Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P36941

- TNR3_HUMAN

UniProt

P36941 - TNR3_HUMAN

Protein

Tumor necrosis factor receptor superfamily member 3

Gene

LTBR

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 144 (01 Oct 2014)
      Sequence version 1 (01 Jun 1994)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Receptor for the heterotrimeric lymphotoxin containing LTA and LTB, and for TNFS14/LIGHT. Promotes apoptosis via TRAF3 and TRAF5. May play a role in the development of lymphoid organs.2 Publications

    GO - Molecular functioni

    1. identical protein binding Source: IntAct
    2. protein binding Source: UniProtKB
    3. ubiquitin protein ligase binding Source: UniProtKB

    GO - Biological processi

    1. apoptotic process Source: UniProtKB-KW
    2. cellular response to mechanical stimulus Source: UniProtKB
    3. positive regulation of extrinsic apoptotic signaling pathway Source: UniProtKB
    4. positive regulation of I-kappaB kinase/NF-kappaB signaling Source: UniProtKB
    5. positive regulation of JNK cascade Source: UniProtKB
    6. signal transduction Source: ProtInc
    7. viral process Source: UniProtKB-KW

    Keywords - Molecular functioni

    Receptor

    Keywords - Biological processi

    Apoptosis, Host-virus interaction

    Enzyme and pathway databases

    SignaLinkiP36941.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Tumor necrosis factor receptor superfamily member 3
    Alternative name(s):
    Lymphotoxin-beta receptor
    Tumor necrosis factor C receptor
    Tumor necrosis factor receptor 2-related protein
    Tumor necrosis factor receptor type III
    Short name:
    TNF-RIII
    Short name:
    TNFR-III
    Gene namesi
    Name:LTBR
    Synonyms:D12S370, TNFCR, TNFR3, TNFRSF3
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 12

    Organism-specific databases

    HGNCiHGNC:6718. LTBR.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA30481.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 3030Sequence AnalysisAdd
    BLAST
    Chaini31 – 435405Tumor necrosis factor receptor superfamily member 3PRO_0000034552Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi40 – 401N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi43 ↔ 58PROSITE-ProRule annotation
    Disulfide bondi59 ↔ 72PROSITE-ProRule annotation
    Disulfide bondi62 ↔ 80PROSITE-ProRule annotation
    Disulfide bondi83 ↔ 98PROSITE-ProRule annotation
    Disulfide bondi101 ↔ 116PROSITE-ProRule annotation
    Disulfide bondi104 ↔ 124PROSITE-ProRule annotation
    Disulfide bondi126 ↔ 132PROSITE-ProRule annotation
    Disulfide bondi139 ↔ 148PROSITE-ProRule annotation
    Disulfide bondi142 ↔ 167PROSITE-ProRule annotation
    Disulfide bondi170 ↔ 185PROSITE-ProRule annotation
    Glycosylationi177 – 1771N-linked (GlcNAc...)Sequence Analysis
    Modified residuei323 – 3231Phosphoserine1 Publication

    Keywords - PTMi

    Disulfide bond, Glycoprotein, Phosphoprotein

    Proteomic databases

    MaxQBiP36941.
    PaxDbiP36941.
    PeptideAtlasiP36941.
    PRIDEiP36941.

    PTM databases

    PhosphoSiteiP36941.

    Expressioni

    Gene expression databases

    ArrayExpressiP36941.
    BgeeiP36941.
    CleanExiHS_LTBR.
    GenevestigatoriP36941.

    Organism-specific databases

    HPAiCAB026202.

    Interactioni

    Subunit structurei

    Self-associates. Associates with TRAF3, TRAF4 and TRAF5. Interacts with HCV core protein.4 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    itself2EBI-3509981,EBI-3509981
    P298465EBI-3509981,EBI-8847394From a different organism.
    ZMYND11Q153265EBI-3509981,EBI-2623509

    Protein-protein interaction databases

    BioGridi110233. 12 interactions.
    DIPiDIP-2928N.
    IntActiP36941. 8 interactions.
    STRINGi9606.ENSP00000228918.

    Structurei

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1RF3X-ray3.50B385-408[»]
    4MXWX-ray3.60R/S41-211[»]
    ProteinModelPortaliP36941.
    SMRiP36941. Positions 43-211.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiP36941.

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini31 – 227197ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini249 – 435187CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei228 – 24821HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati42 – 8140TNFR-Cys 1Add
    BLAST
    Repeati82 – 12443TNFR-Cys 2Add
    BLAST
    Repeati125 – 16844TNFR-Cys 3Add
    BLAST
    Repeati169 – 21143TNFR-Cys 4Add
    BLAST

    Sequence similaritiesi

    Contains 4 TNFR-Cys repeats.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG38845.
    HOGENOMiHOG000294180.
    HOVERGENiHBG023187.
    InParanoidiP36941.
    KOiK03159.
    OMAiTVTGNIY.
    OrthoDBiEOG786H2Q.
    PhylomeDBiP36941.
    TreeFamiTF331157.

    Family and domain databases

    InterProiIPR001368. TNFR/NGFR_Cys_rich_reg.
    IPR017349. TNFR_3_LTBR.
    [Graphical view]
    PfamiPF00020. TNFR_c6. 2 hits.
    [Graphical view]
    PIRSFiPIRSF037999. TNFR_3_LTBR. 1 hit.
    PRINTSiPR01920. TNFACTORR3.
    SMARTiSM00208. TNFR. 4 hits.
    [Graphical view]
    PROSITEiPS00652. TNFR_NGFR_1. 2 hits.
    PS50050. TNFR_NGFR_2. 3 hits.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P36941-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MLLPWATSAP GLAWGPLVLG LFGLLAASQP QAVPPYASEN QTCRDQEKEY    50
    YEPQHRICCS RCPPGTYVSA KCSRIRDTVC ATCAENSYNE HWNYLTICQL 100
    CRPCDPVMGL EEIAPCTSKR KTQCRCQPGM FCAAWALECT HCELLSDCPP 150
    GTEAELKDEV GKGNNHCVPC KAGHFQNTSS PSARCQPHTR CENQGLVEAA 200
    PGTAQSDTTC KNPLEPLPPE MSGTMLMLAV LLPLAFFLLL ATVFSCIWKS 250
    HPSLCRKLGS LLKRRPQGEG PNPVAGSWEP PKAHPYFPDL VQPLLPISGD 300
    VSPVSTGLPA APVLEAGVPQ QQSPLDLTRE PQLEPGEQSQ VAHGTNGIHV 350
    TGGSMTITGN IYIYNGPVLG GPPGPGDLPA TPEPPYPIPE EGDPGPPGLS 400
    TPHQEDGKAW HLAETEHCGA TPSNRGPRNQ FITHD 435
    Length:435
    Mass (Da):46,709
    Last modified:June 1, 1994 - v1
    Checksum:i624626E6022F656F
    GO
    Isoform 2 (identifier: P36941-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-32: MLLPWATSAPGLAWGPLVLGLFGLLAASQPQA → MEATGISLASQLK

    Note: No experimental confirmation available.

    Show »
    Length:416
    Mass (Da):44,810
    Checksum:i43DF8C86945A0F3E
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti76 – 761R → W in BAH11468. (PubMed:14702039)Curated
    Sequence conflicti410 – 4101W → R in BAH11468. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti274 – 2741V → I.
    Corresponds to variant rs35681405 [ dbSNP | Ensembl ].
    VAR_052346

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 3232MLLPW…SQPQA → MEATGISLASQLK in isoform 2. 1 PublicationVSP_047533Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L04270 mRNA. Translation: AAA36757.1.
    AK293187 mRNA. Translation: BAH11468.1.
    AC005840 Genomic DNA. No translation available.
    CH471116 Genomic DNA. Translation: EAW88801.1.
    CH471116 Genomic DNA. Translation: EAW88802.1.
    BC026262 mRNA. Translation: AAH26262.1.
    CCDSiCCDS59233.1. [P36941-2]
    CCDS8544.1. [P36941-1]
    PIRiI54182.
    RefSeqiNP_001257916.1. NM_001270987.1. [P36941-2]
    NP_002333.1. NM_002342.2. [P36941-1]
    UniGeneiHs.1116.

    Genome annotation databases

    GeneIDi4055.
    KEGGihsa:4055.
    UCSCiuc001qny.2. human. [P36941-1]

    Polymorphism databases

    DMDMi549090.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L04270 mRNA. Translation: AAA36757.1 .
    AK293187 mRNA. Translation: BAH11468.1 .
    AC005840 Genomic DNA. No translation available.
    CH471116 Genomic DNA. Translation: EAW88801.1 .
    CH471116 Genomic DNA. Translation: EAW88802.1 .
    BC026262 mRNA. Translation: AAH26262.1 .
    CCDSi CCDS59233.1. [P36941-2 ]
    CCDS8544.1. [P36941-1 ]
    PIRi I54182.
    RefSeqi NP_001257916.1. NM_001270987.1. [P36941-2 ]
    NP_002333.1. NM_002342.2. [P36941-1 ]
    UniGenei Hs.1116.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1RF3 X-ray 3.50 B 385-408 [» ]
    4MXW X-ray 3.60 R/S 41-211 [» ]
    ProteinModelPortali P36941.
    SMRi P36941. Positions 43-211.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 110233. 12 interactions.
    DIPi DIP-2928N.
    IntActi P36941. 8 interactions.
    STRINGi 9606.ENSP00000228918.

    Chemistry

    ChEMBLi CHEMBL1250360.
    GuidetoPHARMACOLOGYi 1872.

    PTM databases

    PhosphoSitei P36941.

    Polymorphism databases

    DMDMi 549090.

    Proteomic databases

    MaxQBi P36941.
    PaxDbi P36941.
    PeptideAtlasi P36941.
    PRIDEi P36941.

    Protocols and materials databases

    DNASUi 4055.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    GeneIDi 4055.
    KEGGi hsa:4055.
    UCSCi uc001qny.2. human. [P36941-1 ]

    Organism-specific databases

    CTDi 4055.
    GeneCardsi GC12P006467.
    HGNCi HGNC:6718. LTBR.
    HPAi CAB026202.
    MIMi 600979. gene.
    neXtProti NX_P36941.
    PharmGKBi PA30481.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG38845.
    HOGENOMi HOG000294180.
    HOVERGENi HBG023187.
    InParanoidi P36941.
    KOi K03159.
    OMAi TVTGNIY.
    OrthoDBi EOG786H2Q.
    PhylomeDBi P36941.
    TreeFami TF331157.

    Enzyme and pathway databases

    SignaLinki P36941.

    Miscellaneous databases

    ChiTaRSi LTBR. human.
    EvolutionaryTracei P36941.
    GeneWikii Lymphotoxin_beta_receptor.
    GenomeRNAii 4055.
    NextBioi 15888.
    PROi P36941.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P36941.
    Bgeei P36941.
    CleanExi HS_LTBR.
    Genevestigatori P36941.

    Family and domain databases

    InterProi IPR001368. TNFR/NGFR_Cys_rich_reg.
    IPR017349. TNFR_3_LTBR.
    [Graphical view ]
    Pfami PF00020. TNFR_c6. 2 hits.
    [Graphical view ]
    PIRSFi PIRSF037999. TNFR_3_LTBR. 1 hit.
    PRINTSi PR01920. TNFACTORR3.
    SMARTi SM00208. TNFR. 4 hits.
    [Graphical view ]
    PROSITEi PS00652. TNFR_NGFR_1. 2 hits.
    PS50050. TNFR_NGFR_2. 3 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Construction and evaluation of a hncDNA library of human 12p transcribed sequences derived from a somatic cell hybrid."
      Baens M., Chaffanet M., Cassiman J.-J., van den Berghe H., Marynen P.
      Genomics 16:214-218(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Liver.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Adrenal gland.
    3. "The finished DNA sequence of human chromosome 12."
      Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
      , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
      Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Lung.
    6. Cited for: FUNCTION.
    7. "The cytoplasmic domain of the lymphotoxin-beta receptor mediates cell death in HeLa cells."
      Wu M.-Y., Wang P.-Y., Han S.-H., Hsieh S.-L.
      J. Biol. Chem. 274:11868-11873(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: CHARACTERIZATION.
    8. "The lymphotoxin-beta receptor is necessary and sufficient for LIGHT-mediated apoptosis of tumor cells."
      Rooney I.A., Butrovich K.D., Glass A.A., Borboroglu S., Benedict C.A., Whitbeck J.C., Cohen G.H., Eisenberg R.J., Ware C.F.
      J. Biol. Chem. 275:14307-14315(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.
    9. "TRAF5, an activator of NF-kappaB and putative signal transducer for the lymphotoxin-beta receptor."
      Nakano H., Oshima H., Chung W., Williams-Abbott L., Ware C.F., Yagita H., Okumura K.
      J. Biol. Chem. 271:14661-14664(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH TRAF3.
    10. "Hepatitis C virus core protein interacts with the cytoplasmic tail of lymphotoxin-beta receptor."
      Matsumoto M., Hsieh T.-Y., Zhu N., VanArsdale T., Hwang S.B., Jeng K.-S., Gorbalenya A.E., Lo S.-Y., Ou J.-H., Ware C.F., Lai M.M.C.
      J. Virol. 71:1301-1309(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH HCV CORE PROTEIN.
    11. "TRAF-4 expression in epithelial progenitor cells. Analysis in normal adult, fetal, and tumor tissues."
      Krajewska M., Krajewski S., Zapata J.M., VanArsdale T., Gascoyne R.D., Berern K., McFadden D., Shabaik A., Hugh J., Reynolds A., Clevenger C.V., Reed J.C.
      Am. J. Pathol. 152:1549-1561(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH TRAF4.
    12. "Cloning and characterization of a cDNA encoding the human homolog of tumor necrosis factor receptor-associated factor 5 (TRAF5)."
      Mizushima S., Fujita M., Ishida T., Azuma S., Kato K., Hirai M., Otsuka M., Yamamoto T., Inoue J.
      Gene 207:135-140(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH TRAF5.
    13. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
      Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
      Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-323, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    14. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.

    Entry informationi

    Entry nameiTNR3_HUMAN
    AccessioniPrimary (citable) accession number: P36941
    Secondary accession number(s): B7Z1D2, D3DUR2, F5GXE7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 1, 1994
    Last sequence update: June 1, 1994
    Last modified: October 1, 2014
    This is version 144 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 12
      Human chromosome 12: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3