SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P36406

- TRI23_HUMAN

UniProt

P36406 - TRI23_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
E3 ubiquitin-protein ligase TRIM23
Gene
TRIM23, ARD1, ARFD1, RNF46
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Acts as an E3 ubiquitin-protein ligase. In the presence of the human cytomegalovirus (HCMV) protein UL144, participates in 'Lys-63'-linked auto-ubiquitination of TRAF6 resulting in the virally controlled activation of NF-kappa-B at early time of infection. The C-terminus can act as an allosteric activator of the cholera toxin catalytic subunit.1 Publication

Pathwayi

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri31 – 7646RING-type; degenerate
Add
BLAST
Zinc fingeri122 – 16847B box-type; degenerate
Add
BLAST
Nucleotide bindingi411 – 4188GTP By similarity
Nucleotide bindingi454 – 4585GTP By similarity
Nucleotide bindingi513 – 5164GTP By similarity

GO - Molecular functioni

  1. GDP binding Source: HGNC
  2. GTP binding Source: HGNC
  3. GTPase activity Source: HGNC
  4. enzyme activator activity Source: ProtInc
  5. identical protein binding Source: IntAct
  6. ligase activity Source: UniProtKB-KW
  7. protein binding Source: IntAct
  8. ubiquitin-protein transferase activity Source: HGNC
  9. zinc ion binding Source: InterPro

GO - Biological processi

  1. GTP catabolic process Source: GOC
  2. positive regulation of catalytic activity Source: GOC
  3. protein ubiquitination Source: HGNC
  4. small GTPase mediated signal transduction Source: InterPro
  5. viral process Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Ligase

Keywords - Biological processi

Host-virus interaction, Ubl conjugation pathway

Keywords - Ligandi

GTP-binding, Metal-binding, Nucleotide-binding, Zinc

Enzyme and pathway databases

UniPathwayiUPA00143.

Names & Taxonomyi

Protein namesi
Recommended name:
E3 ubiquitin-protein ligase TRIM23 (EC:6.3.2.-)
Alternative name(s):
ADP-ribosylation factor domain-containing protein 1
GTP-binding protein ARD-1
RING finger protein 46
Tripartite motif-containing protein 23
Gene namesi
Name:TRIM23
Synonyms:ARD1, ARFD1, RNF46
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 5

Organism-specific databases

HGNCiHGNC:660. TRIM23.

Subcellular locationi

Endomembrane system. Golgi apparatus membrane. Lysosome membrane
Note: Membrane-associated with the Golgi complex and lysosomal structures.1 Publication

GO - Cellular componenti

  1. Golgi membrane Source: HGNC
  2. extracellular vesicular exosome Source: UniProt
  3. lysosomal membrane Source: HGNC
  4. nucleus Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Golgi apparatus, Lysosome, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi34 – 341C → A: Loss of E3 ubiquitin-protein ligase activity. 1 Publication
Mutagenesisi53 – 531H → A: Loss of E3 ubiquitin-protein ligase activity. 1 Publication
Mutagenesisi418 – 4181T → N: Maintains GTPase activity. Increases interaction with PSCD1. 1 Publication
Mutagenesisi458 – 4581K → I: Suppresses GTPase activity. Decreases interaction with PSCD1. 1 Publication

Organism-specific databases

PharmGKBiPA24943.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 574574E3 ubiquitin-protein ligase TRIM23
PRO_0000207483Add
BLAST

Proteomic databases

MaxQBiP36406.
PaxDbiP36406.
PRIDEiP36406.

PTM databases

PhosphoSiteiP36406.

Expressioni

Gene expression databases

ArrayExpressiP36406.
BgeeiP36406.
CleanExiHS_TRIM23.
GenevestigatoriP36406.

Organism-specific databases

HPAiHPA039605.

Interactioni

Subunit structurei

Interacts with PSCD1. Interacts with human cytomegalovirus protein UL144; this interaction might causes auto-ubiquitination of TRAF6, leading to NF-kappaB activation.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
itself3EBI-740098,EBI-740098
GEMP550403EBI-740098,EBI-744104
Hoxa1P090222EBI-740098,EBI-3957603From a different organism.

Protein-protein interaction databases

BioGridi106868. 55 interactions.
IntActiP36406. 44 interactions.
MINTiMINT-1442172.
STRINGi9606.ENSP00000231524.

Structurei

3D structure databases

ProteinModelPortaliP36406.
SMRiP36406. Positions 16-79, 127-219, 371-565.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni390 – 574185ARF-like
Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili352 – 37928 Reviewed prediction
Add
BLAST

Domaini

The RING-type zinc finger domain is responsible for E3 ubiquitin ligase activity.

Sequence similaritiesi

In the C-terminal section; belongs to the small GTPase superfamily. Arf family.

Keywords - Domaini

Coiled coil, Zinc-finger

Phylogenomic databases

eggNOGiCOG1100.
HOGENOMiHOG000008208.
HOVERGENiHBG000551.
InParanoidiP36406.
KOiK07963.
OMAiRAVRCPF.
OrthoDBiEOG76DTS0.
PhylomeDBiP36406.
TreeFamiTF320703.

Family and domain databases

Gene3Di3.30.40.10. 1 hit.
3.40.50.300. 1 hit.
InterProiIPR003649. Bbox_C.
IPR027417. P-loop_NTPase.
IPR005225. Small_GTP-bd_dom.
IPR024156. Small_GTPase_ARF.
IPR006689. Small_GTPase_ARF/SAR.
IPR000315. Znf_B-box.
IPR007087. Znf_C2H2.
IPR001841. Znf_RING.
IPR013083. Znf_RING/FYVE/PHD.
IPR017907. Znf_RING_CS.
[Graphical view]
PfamiPF00025. Arf. 1 hit.
PF00643. zf-B_box. 1 hit.
[Graphical view]
PRINTSiPR00328. SAR1GTPBP.
SMARTiSM00177. ARF. 1 hit.
SM00502. BBC. 1 hit.
SM00336. BBOX. 2 hits.
SM00184. RING. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
TIGRFAMsiTIGR00231. small_GTP. 1 hit.
PROSITEiPS51417. ARF. 1 hit.
PS50119. ZF_BBOX. 1 hit.
PS00518. ZF_RING_1. 1 hit.
PS50089. ZF_RING_2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform Alpha (identifier: P36406-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MATLVVNKLG AGVDSGRQGS RGTAVVKVLE CGVCEDVFSL QGDKVPRLLL    50
CGHTVCHDCL TRLPLHGRAI RCPFDRQVTD LGDSGVWGLK KNFALLELLE 100
RLQNGPIGQY GAAEESIGIS GESIIRCDED EAHLASVYCT VCATHLCSEC 150
SQVTHSTKTL AKHRRVPLAD KPHEKTMCSQ HQVHAIEFVC LEEGCQTSPL 200
MCCVCKEYGK HQGHKHSVLE PEANQIRASI LDMAHCIRTF TEEISDYSRK 250
LVGIVQHIEG GEQIVEDGIG MAHTEHVPGT AENARSCIRA YFYDLHETLC 300
RQEEMALSVV DAHVREKLIW LRQQQEDMTI LLSEVSAACL HCEKTLQQDD 350
CRVVLAKQEI TRLLETLQKQ QQQFTEVADH IQLDASIPVT FTKDNRVHIG 400
PKMEIRVVTL GLDGAGKTTI LFKLKQDEFM QPIPTIGFNV ETVEYKNLKF 450
TIWDVGGKHK LRPLWKHYYL NTQAVVFVVD SSHRDRISEA HSELAKLLTE 500
KELRDALLLI FANKQDVAGA LSVEEITELL SLHKLCCGRS WYIQGCDARS 550
GMGLYEGLDW LSRQLVAAGV LDVA 574
Length:574
Mass (Da):64,067
Last modified:June 1, 1994 - v1
Checksum:iCB85923B29BF0320
GO
Isoform Beta (identifier: P36406-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     551-574: GMGLYEGLDWLSRQLVAAGVLDVA → VFQIICDQYTGKEVVTEKG

Show »
Length:569
Mass (Da):63,690
Checksum:i21399953A4224B7A
GO
Isoform Gamma (identifier: P36406-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     541-574: WYIQGCDARSGMGLYEGLDWLSRQLVAAGVLDVA → CFSDNM

Show »
Length:546
Mass (Da):61,068
Checksum:iD21D92EED6E967A2
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti480 – 4801D → N.
Corresponds to variant rs34046496 [ dbSNP | Ensembl ].
VAR_048320

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei541 – 57434WYIQG…VLDVA → CFSDNM in isoform Gamma.
VSP_000297Add
BLAST
Alternative sequencei551 – 57424GMGLY…VLDVA → VFQIICDQYTGKEVVTEKG in isoform Beta.
VSP_000296Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
L04510 mRNA. Translation: AAA35940.1.
AF230397 mRNA. Translation: AAG50176.1.
AF230398 mRNA. Translation: AAG50177.1.
AF230399 mRNA. Translation: AAG50178.1.
BC022510 mRNA. Translation: AAH22510.1.
CCDSiCCDS3986.1. [P36406-3]
CCDS3987.1. [P36406-1]
CCDS43322.1. [P36406-2]
PIRiA46054.
RefSeqiNP_001647.1. NM_001656.3. [P36406-1]
NP_150230.1. NM_033227.2. [P36406-2]
NP_150231.1. NM_033228.2. [P36406-3]
UniGeneiHs.792.

Genome annotation databases

EnsembliENST00000231524; ENSP00000231524; ENSG00000113595. [P36406-1]
ENST00000274327; ENSP00000274327; ENSG00000113595. [P36406-3]
ENST00000381018; ENSP00000370406; ENSG00000113595. [P36406-2]
GeneIDi373.
KEGGihsa:373.
UCSCiuc003jtw.3. human. [P36406-3]
uc003jtx.3. human. [P36406-2]
uc003jty.3. human. [P36406-1]

Polymorphism databases

DMDMi543839.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
L04510 mRNA. Translation: AAA35940.1 .
AF230397 mRNA. Translation: AAG50176.1 .
AF230398 mRNA. Translation: AAG50177.1 .
AF230399 mRNA. Translation: AAG50178.1 .
BC022510 mRNA. Translation: AAH22510.1 .
CCDSi CCDS3986.1. [P36406-3 ]
CCDS3987.1. [P36406-1 ]
CCDS43322.1. [P36406-2 ]
PIRi A46054.
RefSeqi NP_001647.1. NM_001656.3. [P36406-1 ]
NP_150230.1. NM_033227.2. [P36406-2 ]
NP_150231.1. NM_033228.2. [P36406-3 ]
UniGenei Hs.792.

3D structure databases

ProteinModelPortali P36406.
SMRi P36406. Positions 16-79, 127-219, 371-565.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 106868. 55 interactions.
IntActi P36406. 44 interactions.
MINTi MINT-1442172.
STRINGi 9606.ENSP00000231524.

PTM databases

PhosphoSitei P36406.

Polymorphism databases

DMDMi 543839.

Proteomic databases

MaxQBi P36406.
PaxDbi P36406.
PRIDEi P36406.

Protocols and materials databases

DNASUi 373.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000231524 ; ENSP00000231524 ; ENSG00000113595 . [P36406-1 ]
ENST00000274327 ; ENSP00000274327 ; ENSG00000113595 . [P36406-3 ]
ENST00000381018 ; ENSP00000370406 ; ENSG00000113595 . [P36406-2 ]
GeneIDi 373.
KEGGi hsa:373.
UCSCi uc003jtw.3. human. [P36406-3 ]
uc003jtx.3. human. [P36406-2 ]
uc003jty.3. human. [P36406-1 ]

Organism-specific databases

CTDi 373.
GeneCardsi GC05M064885.
HGNCi HGNC:660. TRIM23.
HPAi HPA039605.
MIMi 601747. gene.
neXtProti NX_P36406.
PharmGKBi PA24943.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG1100.
HOGENOMi HOG000008208.
HOVERGENi HBG000551.
InParanoidi P36406.
KOi K07963.
OMAi RAVRCPF.
OrthoDBi EOG76DTS0.
PhylomeDBi P36406.
TreeFami TF320703.

Enzyme and pathway databases

UniPathwayi UPA00143 .

Miscellaneous databases

GeneWikii TRIM23.
GenomeRNAii 373.
NextBioi 1557.
PROi P36406.
SOURCEi Search...

Gene expression databases

ArrayExpressi P36406.
Bgeei P36406.
CleanExi HS_TRIM23.
Genevestigatori P36406.

Family and domain databases

Gene3Di 3.30.40.10. 1 hit.
3.40.50.300. 1 hit.
InterProi IPR003649. Bbox_C.
IPR027417. P-loop_NTPase.
IPR005225. Small_GTP-bd_dom.
IPR024156. Small_GTPase_ARF.
IPR006689. Small_GTPase_ARF/SAR.
IPR000315. Znf_B-box.
IPR007087. Znf_C2H2.
IPR001841. Znf_RING.
IPR013083. Znf_RING/FYVE/PHD.
IPR017907. Znf_RING_CS.
[Graphical view ]
Pfami PF00025. Arf. 1 hit.
PF00643. zf-B_box. 1 hit.
[Graphical view ]
PRINTSi PR00328. SAR1GTPBP.
SMARTi SM00177. ARF. 1 hit.
SM00502. BBC. 1 hit.
SM00336. BBOX. 2 hits.
SM00184. RING. 1 hit.
[Graphical view ]
SUPFAMi SSF52540. SSF52540. 1 hit.
TIGRFAMsi TIGR00231. small_GTP. 1 hit.
PROSITEi PS51417. ARF. 1 hit.
PS50119. ZF_BBOX. 1 hit.
PS00518. ZF_RING_1. 1 hit.
PS50089. ZF_RING_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "ARD 1, a 64-kDa guanine nucleotide-binding protein with a carboxyl-terminal ADP-ribosylation factor domain."
    Mishima K., Tsuchiya M., Nightingale M.S., Moss J., Vaughan M.
    J. Biol. Chem. 268:8801-8807(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA).
  2. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA; BETA AND GAMMA).
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM ALPHA).
    Tissue: Brain.
  4. "Localization of ADP-ribosylation factor domain protein 1 (ARD1) in lysosomes and Golgi apparatus."
    Vitale N., Horiba K., Ferrans V.J., Moss J., Vaughan M.
    Proc. Natl. Acad. Sci. U.S.A. 95:8613-8618(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION.
  5. "Specific functional interaction of human cytohesin-1 and ADP-ribosylation factor domain protein (ARD1)."
    Vitale N., Pacheco-Rodriguez G., Ferrans V.J., Riemenschneider W., Moss J., Vaughan M.
    J. Biol. Chem. 275:21331-21339(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH PSCD1, MUTAGENESIS OF THR-418 AND LYS-458.
  6. "E3 ubiquitin ligase activity of the trifunctional ARD1 (ADP-ribosylation factor domain protein 1)."
    Vichi A., Payne D.M., Pacheco-Rodriguez G., Moss J., Vaughan M.
    Proc. Natl. Acad. Sci. U.S.A. 102:1945-1950(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, MUTAGENESIS OF CYS-34 AND HIS-53.
  7. "Identification of TRIM23 as a cofactor involved in the regulation of NF-kappaB by human cytomegalovirus."
    Poole E., Groves I., MacDonald A., Pang Y., Alcami A., Sinclair J.
    J. Virol. 83:3581-3590(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH HUMAN CYTOMEGALOVIRUS PROTEIN UL144.

Entry informationi

Entry nameiTRI23_HUMAN
AccessioniPrimary (citable) accession number: P36406
Secondary accession number(s): Q9BZY4, Q9BZY5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 1, 1994
Last sequence update: June 1, 1994
Last modified: September 3, 2014
This is version 142 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi