Reviewed,
UniProtKB/Swiss-Prot P36896 (ACV1B_HUMAN)
Last modified
November 3, 2009.
Version 115.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Activin receptor type-1B EC=2.7.11.30 Alternative name(s): ACTR-IB Serine/threonine-protein kinase receptor R2 Short name=SKR2 Activin receptor-like kinase 4 Short name=ALK-4 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 505 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Phosphorylates TTRAP. Ref.7 |
| Catalytic activity | ATP + [receptor-protein] = ADP + [receptor-protein] phosphate. |
| Cofactor | Magnesium or manganese By similarity. |
| Subunit structure | Interacts with AIP1. Part of a complex consisting of AIP1, ACVR2A, ACVR1B and SMAD3. Interacts with TTRAP By similarity. |
| Subcellular location | |
| Tissue specificity | Expressed in many tissues, most strongly in kidney, pancreas, brain, lung, and liver. |
| Post-translational modification | |
| Sequence similarities | Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily. Contains 1 GS domain. Contains 1 protein kinase domain. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | |||||||||
| Isoform 1 (identifier: P36896-1) Also known as: SKR2-1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | |||||||||
| Isoform 2 (identifier: P36896-2) Also known as: SKR2-2; The sequence of this isoform differs from the canonical sequence as follows: 465-505: ALRVMGKMMRECWYANGAARLTALRIKKTLSQLSVQEDVKI → VRSWPPAAFPSA | |||||||||
| Isoform 3 (identifier: P36896-3) Also known as: SKR2-3; The sequence of this isoform differs from the canonical sequence as follows: 422-505: VHEEYQLPYY...QLSVQEDVKI → TFLFCLCSYL...RLFFRDQFVE | |||||||||
Sequence annotation (Features) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
| Natural variant | 478 | 1 | R → H | ||||||
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 23 | 23 | Potential | ||||||
| Chain | 24 – 505 | 482 | Activin receptor type-1B | PRO_0000024417 | |||||
Regions | |||||||||
| Topological domain | 24 – 126 | 103 | Extracellular Potential | ||||||
| Transmembrane | 127 – 149 | 23 | Potential | ||||||
| Topological domain | 150 – 505 | 356 | Cytoplasmic Potential | ||||||
| Domain | 177 – 206 | 30 | GS | ||||||
| Domain | 207 – 497 | 291 | Protein kinase | ||||||
| Nucleotide binding | 213 – 221 | 9 | ATP By similarity | ||||||
Sites | |||||||||
| Active site | 335 | 1 | Proton acceptor By similarity | ||||||
| Binding site | 234 | 1 | ATP By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 380 | 1 | Phosphotyrosine Ref.6 | ||||||
| Glycosylation | 43 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 422 – 505 | 84 | VHEEY…EDVKI → TFLFCLCSYLPFQDAGSPKA VLLPPFFLQPVGCLLPEPES SFKVAIKGVEVAVLRVRLFF RDQFVE in isoform 3. | VSP_004953 | |||||
| Alternative sequence | 465 – 505 | 41 | ALRVM…EDVKI → VRSWPPAAFPSA in isoform 2. | VSP_004954 | |||||
| Natural variant | 146 | 1 | F → L | VAR_041406 | |||||
| Natural variant | 408 | 1 | L → V: dbSNP rs928906. | VAR_011716 | |||||
Experimental info | |||||||||
| Sequence conflict | 56 | 1 | I → F in AAA60555. Ref.3 | ||||||
| Sequence conflict | 56 | 1 | I → F in AAA60556. Ref.3 | ||||||
| Sequence conflict | 222 – 223 | 2 | WR → MA in AAA60555. Ref.3 | ||||||
| Sequence conflict | 222 – 223 | 2 | WR → MA in AAA60556. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Activin receptor-like kinases: a novel subclass of cell-surface receptors with predicted serine/threonine kinase activity." ten Dijke P., Ichijo H., Franzen P., Schulz P., Saras J., Toyoshima H., Heldin C.-H., Miyazono K. Oncogene 8:2879-2887(1993) [PubMed: 8397373] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Tissue: Placenta. |
| [2] | "Type I receptors specify growth-inhibitory and transcriptional responses to transforming growth factor beta and activin." Carcamo J., Weis F.M., Ventura F., Wieser R., Wrana J.L., Attisano L., Massague J. Mol. Cell. Biol. 14:3810-3821(1994) [PubMed: 8196624] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Tissue: Kidney. |
| [3] | "Genomic structure and cloned cDNAs predict that four variants in the kinase domain of serine/threonine kinase receptors arise by alternative splicing and poly(A) addition." Xu J., Matsuzaki K., McKeehan K., Wang F., Kan M., McKeehan W.L. Proc. Natl. Acad. Sci. U.S.A. 91:7957-7961(1994) [PubMed: 8058741] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA], ALTERNATIVE SPLICING. Tissue: Liver. |
| [4] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain and Eye. |
| [6] | "Identification of the phosphotyrosine proteome from thrombin activated platelets." Maguire P.B., Wynne K.J., Harney D.F., O'Donoghue N.M., Stephens G., Fitzgerald D.J. Proteomics 2:642-648(2002) [PubMed: 12112843] [Abstract] Cited for: PHOSPHORYLATION AT TYR-380. |
| [7] | "Ttrap is an essential modulator of Smad3-dependent Nodal signaling during zebrafish gastrulation and left-right axis determination." Esguerra C.V., Nelles L., Vermeire L., Ibrahimi A., Crawford A.D., Derua R., Janssens E., Waelkens E., Carmeliet P., Collen D., Huylebroeck D. Development 134:4381-4393(2007) [PubMed: 18039968] [Abstract] Cited for: FUNCTION, AUTOPHOSPHORYLATION. |
| [8] | "Patterns of somatic mutation in human cancer genomes." Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. Stratton M.R.Nature 446:153-158(2007) [PubMed: 17344846] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] LEU-146, VARIANT [LARGE SCALE ANALYSIS] HIS-478 (ISOFORM 3). |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| Z22536 mRNA. Translation: CAA80258.1. U14722 mRNA. Translation: AAA50246.1. L10125 mRNA. Translation: AAA60555.1. L10126 mRNA. Translation: AAA60556.1. L31848 Genomic DNA. Translation: AAA53349.1. L31848 Genomic DNA. Translation: AAA53350.1. L31848 Genomic DNA. Translation: AAA53351.1. BT007072 mRNA. Translation: AAP35735.1. BC000254 mRNA. Translation: AAH00254.1. BC040531 mRNA. Translation: AAH40531.1. | |
| IPI | IPI00005732. IPI00218980. IPI00297220. |
| PIR | I38859. I80182. I80183. |
| RefSeq | NP_004293.1. NP_064732.2. NP_064733.2. |
| UniGene | Hs.438918 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1B6C based on UniProtKB P36897. |
| SMR | P36896. Positions 173-501. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP:427N. |
| STRING | P36896. |
Proteomic databases | |
| PRIDE | P36896. |
Genome annotation databases | |
| Ensembl | ENST00000257963; ENSP00000257963; ENSG00000135503; Homo sapiens. [Genome view] ENST00000415850; ENSP00000397550; ENSG00000135503; Homo sapiens. [Genome view] ENST00000426655; ENSP00000390477; ENSG00000135503; Homo sapiens. [Genome view] |
| GeneID | 91. |
| KEGG | hsa:91. |
| UCSC | uc001rzl.1. human. uc001rzm.1. human. uc001rzn.1. human. |
Organism-specific databases | |
| CTD | 91. |
| GeneCards | GC12P050631. |
| H-InvDB | HIX0010648. |
| HGNC | HGNC:172. ACVR1B. |
| MIM | 601300. gene. |
| PharmGKB | PA24493. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOGENOM | P36896. |
| HOVERGEN | P36896. |
| OMA | SSWGPVE. |
Enzyme and pathway databases | |
| BRENDA | 2.7.10.2. 247. 2.7.11.30. 247. |
Gene expression databases | |
| ArrayExpress | P36896. |
| Bgee | P36896. |
| CleanEx | HS_ACVR1B. |
| Genevestigator | P36896. |
Family and domain databases | |
| InterPro | IPR000472. Activin_rcpt. IPR000719. Prot_kinase_core. IPR017441. Protein_kinase_ATP_BS. IPR017442. Se/Thr_pkinase-rel. IPR008271. Ser_thr_pkin_AS. IPR003605. TGF_beta_rcpt_GS. [Graphical view] |
| Pfam | PF01064. Activin_recp. 1 hit. PF00069. Pkinase. 1 hit. PF08515. TGF_beta_GS. 1 hit. [Graphical view] |
| ProDom | PD000001. Prot_kinase. 1 hit. [Graphical view] [Entries sharing at least one domain] |
| SMART | SM00467. GS. 1 hit. [Graphical view] |
| PROSITE | PS51256. GS. 1 hit. PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| DrugBank | DB00171. Adenosine triphosphate. |
| NextBio | 339. |
| SOURCE | Search... |
Entry information
| Entry name | ACV1B_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P36896 Secondary accession number(s): Q15479 Q15482 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| SIMILARITY comments Index of protein domains and families |

Clusters with


