Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Activin receptor type-1B

Gene

ACVR1B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Transmembrane serine/threonine kinase activin type-1 receptor forming an activin receptor complex with activin receptor type-2 (ACVR2A or ACVR2B). Transduces the activin signal from the cell surface to the cytoplasm and is thus regulating a many physiological and pathological processes including neuronal differentiation and neuronal survival, hair follicle development and cycling, FSH production by the pituitary gland, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. Activin is also thought to have a paracrine or autocrine role in follicular development in the ovary. Within the receptor complex, type-2 receptors (ACVR2A and/or ACVR2B) act as a primary activin receptors whereas the type-1 receptors like ACVR1B act as downstream transducers of activin signals. Activin binds to type-2 receptor at the plasma membrane and activates its serine-threonine kinase. The activated receptor type-2 then phosphorylates and activates the type-1 receptor such as ACVR1B. Once activated, the type-1 receptor binds and phosphorylates the SMAD proteins SMAD2 and SMAD3, on serine residues of the C-terminal tail. Soon after their association with the activin receptor and subsequent phosphorylation, SMAD2 and SMAD3 are released into the cytoplasm where they interact with the common partner SMAD4. This SMAD complex translocates into the nucleus where it mediates activin-induced transcription. Inhibitory SMAD7, which is recruited to ACVR1B through FKBP1A, can prevent the association of SMAD2 and SMAD3 with the activin receptor complex, thereby blocking the activin signal. Activin signal transduction is also antagonized by the binding to the receptor of inhibin-B via the IGSF1 inhibin coreceptor. ACVR1B also phosphorylates TDP2.7 Publications

Catalytic activityi

ATP + [receptor-protein] = ADP + [receptor-protein] phosphate.

Cofactori

Mg2+By similarity, Mn2+By similarity

Enzyme regulationi

Activin receptor type-2 (ACVR2A or ACVR2B) activates the type-1 receptor through phosphorylation of its regulatory GS domain.2 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei234ATPPROSITE-ProRule annotation1
Active sitei335Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi213 – 221ATPPROSITE-ProRule annotation9

GO - Molecular functioni

  • activin receptor activity, type I Source: UniProtKB
  • ATP binding Source: HGNC
  • inhibin binding Source: BHF-UCL
  • metal ion binding Source: UniProtKB-KW
  • protein serine/threonine kinase activity Source: UniProtKB
  • receptor signaling protein serine/threonine kinase activity Source: Ensembl
  • SMAD binding Source: HGNC
  • transmembrane receptor protein serine/threonine kinase activity Source: HGNC
  • ubiquitin protein ligase binding Source: BHF-UCL

GO - Biological processi

  • activin receptor signaling pathway Source: UniProtKB
  • central nervous system development Source: Ensembl
  • development of primary female sexual characteristics Source: Ensembl
  • extrinsic apoptotic signaling pathway Source: BHF-UCL
  • G1/S transition of mitotic cell cycle Source: HGNC
  • hair follicle development Source: Ensembl
  • in utero embryonic development Source: Ensembl
  • negative regulation of cell growth Source: HGNC
  • negative regulation of gene expression Source: Ensembl
  • nodal signaling pathway Source: UniProtKB
  • peptidyl-threonine phosphorylation Source: UniProtKB
  • positive regulation of activin receptor signaling pathway Source: BHF-UCL
  • positive regulation of erythrocyte differentiation Source: HGNC
  • positive regulation of pathway-restricted SMAD protein phosphorylation Source: Ensembl
  • positive regulation of transcription from RNA polymerase II promoter Source: Ensembl
  • positive regulation of trophoblast cell migration Source: BHF-UCL
  • protein autophosphorylation Source: UniProtKB
  • protein phosphorylation Source: HGNC
  • regulation of transcription, DNA-templated Source: HGNC
  • signal transduction Source: HGNC
  • transmembrane receptor protein serine/threonine kinase signaling pathway Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Receptor, Serine/threonine-protein kinase, Transferase

Keywords - Ligandi

ATP-binding, Magnesium, Manganese, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyciZFISH:HS06021-MONOMER.
BRENDAi2.7.10.2. 2681.
ReactomeiR-HSA-1181150. Signaling by NODAL.
R-HSA-1433617. Regulation of signaling by NODAL.
R-HSA-1502540. Signaling by Activin.
SignaLinkiP36896.
SIGNORiP36896.

Names & Taxonomyi

Protein namesi
Recommended name:
Activin receptor type-1B (EC:2.7.11.30)
Alternative name(s):
Activin receptor type IB
Short name:
ACTR-IB
Activin receptor-like kinase 4
Short name:
ALK-4
Serine/threonine-protein kinase receptor R2
Short name:
SKR2
Gene namesi
Name:ACVR1B
Synonyms:ACVRLK4, ALK4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

HGNCiHGNC:172. ACVR1B.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini24 – 126ExtracellularSequence analysisAdd BLAST103
Transmembranei127 – 149HelicalSequence analysisAdd BLAST23
Topological domaini150 – 505CytoplasmicSequence analysisAdd BLAST356

GO - Cellular componenti

  • activin receptor complex Source: BHF-UCL
  • cell surface Source: HGNC
  • extracellular exosome Source: UniProtKB
  • integral component of plasma membrane Source: HGNC
  • plasma membrane Source: Reactome
  • receptor complex Source: BHF-UCL
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Involvement in diseasei

ACVRIB is abundantly expressed in systemic sclerosis patient fibroblasts and production of collagen is also induced by activin-A/INHBA. This suggests that the activin/ACRV1B signaling mechanism is involved in systemic sclerosis.

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi40L → A: Increases binding to activin. 1 Publication1
Mutagenesisi70I → A: Decreases binding to activin. 1 Publication1
Mutagenesisi73V → A: Increases binding to activin. 1 Publication1
Mutagenesisi75L → A: Decreases binding to activin. 1 Publication1
Mutagenesisi77P → A: Decreases binding to activin. 1 Publication1
Mutagenesisi206T → V: Leads to constitutive activation. 1 Publication1

Organism-specific databases

DisGeNETi91.
MalaCardsiACVR1B.
OpenTargetsiENSG00000135503.
PharmGKBiPA24493.

Chemistry databases

ChEMBLiCHEMBL5310.
DrugBankiDB00171. Adenosine triphosphate.
GuidetoPHARMACOLOGYi1787.

Polymorphism and mutation databases

BioMutaiACVR1B.
DMDMi547775.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 23Sequence analysisAdd BLAST23
ChainiPRO_000002441724 – 505Activin receptor type-1BAdd BLAST482

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi43N-linked (GlcNAc...)Sequence analysis1
Modified residuei380Phosphotyrosine1 Publication1

Post-translational modificationi

Autophosphorylated. Phosphorylated by activin receptor type-2 (ACVR2A or ACVR2B) in response to activin-binding at serine and threonine residues in the GS domain. Phosphorylation of ACVR1B by activin receptor type-2 regulates association with SMAD7.4 Publications
Ubiquitinated. Level of ubiquitination is regulated by the SMAD7-SMURF1 complex.
Ubiquitinated.

Keywords - PTMi

Glycoprotein, Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQBiP36896.
PeptideAtlasiP36896.
PRIDEiP36896.

PTM databases

iPTMnetiP36896.
PhosphoSitePlusiP36896.

Expressioni

Tissue specificityi

Expressed in many tissues, most strongly in kidney, pancreas, brain, lung, and liver.

Gene expression databases

BgeeiENSG00000135503.
CleanExiHS_ACVR1B.
ExpressionAtlasiP36896. baseline and differential.
GenevisibleiP36896. HS.

Organism-specific databases

HPAiCAB026126.
HPA063761.

Interactioni

Subunit structurei

Forms an activin receptor complex with activin receptor type-2 (ACVR2A or ACVR2B). Interacts with TDP2 (By similarity). Interacts with AIP1, FKBP1A, IGSF1, TDGF1, SMAD2, SMAD3 and SMAD7.By similarity8 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
FKBP1AP629422EBI-1384128,EBI-1027571
HSP90AB1P082382EBI-1384128,EBI-352572
SMAD7O151052EBI-1384128,EBI-3861591

GO - Molecular functioni

  • inhibin binding Source: BHF-UCL
  • SMAD binding Source: HGNC
  • ubiquitin protein ligase binding Source: BHF-UCL

Protein-protein interaction databases

BioGridi106606. 45 interactors.
DIPiDIP-427N.
IntActiP36896. 13 interactors.

Chemistry databases

BindingDBiP36896.

Structurei

3D structure databases

ProteinModelPortaliP36896.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini177 – 206GSPROSITE-ProRule annotationAdd BLAST30
Domaini207 – 497Protein kinasePROSITE-ProRule annotationAdd BLAST291

Domaini

The GS domain is a 30-amino-acid sequence adjacent to the N-terminal boundary of the kinase domain and highly conserved in all other known type-1 receptors but not in type-2 receptors. The GS domain is the site of activation through phosphorylation by the II receptors.1 Publication

Sequence similaritiesi

Contains 1 GS domain.PROSITE-ProRule annotation
Contains 1 protein kinase domain.PROSITE-ProRule annotation

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

GeneTreeiENSGT00760000118876.
HOGENOMiHOG000230587.
HOVERGENiHBG054502.
InParanoidiP36896.
KOiK13567.
OMAiQCACTSC.
OrthoDBiEOG091G0BIU.
PhylomeDBiP36896.
TreeFamiTF314724.

Family and domain databases

InterProiIPR000472. Activin_recp.
IPR003605. GS_dom.
IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR008271. Ser/Thr_kinase_AS.
IPR000333. TGFB_receptor.
[Graphical view]
PANTHERiPTHR23255. PTHR23255. 1 hit.
PfamiPF01064. Activin_recp. 1 hit.
PF00069. Pkinase. 1 hit.
PF08515. TGF_beta_GS. 1 hit.
[Graphical view]
SMARTiSM00467. GS. 1 hit.
SM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMiSSF56112. SSF56112. 1 hit.
PROSITEiPS51256. GS. 1 hit.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P36896-1) [UniParc]FASTAAdd to basket
Also known as: SKR2-1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAESAGASSF FPLVVLLLAG SGGSGPRGVQ ALLCACTSCL QANYTCETDG
60 70 80 90 100
ACMVSIFNLD GMEHHVRTCI PKVELVPAGK PFYCLSSEDL RNTHCCYTDY
110 120 130 140 150
CNRIDLRVPS GHLKEPEHPS MWGPVELVGI IAGPVFLLFL IIIIVFLVIN
160 170 180 190 200
YHQRVYHNRQ RLDMEDPSCE MCLSKDKTLQ DLVYDLSTSG SGSGLPLFVQ
210 220 230 240 250
RTVARTIVLQ EIIGKGRFGE VWRGRWRGGD VAVKIFSSRE ERSWFREAEI
260 270 280 290 300
YQTVMLRHEN ILGFIAADNK DNGTWTQLWL VSDYHEHGSL FDYLNRYTVT
310 320 330 340 350
IEGMIKLALS AASGLAHLHM EIVGTQGKPG IAHRDLKSKN ILVKKNGMCA
360 370 380 390 400
IADLGLAVRH DAVTDTIDIA PNQRVGTKRY MAPEVLDETI NMKHFDSFKC
410 420 430 440 450
ADIYALGLVY WEIARRCNSG GVHEEYQLPY YDLVPSDPSI EEMRKVVCDQ
460 470 480 490 500
KLRPNIPNWW QSYEALRVMG KMMRECWYAN GAARLTALRI KKTLSQLSVQ

EDVKI
Length:505
Mass (Da):56,807
Last modified:June 1, 1994 - v1
Checksum:i40A6C65CAA4C7573
GO
Isoform 2 (identifier: P36896-2) [UniParc]FASTAAdd to basket
Also known as: SKR2-2

The sequence of this isoform differs from the canonical sequence as follows:
     465-505: ALRVMGKMMRECWYANGAARLTALRIKKTLSQLSVQEDVKI → VRSWPPAAFPSA

Show »
Length:476
Mass (Da):53,411
Checksum:i13269BD6D04F39D3
GO
Isoform 3 (identifier: P36896-3) [UniParc]FASTAAdd to basket
Also known as: SKR2-3

The sequence of this isoform differs from the canonical sequence as follows:
     422-505: VHEEYQLPYY...QLSVQEDVKI → TFLFCLCSYL...RLFFRDQFVE

Show »
Length:487
Mass (Da):54,270
Checksum:i969525A044E8F7C6
GO
Isoform 4 (identifier: P36896-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     271-271: D → ADCSFLTLPWEVVMVSAAPKLRSLRLQYKGGRGRARFLFPLN

Show »
Length:546
Mass (Da):61,439
Checksum:i0A75C7D6FE406EB3
GO
Isoform 5 (identifier: P36896-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-52: Missing.

Show »
Length:453
Mass (Da):51,725
Checksum:i8E6885B168A1B026
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti56I → F in AAA60555 (PubMed:8058741).Curated1
Sequence conflicti56I → F in AAA60556 (PubMed:8058741).Curated1
Sequence conflicti222 – 223WR → MA in AAA60555 (PubMed:8058741).Curated2
Sequence conflicti222 – 223WR → MA in AAA60556 (PubMed:8058741).Curated2

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_041406146F → L.1 PublicationCorresponds to variant rs34488074dbSNPEnsembl.1
Natural variantiVAR_011716408L → V.Corresponds to variant rs928906dbSNPEnsembl.1
Isoform 3 (identifier: P36896-3)
Natural varianti478R → H.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0418411 – 52Missing in isoform 5. 1 PublicationAdd BLAST52
Alternative sequenceiVSP_041842271D → ADCSFLTLPWEVVMVSAAPK LRSLRLQYKGGRGRARFLFP LN in isoform 4. 1 Publication1
Alternative sequenceiVSP_004953422 – 505VHEEY…EDVKI → TFLFCLCSYLPFQDAGSPKA VLLPPFFLQPVGCLLPEPES SFKVAIKGVEVAVLRVRLFF RDQFVE in isoform 3. 1 PublicationAdd BLAST84
Alternative sequenceiVSP_004954465 – 505ALRVM…EDVKI → VRSWPPAAFPSA in isoform 2. 1 PublicationAdd BLAST41

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z22536 mRNA. Translation: CAA80258.1.
U14722 mRNA. Translation: AAA50246.1.
L10125 mRNA. Translation: AAA60555.1.
L10126 mRNA. Translation: AAA60556.1.
L31848 Genomic DNA. Translation: AAA53349.1.
L31848 Genomic DNA. Translation: AAA53350.1.
L31848 Genomic DNA. Translation: AAA53351.1.
BT007072 mRNA. Translation: AAP35735.1.
AK299120 mRNA. Translation: BAH12954.1.
AK299496 mRNA. Translation: BAH13051.1.
AC025259 Genomic DNA. No translation available.
BC000254 mRNA. Translation: AAH00254.1.
BC040531 mRNA. Translation: AAH40531.1.
CCDSiCCDS44893.2. [P36896-5]
CCDS44894.2. [P36896-4]
CCDS8816.1. [P36896-1]
PIRiI38859.
I80182.
I80183.
RefSeqiNP_004293.1. NM_004302.4. [P36896-1]
NP_064732.3. NM_020327.3. [P36896-5]
NP_064733.3. NM_020328.3. [P36896-4]
UniGeneiHs.438918.

Genome annotation databases

EnsembliENST00000257963; ENSP00000257963; ENSG00000135503. [P36896-1]
ENST00000415850; ENSP00000397550; ENSG00000135503. [P36896-3]
ENST00000426655; ENSP00000390477; ENSG00000135503. [P36896-2]
ENST00000541224; ENSP00000442656; ENSG00000135503. [P36896-4]
ENST00000542485; ENSP00000442885; ENSG00000135503. [P36896-5]
GeneIDi91.
KEGGihsa:91.
UCSCiuc001rzl.4. human. [P36896-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z22536 mRNA. Translation: CAA80258.1.
U14722 mRNA. Translation: AAA50246.1.
L10125 mRNA. Translation: AAA60555.1.
L10126 mRNA. Translation: AAA60556.1.
L31848 Genomic DNA. Translation: AAA53349.1.
L31848 Genomic DNA. Translation: AAA53350.1.
L31848 Genomic DNA. Translation: AAA53351.1.
BT007072 mRNA. Translation: AAP35735.1.
AK299120 mRNA. Translation: BAH12954.1.
AK299496 mRNA. Translation: BAH13051.1.
AC025259 Genomic DNA. No translation available.
BC000254 mRNA. Translation: AAH00254.1.
BC040531 mRNA. Translation: AAH40531.1.
CCDSiCCDS44893.2. [P36896-5]
CCDS44894.2. [P36896-4]
CCDS8816.1. [P36896-1]
PIRiI38859.
I80182.
I80183.
RefSeqiNP_004293.1. NM_004302.4. [P36896-1]
NP_064732.3. NM_020327.3. [P36896-5]
NP_064733.3. NM_020328.3. [P36896-4]
UniGeneiHs.438918.

3D structure databases

ProteinModelPortaliP36896.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi106606. 45 interactors.
DIPiDIP-427N.
IntActiP36896. 13 interactors.

Chemistry databases

BindingDBiP36896.
ChEMBLiCHEMBL5310.
DrugBankiDB00171. Adenosine triphosphate.
GuidetoPHARMACOLOGYi1787.

PTM databases

iPTMnetiP36896.
PhosphoSitePlusiP36896.

Polymorphism and mutation databases

BioMutaiACVR1B.
DMDMi547775.

Proteomic databases

MaxQBiP36896.
PeptideAtlasiP36896.
PRIDEiP36896.

Protocols and materials databases

DNASUi91.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000257963; ENSP00000257963; ENSG00000135503. [P36896-1]
ENST00000415850; ENSP00000397550; ENSG00000135503. [P36896-3]
ENST00000426655; ENSP00000390477; ENSG00000135503. [P36896-2]
ENST00000541224; ENSP00000442656; ENSG00000135503. [P36896-4]
ENST00000542485; ENSP00000442885; ENSG00000135503. [P36896-5]
GeneIDi91.
KEGGihsa:91.
UCSCiuc001rzl.4. human. [P36896-1]

Organism-specific databases

CTDi91.
DisGeNETi91.
GeneCardsiACVR1B.
HGNCiHGNC:172. ACVR1B.
HPAiCAB026126.
HPA063761.
MalaCardsiACVR1B.
MIMi601300. gene.
neXtProtiNX_P36896.
OpenTargetsiENSG00000135503.
PharmGKBiPA24493.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00760000118876.
HOGENOMiHOG000230587.
HOVERGENiHBG054502.
InParanoidiP36896.
KOiK13567.
OMAiQCACTSC.
OrthoDBiEOG091G0BIU.
PhylomeDBiP36896.
TreeFamiTF314724.

Enzyme and pathway databases

BioCyciZFISH:HS06021-MONOMER.
BRENDAi2.7.10.2. 2681.
ReactomeiR-HSA-1181150. Signaling by NODAL.
R-HSA-1433617. Regulation of signaling by NODAL.
R-HSA-1502540. Signaling by Activin.
SignaLinkiP36896.
SIGNORiP36896.

Miscellaneous databases

GeneWikiiACVR1B.
GenomeRNAii91.
PROiP36896.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000135503.
CleanExiHS_ACVR1B.
ExpressionAtlasiP36896. baseline and differential.
GenevisibleiP36896. HS.

Family and domain databases

InterProiIPR000472. Activin_recp.
IPR003605. GS_dom.
IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR008271. Ser/Thr_kinase_AS.
IPR000333. TGFB_receptor.
[Graphical view]
PANTHERiPTHR23255. PTHR23255. 1 hit.
PfamiPF01064. Activin_recp. 1 hit.
PF00069. Pkinase. 1 hit.
PF08515. TGF_beta_GS. 1 hit.
[Graphical view]
SMARTiSM00467. GS. 1 hit.
SM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMiSSF56112. SSF56112. 1 hit.
PROSITEiPS51256. GS. 1 hit.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiACV1B_HUMAN
AccessioniPrimary (citable) accession number: P36896
Secondary accession number(s): B7Z5L8
, B7Z5W5, Q15479, Q15480, Q15481, Q15482
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 1, 1994
Last sequence update: June 1, 1994
Last modified: November 2, 2016
This is version 190 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.