P36896 (ACV1B_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 154.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Activin receptor type-1B EC=2.7.11.30 Alternative name(s): Activin receptor type IB Short name=ACTR-IB Activin receptor-like kinase 4 Short name=ALK-4 Serine/threonine-protein kinase receptor R2 Short name=SKR2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 505 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Transmembrane serine/threonine kinase activin type-1 receptor forming an activin receptor complex with activin receptor type-2 (ACVR2A or ACVR2B). Transduces the activin signal from the cell surface to the cytoplasm and is thus regulating a many physiological and pathological processes including neuronal differentiation and neuronal survival, hair follicle development and cycling, FSH production by the pituitary gland, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. Activin is also thought to have a paracrine or autocrine role in follicular development in the ovary. Within the receptor complex, type-2 receptors (ACVR2A and/or ACVR2B) act as a primary activin receptors whereas the type-1 receptors like ACVR1B act as downstream transducers of activin signals. Activin binds to type-2 receptor at the plasma membrane and activates its serine-threonine kinase. The activated receptor type-2 then phosphorylates and activates the type-1 receptor such as ACVR1B. Once activated, the type-1 receptor binds and phosphorylates the SMAD proteins SMAD2 and SMAD3, on serine residues of the C-terminal tail. Soon after their association with the activin receptor and subsequent phosphorylation, SMAD2 and SMAD3 are released into the cytoplasm where they interact with the common partner SMAD4. This SMAD complex translocates into the nucleus where it mediates activin-induced transcription. Inhibitory SMAD7, which is recruited to ACVR1B through FKBP1A, can prevent the association of SMAD2 and SMAD3 with the activin receptor complex, thereby blocking the activin signal. Activin signal transduction is also antagonized by the binding to the receptor of inhibin-B via the IGSF1 inhibin coreceptor. ACVR1B also phosphorylates TDP2. Ref.2 Ref.9 Ref.10 Ref.13 Ref.16 Ref.19 Ref.20 |
| Catalytic activity | ATP + [receptor-protein] = ADP + [receptor-protein] phosphate. |
| Cofactor | Magnesium or manganese By similarity. |
| Enzyme regulation | Activin receptor type-2 (ACVR2A or ACVR2B) activates the type-1 receptor through phosphorylation of its regulatory GS domain. Ref.11 Ref.14 |
| Subunit structure | Forms an activin receptor complex with activin receptor type-2 (ACVR2A or ACVR2B). Interacts with TDP2 By similarity. Interacts with AIP1, FKBP1A, IGSF1, TDGF1, SMAD2, SMAD3 and SMAD7. Ref.2 Ref.8 Ref.9 Ref.10 Ref.11 Ref.12 Ref.14 Ref.18 |
| Subcellular location | Cell membrane; Single-pass type I membrane protein By similarity. |
| Tissue specificity | Expressed in many tissues, most strongly in kidney, pancreas, brain, lung, and liver. |
| Domain | The GS domain is a 30-amino-acid sequence adjacent to the N-terminal boundary of the kinase domain and highly conserved in all other known type-1 receptors but not in type-2 receptors. The GS domain is the site of activation through phosphorylation by the II receptors. Ref.8 |
| Post-translational modification | Autophosphorylated. Phosphorylated by activin receptor type-2 (ACVR2A or ACVR2B) in response to activin-binding at serine and threonine residues in the GS domain. Phosphorylation of ACVR1B by activin receptor type-2 regulates association with SMAD7. Ref.8 Ref.12 Ref.13 Ref.15 Ref.19 Ubiquitinated. Level of ubiquitination is regulated by the SMAD7-SMURF1 complex. Ref.18 |
| Involvement in disease | ACVRIB is abundantly expressed in systemic sclerosis patient fibroblasts and production of collagen is also induced by activin-A/INHBA. This suggests that the activin/ACRV1B signaling mechanism is involved in systemic sclerosis. |
| Sequence similarities | Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily. Contains 1 GS domain. Contains 1 protein kinase domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| HSP90AB1 | P08238 | 2 | EBI-1384128,EBI-352572 |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P36896-1) Also known as: SKR2-1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P36896-2) Also known as: SKR2-2; The sequence of this isoform differs from the canonical sequence as follows: 465-505: ALRVMGKMMRECWYANGAARLTALRIKKTLSQLSVQEDVKI → VRSWPPAAFPSA | ||||||
| Isoform 3 (identifier: P36896-3) Also known as: SKR2-3; The sequence of this isoform differs from the canonical sequence as follows: 422-505: VHEEYQLPYY...QLSVQEDVKI → TFLFCLCSYL...RLFFRDQFVE | ||||||
| Isoform 4 (identifier: P36896-4) The sequence of this isoform differs from the canonical sequence as follows: 271-271: D → ADCSFLTLPWEVVMVSAAPKLRSLRLQYKGGRGRARFLFPLN | ||||||
| Isoform 5 (identifier: P36896-5) The sequence of this isoform differs from the canonical sequence as follows: 1-52: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 23 | 23 | Potential | ||||||
| Chain | 24 – 505 | 482 | Activin receptor type-1B | PRO_0000024417 | |||||
Regions | |||||||||
| Topological domain | 24 – 126 | 103 | Extracellular Potential | ||||||
| Transmembrane | 127 – 149 | 23 | Helical; Potential | ||||||
| Topological domain | 150 – 505 | 356 | Cytoplasmic Potential | ||||||
| Domain | 177 – 206 | 30 | GS | ||||||
| Domain | 207 – 497 | 291 | Protein kinase | ||||||
| Nucleotide binding | 213 – 221 | 9 | ATP By similarity | ||||||
Sites | |||||||||
| Active site | 335 | 1 | Proton acceptor By similarity | ||||||
| Binding site | 234 | 1 | ATP By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 380 | 1 | Phosphotyrosine Ref.15 | ||||||
| Glycosylation | 43 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 52 | 52 | Missing in isoform 5. | VSP_041841 | |||||
| Alternative sequence | 271 | 1 | D → ADCSFLTLPWEVVMVSAAPK LRSLRLQYKGGRGRARFLFP LN in isoform 4. | VSP_041842 | |||||
| Alternative sequence | 422 – 505 | 84 | VHEEY…EDVKI → TFLFCLCSYLPFQDAGSPKA VLLPPFFLQPVGCLLPEPES SFKVAIKGVEVAVLRVRLFF RDQFVE in isoform 3. | VSP_004953 | |||||
| Alternative sequence | 465 – 505 | 41 | ALRVM…EDVKI → VRSWPPAAFPSA in isoform 2. | VSP_004954 | |||||
| Natural variant | 146 | 1 | F → L. Ref.22 Corresponds to variant rs34488074 [ dbSNP | Ensembl ]. | VAR_041406 | |||||
| Natural variant | 408 | 1 | L → V. Corresponds to variant rs928906 [ dbSNP | Ensembl ]. | VAR_011716 | |||||
| Isoform 3: | |||||||||
| Natural variant | 478 | 1 | R → H. | ||||||
Experimental info | |||||||||
| Mutagenesis | 40 | 1 | L → A: Increases binding to activin. Ref.17 | ||||||
| Mutagenesis | 70 | 1 | I → A: Decreases binding to activin. Ref.17 | ||||||
| Mutagenesis | 73 | 1 | V → A: Increases binding to activin. Ref.17 | ||||||
| Mutagenesis | 75 | 1 | L → A: Decreases binding to activin. Ref.17 | ||||||
| Mutagenesis | 77 | 1 | P → A: Decreases binding to activin. Ref.17 | ||||||
| Mutagenesis | 206 | 1 | T → V: Leads to constitutive activation. Ref.8 | ||||||
| Sequence conflict | 56 | 1 | I → F in AAA60555. Ref.3 | ||||||
| Sequence conflict | 56 | 1 | I → F in AAA60556. Ref.3 | ||||||
| Sequence conflict | 222 – 223 | 2 | WR → MA in AAA60555. Ref.3 | ||||||
| Sequence conflict | 222 – 223 | 2 | WR → MA in AAA60556. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Activin receptor-like kinases: a novel subclass of cell-surface receptors with predicted serine/threonine kinase activity." ten Dijke P., Ichijo H., Franzen P., Schulz P., Saras J., Toyoshima H., Heldin C.-H., Miyazono K. Oncogene 8:2879-2887(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Placenta. |
| [2] | "Type I receptors specify growth-inhibitory and transcriptional responses to transforming growth factor beta and activin." Carcamo J., Weis F.M., Ventura F., Wieser R., Wrana J.L., Attisano L., Massague J. Mol. Cell. Biol. 14:3810-3821(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), IDENTIFICATION IN A ACTIVIN RECEPTOR COMPLEX, ACTIVIN-BINDING, FUNCTION. Tissue: Kidney. |
| [3] | "Genomic structure and cloned cDNAs predict that four variants in the kinase domain of serine/threonine kinase receptors arise by alternative splicing and poly(A) addition." Xu J., Matsuzaki K., McKeehan K., Wang F., Kan M., McKeehan W.L. Proc. Natl. Acad. Sci. U.S.A. 91:7957-7961(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 2 AND 3), ALTERNATIVE SPLICING. Tissue: Liver. |
| [4] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4 AND 5). |
| [6] | "The finished DNA sequence of human chromosome 12." Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. Gibbs R.A.Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain and Eye. |
| [8] | "Activation of signalling by the activin receptor complex." Attisano L., Wrana J.L., Montalvo E., Massague J. Mol. Cell. Biol. 16:1066-1073(1996) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH ACVR2B, PHOSPHORYLATION BY ACVR2B, DOMAIN GS, MUTAGENESIS OF THR-206. |
| [9] | "Activin and inhibin have antagonistic effects on ligand-dependent heteromerization of the type I and type II activin receptors and human erythroid differentiation." Lebrun J.J., Vale W.W. Mol. Cell. Biol. 17:1682-1691(1997) [PubMed] [Europe PMC] [Abstract] Cited for: SUBUNIT, FUNCTION. |
| [10] | "Roles of pathway-specific and inhibitory Smads in activin receptor signaling." Lebrun J.J., Takabe K., Chen Y., Vale W. Mol. Endocrinol. 13:15-23(1999) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SMAD2; SMAD3 AND SMAD7, FUNCTION. |
| [11] | "Modulation of activin signal transduction by inhibin B and inhibin-binding protein (INhBP)." Chapman S.C., Woodruff T.K. Mol. Endocrinol. 15:668-679(2001) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH IGSF1, ENZYME REGULATION. |
| [12] | "Phosphorylation regulation of the interaction between Smad7 and activin type I receptor." Liu X., Nagarajan R.P., Vale W., Chen Y. FEBS Lett. 519:93-98(2002) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION, INTERACTION WITH SMAD7. |
| [13] | "Overexpression of wild-type activin receptor alk4-1 restores activin antiproliferative effects in human pituitary tumor cells." Danila D.C., Zhang X., Zhou Y., Haidar J.N., Klibanski A. J. Clin. Endocrinol. Metab. 87:4741-4746(2002) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, PHOSPHORYLATION. |
| [14] | "Cripto-1 activates nodal- and ALK4-dependent and -independent signaling pathways in mammary epithelial Cells." Bianco C., Adkins H.B., Wechselberger C., Seno M., Normanno N., De Luca A., Sun Y., Khan N., Kenney N., Ebert A., Williams K.P., Sanicola M., Salomon D.S. Mol. Cell. Biol. 22:2586-2597(2002) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH TDGF1, ENZYME REGULATION. |
| [15] | "Identification of the phosphotyrosine proteome from thrombin activated platelets." Maguire P.B., Wynne K.J., Harney D.F., O'Donoghue N.M., Stephens G., Fitzgerald D.J. Proteomics 2:642-648(2002) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT TYR-380. |
| [16] | "Activin signaling through type IB activin receptor stimulates aromatase activity in the ovarian granulosa cell-like human granulosa (KGN) cells." Mukasa C., Nomura M., Tanaka T., Tanaka K., Nishi Y., Okabe T., Goto K., Yanase T., Nawata H. Endocrinology 144:1603-1611(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [17] | "Identification of a functional binding site for activin on the type I receptor ALK4." Harrison C.A., Gray P.C., Koerber S.C., Fischer W., Vale W. J. Biol. Chem. 278:21129-21135(2003) [PubMed] [Europe PMC] [Abstract] Cited for: MUTAGENESIS OF LEU-40; ILE-70; VAL-73; LEU-75 AND PRO-77, ACTIVIN-BINDING. |
| [18] | "FKBP12 functions as an adaptor of the Smad7-Smurf1 complex on activin type I receptor." Yamaguchi T., Kurisaki A., Yamakawa N., Minakuchi K., Sugino H. J. Mol. Endocrinol. 36:569-579(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH FKBP1A AND SMAD7, UBIQUITINATION. |
| [19] | "Ttrap is an essential modulator of Smad3-dependent Nodal signaling during zebrafish gastrulation and left-right axis determination." Esguerra C.V., Nelles L., Vermeire L., Ibrahimi A., Crawford A.D., Derua R., Janssens E., Waelkens E., Carmeliet P., Collen D., Huylebroeck D. Development 134:4381-4393(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, AUTOPHOSPHORYLATION. |
| [20] | "Activin A induces neuronal differentiation and survival via ALK4 in a SMAD-independent manner in a subpopulation of human neuroblastomas." Suzuki K., Kobayashi T., Funatsu O., Morita A., Ikekita M. Biochem. Biophys. Res. Commun. 394:639-645(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [21] | "Activation of the activin A-ALK-Smad pathway in systemic sclerosis." Takagi K., Kawaguchi Y., Kawamoto M., Ota Y., Tochimoto A., Gono T., Katsumata Y., Takagi M., Hara M., Yamanaka H. J. Autoimmun. 36:181-188(2011) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN SYSTEMIC SCLEROSIS. |
| [22] | "Patterns of somatic mutation in human cancer genomes." Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. Stratton M.R.Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] LEU-146, VARIANT [LARGE SCALE ANALYSIS] HIS-478 (ISOFORM 3). |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | Z22536 mRNA. Translation: CAA80258.1. U14722 mRNA. Translation: AAA50246.1. L10125 mRNA. Translation: AAA60555.1. L10126 mRNA. Translation: AAA60556.1. L31848 Genomic DNA. Translation: AAA53349.1. L31848 Genomic DNA. Translation: AAA53350.1. L31848 Genomic DNA. Translation: AAA53351.1. BT007072 mRNA. Translation: AAP35735.1. AK299120 mRNA. Translation: BAH12954.1. AK299496 mRNA. Translation: BAH13051.1. AC025259 Genomic DNA. No translation available. BC000254 mRNA. Translation: AAH00254.1. BC040531 mRNA. Translation: AAH40531.1. |
| IPI | IPI00005732. IPI00218980. IPI00297220. |
| PIR | I38859. I80182. I80183. |
| RefSeq | NP_004293.1. NM_004302.4. NP_064732.3. NM_020327.3. NP_064733.3. NM_020328.3. |
| UniGene | Hs.438918. |
3D structure databases | |
| ProteinModelPortal | P36896. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-427N. |
| IntAct | P36896. 5 interactions. |
| STRING | 9606.ENSP00000257963. |
PTM databases | |
| PhosphoSite | P36896. |
Polymorphism databases | |
| DMDM | 547775. |
Proteomic databases | |
| PaxDb | P36896. |
| PRIDE | P36896. |
Protocols and materials databases | |
| DNASU | 91. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000257963; ENSP00000257963; ENSG00000135503. ENST00000415850; ENSP00000397550; ENSG00000135503. ENST00000426655; ENSP00000390477; ENSG00000135503. ENST00000541224; ENSP00000442656; ENSG00000135503. ENST00000542485; ENSP00000442885; ENSG00000135503. ENST00000563546; ENSP00000456299; ENSG00000135503. |
| GeneID | 91. |
| KEGG | hsa:91. |
| UCSC | uc001rzl.3. human. uc001rzm.3. human. uc001rzn.3. human. uc010snn.2. human. |
Organism-specific databases | |
| CTD | 91. |
| GeneCards | GC12P052375. |
| HGNC | HGNC:172. ACVR1B. |
| MIM | 601300. gene. |
| neXtProt | NX_P36896. |
| PharmGKB | PA24493. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0515. |
| HOGENOM | HOG000230587. |
| HOVERGEN | HBG054502. |
| InParanoid | P36896. |
| KO | K13567. |
| OMA | HHQRVYH. |
| OrthoDB | EOG4FJ88P. |
| PhylomeDB | P36896. |
Enzyme and pathway databases | |
| BRENDA | 2.7.10.2. 2681. |
| Reactome | REACT_111045. Developmental Biology. REACT_111102. Signal Transduction. |
| SignaLink | P36896. |
Gene expression databases | |
| ArrayExpress | P36896. |
| Bgee | P36896. |
| CleanEx | HS_ACVR1B. |
| Genevestigator | P36896. |
Family and domain databases | |
| InterPro | IPR000472. Activin_rcpt. IPR011009. Kinase-like_dom. IPR000719. Prot_kinase_cat_dom. IPR017441. Protein_kinase_ATP_BS. IPR008271. Ser/Thr_kinase_AS. IPR003605. TGF_beta_rcpt_GS. [Graphical view] |
| Pfam | PF01064. Activin_recp. 1 hit. PF00069. Pkinase. 1 hit. PF08515. TGF_beta_GS. 1 hit. [Graphical view] |
| SMART | SM00467. GS. 1 hit. [Graphical view] |
| SUPFAM | SSF56112. Kinase_like. 1 hit. |
| PROSITE | PS51256. GS. 1 hit. PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | P36896. |
| ChEMBL | CHEMBL5310. |
| DrugBank | DB00171. Adenosine triphosphate. |
| GenomeRNAi | 91. |
| NextBio | 339. |
| SOURCE | Search... |
Entry information
| Entry name | ACV1B_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P36896 Secondary accession number(s): B7Z5L8 Q15482 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
