENSGT00760000119204.
HOGENOMiHOG000294180.
HOVERGENiHBG023187.
InParanoidiP36941.
KOiK03159.
OMAiTVTGNIY.
OrthoDBiEOG786H2Q.
PhylomeDBiP36941.
TreeFamiTF331157.

Family and domain databases

InterProiIPR001368. TNFR/NGFR_Cys_rich_reg.
IPR017349. TNFR_3_LTBR.
[Graphical view]
PfamiPF00020. TNFR_c6. 2 hits.
[Graphical view]
PIRSFiPIRSF037999. TNFR_3_LTBR. 1 hit.
PRINTSiPR01920. TNFACTORR3.
SMARTiSM00208. TNFR. 4 hits.
[Graphical view]
PROSITEiPS00652. TNFR_NGFR_1. 2 hits.
PS50050. TNFR_NGFR_2. 3 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P36941-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLLPWATSAP GLAWGPLVLG LFGLLAASQP QAVPPYASEN QTCRDQEKEY
60 70 80 90 100
YEPQHRICCS RCPPGTYVSA KCSRIRDTVC ATCAENSYNE HWNYLTICQL
110 120 130 140 150
CRPCDPVMGL EEIAPCTSKR KTQCRCQPGM FCAAWALECT HCELLSDCPP
160 170 180 190 200
GTEAELKDEV GKGNNHCVPC KAGHFQNTSS PSARCQPHTR CENQGLVEAA
210 220 230 240 250
PGTAQSDTTC KNPLEPLPPE MSGTMLMLAV LLPLAFFLLL ATVFSCIWKS
260 270 280 290 300
HPSLCRKLGS LLKRRPQGEG PNPVAGSWEP PKAHPYFPDL VQPLLPISGD
310 320 330 340 350
VSPVSTGLPA APVLEAGVPQ QQSPLDLTRE PQLEPGEQSQ VAHGTNGIHV
360 370 380 390 400
TGGSMTITGN IYIYNGPVLG GPPGPGDLPA TPEPPYPIPE EGDPGPPGLS
410 420 430
TPHQEDGKAW HLAETEHCGA TPSNRGPRNQ FITHD
Length:435
Mass (Da):46,709
Last modified:June 1, 1994 - v1
Checksum:i624626E6022F656F
GO
Isoform 2 (identifier: P36941-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MLLPWATSAPGLAWGPLVLGLFGLLAASQPQA → MEATGISLASQLK

Note: No experimental confirmation available.

Show »
Length:416
Mass (Da):44,810
Checksum:i43DF8C86945A0F3E
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti76 – 761R → W in BAH11468. (PubMed:14702039)Curated
Sequence conflicti410 – 4101W → R in BAH11468. (PubMed:14702039)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti274 – 2741V → I.
Corresponds to variant rs35681405 [ dbSNP | Ensembl ].
VAR_052346

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3232MLLPW…SQPQA → MEATGISLASQLK in isoform 2. 1 PublicationVSP_047533Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L04270 mRNA. Translation: AAA36757.1.
AK293187 mRNA. Translation: BAH11468.1.
AC005840 Genomic DNA. No translation available.
CH471116 Genomic DNA. Translation: EAW88801.1.
CH471116 Genomic DNA. Translation: EAW88802.1.
BC026262 mRNA. Translation: AAH26262.1.
CCDSiCCDS59233.1. [P36941-2]
CCDS8544.1. [P36941-1]
PIRiI54182.
RefSeqiNP_001257916.1. NM_001270987.1. [P36941-2]
NP_002333.1. NM_002342.2. [P36941-1]
UniGeneiHs.1116.

Genome annotation databases

EnsembliENST00000228918; ENSP00000228918; ENSG00000111321. [P36941-1]
ENST00000539925; ENSP00000440875; ENSG00000111321. [P36941-2]
GeneIDi4055.
KEGGihsa:4055.
UCSCiuc001qny.2. human. [P36941-1]

Polymorphism databases

DMDMi549090.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L04270 mRNA. Translation: AAA36757.1 .
AK293187 mRNA. Translation: BAH11468.1 .
AC005840 Genomic DNA. No translation available.
CH471116 Genomic DNA. Translation: EAW88801.1 .
CH471116 Genomic DNA. Translation: EAW88802.1 .
BC026262 mRNA. Translation: AAH26262.1 .
CCDSi CCDS59233.1. [P36941-2 ]
CCDS8544.1. [P36941-1 ]
PIRi I54182.
RefSeqi NP_001257916.1. NM_001270987.1. [P36941-2 ]
NP_002333.1. NM_002342.2. [P36941-1 ]
UniGenei Hs.1116.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1RF3 X-ray 3.50 B 385-408 [» ]
4MXW X-ray 3.60 R/S 41-211 [» ]
ProteinModelPortali P36941.
SMRi P36941. Positions 43-211.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 110233. 71 interactions.
DIPi DIP-2928N.
IntActi P36941. 8 interactions.
STRINGi 9606.ENSP00000228918.

Chemistry

ChEMBLi CHEMBL1250360.
GuidetoPHARMACOLOGYi 1872.

PTM databases

PhosphoSitei P36941.

Polymorphism databases

DMDMi 549090.

Proteomic databases

MaxQBi P36941.
PaxDbi P36941.
PeptideAtlasi P36941.
PRIDEi P36941.

Protocols and materials databases

DNASUi 4055.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000228918 ; ENSP00000228918 ; ENSG00000111321 . [P36941-1 ]
ENST00000539925 ; ENSP00000440875 ; ENSG00000111321 . [P36941-2 ]
GeneIDi 4055.
KEGGi hsa:4055.
UCSCi uc001qny.2. human. [P36941-1 ]

Organism-specific databases

CTDi 4055.
GeneCardsi GC12P006484.
HGNCi HGNC:6718. LTBR.
HPAi CAB026202.
MIMi 600979. gene.
neXtProti NX_P36941.
PharmGKBi PA30481.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG38845.
GeneTreei ENSGT00760000119204.
HOGENOMi HOG000294180.
HOVERGENi HBG023187.
InParanoidi P36941.
KOi K03159.
OMAi TVTGNIY.
OrthoDBi EOG786H2Q.
PhylomeDBi P36941.
TreeFami TF331157.

Enzyme and pathway databases

SignaLinki P36941.

Miscellaneous databases

ChiTaRSi LTBR. human.
EvolutionaryTracei P36941.
GeneWikii Lymphotoxin_beta_receptor.
GenomeRNAii 4055.
NextBioi 15888.
PROi P36941.
SOURCEi Search...

Gene expression databases

Bgeei P36941.
CleanExi HS_LTBR.
ExpressionAtlasi P36941. baseline and differential.
Genevestigatori P36941.

Family and domain databases

InterProi IPR001368. TNFR/NGFR_Cys_rich_reg.
IPR017349. TNFR_3_LTBR.
[Graphical view ]
Pfami PF00020. TNFR_c6. 2 hits.
[Graphical view ]
PIRSFi PIRSF037999. TNFR_3_LTBR. 1 hit.
PRINTSi PR01920. TNFACTORR3.
SMARTi SM00208. TNFR. 4 hits.
[Graphical view ]
PROSITEi PS00652. TNFR_NGFR_1. 2 hits.
PS50050. TNFR_NGFR_2. 3 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Construction and evaluation of a hncDNA library of human 12p transcribed sequences derived from a somatic cell hybrid."
    Baens M., Chaffanet M., Cassiman J.-J., van den Berghe H., Marynen P.
    Genomics 16:214-218(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Liver.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Adrenal gland.
  3. "The finished DNA sequence of human chromosome 12."
    Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
    , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
    Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Lung.
  6. Cited for: FUNCTION.
  7. "The cytoplasmic domain of the lymphotoxin-beta receptor mediates cell death in HeLa cells."
    Wu M.-Y., Wang P.-Y., Han S.-H., Hsieh S.-L.
    J. Biol. Chem. 274:11868-11873(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: CHARACTERIZATION.
  8. "The lymphotoxin-beta receptor is necessary and sufficient for LIGHT-mediated apoptosis of tumor cells."
    Rooney I.A., Butrovich K.D., Glass A.A., Borboroglu S., Benedict C.A., Whitbeck J.C., Cohen G.H., Eisenberg R.J., Ware C.F.
    J. Biol. Chem. 275:14307-14315(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  9. "TRAF5, an activator of NF-kappaB and putative signal transducer for the lymphotoxin-beta receptor."
    Nakano H., Oshima H., Chung W., Williams-Abbott L., Ware C.F., Yagita H., Okumura K.
    J. Biol. Chem. 271:14661-14664(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH TRAF3.
  10. "Hepatitis C virus core protein interacts with the cytoplasmic tail of lymphotoxin-beta receptor."
    Matsumoto M., Hsieh T.-Y., Zhu N., VanArsdale T., Hwang S.B., Jeng K.-S., Gorbalenya A.E., Lo S.-Y., Ou J.-H., Ware C.F., Lai M.M.C.
    J. Virol. 71:1301-1309(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH HCV CORE PROTEIN.
  11. "TRAF-4 expression in epithelial progenitor cells. Analysis in normal adult, fetal, and tumor tissues."
    Krajewska M., Krajewski S., Zapata J.M., VanArsdale T., Gascoyne R.D., Berern K., McFadden D., Shabaik A., Hugh J., Reynolds A., Clevenger C.V., Reed J.C.
    Am. J. Pathol. 152:1549-1561(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH TRAF4.
  12. "Cloning and characterization of a cDNA encoding the human homolog of tumor necrosis factor receptor-associated factor 5 (TRAF5)."
    Mizushima S., Fujita M., Ishida T., Azuma S., Kato K., Hirai M., Otsuka M., Yamamoto T., Inoue J.
    Gene 207:135-140(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH TRAF5.
  13. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
    Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
    Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-323, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  14. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.

Entry informationi

Entry nameiTNR3_HUMAN
AccessioniPrimary (citable) accession number: P36941
Secondary accession number(s): B7Z1D2, D3DUR2, F5GXE7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 1, 1994
Last sequence update: June 1, 1994
Last modified: November 26, 2014
This is version 146 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3