Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P36406

- TRI23_HUMAN

UniProt

P36406 - TRI23_HUMAN

Protein

E3 ubiquitin-protein ligase TRIM23

Gene

TRIM23

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 143 (01 Oct 2014)
      Sequence version 1 (01 Jun 1994)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Acts as an E3 ubiquitin-protein ligase. In the presence of the human cytomegalovirus (HCMV) protein UL144, participates in 'Lys-63'-linked auto-ubiquitination of TRAF6 resulting in the virally controlled activation of NF-kappa-B at early time of infection. The C-terminus can act as an allosteric activator of the cholera toxin catalytic subunit.1 Publication

    Pathwayi

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri31 – 7646RING-type; degeneratePROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri122 – 16847B box-type; degeneratePROSITE-ProRule annotationAdd
    BLAST
    Nucleotide bindingi411 – 4188GTPBy similarity
    Nucleotide bindingi454 – 4585GTPBy similarity
    Nucleotide bindingi513 – 5164GTPBy similarity

    GO - Molecular functioni

    1. enzyme activator activity Source: ProtInc
    2. GDP binding Source: HGNC
    3. GTPase activity Source: HGNC
    4. GTP binding Source: HGNC
    5. identical protein binding Source: IntAct
    6. ligase activity Source: UniProtKB-KW
    7. protein binding Source: IntAct
    8. ubiquitin-protein transferase activity Source: HGNC
    9. zinc ion binding Source: InterPro

    GO - Biological processi

    1. GTP catabolic process Source: GOC
    2. positive regulation of catalytic activity Source: GOC
    3. protein ubiquitination Source: HGNC
    4. small GTPase mediated signal transduction Source: InterPro
    5. viral process Source: UniProtKB-KW

    Keywords - Molecular functioni

    Ligase

    Keywords - Biological processi

    Host-virus interaction, Ubl conjugation pathway

    Keywords - Ligandi

    GTP-binding, Metal-binding, Nucleotide-binding, Zinc

    Enzyme and pathway databases

    UniPathwayiUPA00143.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    E3 ubiquitin-protein ligase TRIM23 (EC:6.3.2.-)
    Alternative name(s):
    ADP-ribosylation factor domain-containing protein 1
    GTP-binding protein ARD-1
    RING finger protein 46
    Tripartite motif-containing protein 23
    Gene namesi
    Name:TRIM23
    Synonyms:ARD1, ARFD1, RNF46
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 5

    Organism-specific databases

    HGNCiHGNC:660. TRIM23.

    Subcellular locationi

    Endomembrane system 1 Publication. Golgi apparatus membrane 1 Publication. Lysosome membrane 1 Publication
    Note: Membrane-associated with the Golgi complex and lysosomal structures.

    GO - Cellular componenti

    1. extracellular vesicular exosome Source: UniProt
    2. Golgi membrane Source: HGNC
    3. lysosomal membrane Source: HGNC
    4. nucleus Source: Ensembl

    Keywords - Cellular componenti

    Golgi apparatus, Lysosome, Membrane

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi34 – 341C → A: Loss of E3 ubiquitin-protein ligase activity. 1 Publication
    Mutagenesisi53 – 531H → A: Loss of E3 ubiquitin-protein ligase activity. 1 Publication
    Mutagenesisi418 – 4181T → N: Maintains GTPase activity. Increases interaction with PSCD1. 1 Publication
    Mutagenesisi458 – 4581K → I: Suppresses GTPase activity. Decreases interaction with PSCD1. 1 Publication

    Organism-specific databases

    PharmGKBiPA24943.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 574574E3 ubiquitin-protein ligase TRIM23PRO_0000207483Add
    BLAST

    Proteomic databases

    MaxQBiP36406.
    PaxDbiP36406.
    PRIDEiP36406.

    PTM databases

    PhosphoSiteiP36406.

    Expressioni

    Gene expression databases

    ArrayExpressiP36406.
    BgeeiP36406.
    CleanExiHS_TRIM23.
    GenevestigatoriP36406.

    Organism-specific databases

    HPAiHPA039605.

    Interactioni

    Subunit structurei

    Interacts with PSCD1. Interacts with human cytomegalovirus protein UL144; this interaction might causes auto-ubiquitination of TRAF6, leading to NF-kappaB activation.2 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    itself3EBI-740098,EBI-740098
    GEMP550403EBI-740098,EBI-744104
    Hoxa1P090222EBI-740098,EBI-3957603From a different organism.

    Protein-protein interaction databases

    BioGridi106868. 55 interactions.
    IntActiP36406. 44 interactions.
    MINTiMINT-1442172.
    STRINGi9606.ENSP00000231524.

    Structurei

    3D structure databases

    ProteinModelPortaliP36406.
    SMRiP36406. Positions 16-79, 127-219, 371-565.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni390 – 574185ARF-likeAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili352 – 37928Sequence AnalysisAdd
    BLAST

    Domaini

    The RING-type zinc finger domain is responsible for E3 ubiquitin ligase activity.

    Sequence similaritiesi

    In the C-terminal section; belongs to the small GTPase superfamily. Arf family.Curated
    Contains 1 B box-type zinc finger.PROSITE-ProRule annotation
    Contains 1 RING-type zinc finger.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri31 – 7646RING-type; degeneratePROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri122 – 16847B box-type; degeneratePROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Coiled coil, Zinc-finger

    Phylogenomic databases

    eggNOGiCOG1100.
    HOGENOMiHOG000008208.
    HOVERGENiHBG000551.
    InParanoidiP36406.
    KOiK07963.
    OMAiRAVRCPF.
    OrthoDBiEOG76DTS0.
    PhylomeDBiP36406.
    TreeFamiTF320703.

    Family and domain databases

    Gene3Di3.30.40.10. 1 hit.
    3.40.50.300. 1 hit.
    InterProiIPR003649. Bbox_C.
    IPR027417. P-loop_NTPase.
    IPR005225. Small_GTP-bd_dom.
    IPR024156. Small_GTPase_ARF.
    IPR006689. Small_GTPase_ARF/SAR.
    IPR000315. Znf_B-box.
    IPR007087. Znf_C2H2.
    IPR001841. Znf_RING.
    IPR013083. Znf_RING/FYVE/PHD.
    IPR017907. Znf_RING_CS.
    [Graphical view]
    PfamiPF00025. Arf. 1 hit.
    PF00643. zf-B_box. 1 hit.
    [Graphical view]
    PRINTSiPR00328. SAR1GTPBP.
    SMARTiSM00177. ARF. 1 hit.
    SM00502. BBC. 1 hit.
    SM00336. BBOX. 2 hits.
    SM00184. RING. 1 hit.
    [Graphical view]
    SUPFAMiSSF52540. SSF52540. 1 hit.
    TIGRFAMsiTIGR00231. small_GTP. 1 hit.
    PROSITEiPS51417. ARF. 1 hit.
    PS50119. ZF_BBOX. 1 hit.
    PS00518. ZF_RING_1. 1 hit.
    PS50089. ZF_RING_2. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform Alpha (identifier: P36406-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MATLVVNKLG AGVDSGRQGS RGTAVVKVLE CGVCEDVFSL QGDKVPRLLL    50
    CGHTVCHDCL TRLPLHGRAI RCPFDRQVTD LGDSGVWGLK KNFALLELLE 100
    RLQNGPIGQY GAAEESIGIS GESIIRCDED EAHLASVYCT VCATHLCSEC 150
    SQVTHSTKTL AKHRRVPLAD KPHEKTMCSQ HQVHAIEFVC LEEGCQTSPL 200
    MCCVCKEYGK HQGHKHSVLE PEANQIRASI LDMAHCIRTF TEEISDYSRK 250
    LVGIVQHIEG GEQIVEDGIG MAHTEHVPGT AENARSCIRA YFYDLHETLC 300
    RQEEMALSVV DAHVREKLIW LRQQQEDMTI LLSEVSAACL HCEKTLQQDD 350
    CRVVLAKQEI TRLLETLQKQ QQQFTEVADH IQLDASIPVT FTKDNRVHIG 400
    PKMEIRVVTL GLDGAGKTTI LFKLKQDEFM QPIPTIGFNV ETVEYKNLKF 450
    TIWDVGGKHK LRPLWKHYYL NTQAVVFVVD SSHRDRISEA HSELAKLLTE 500
    KELRDALLLI FANKQDVAGA LSVEEITELL SLHKLCCGRS WYIQGCDARS 550
    GMGLYEGLDW LSRQLVAAGV LDVA 574
    Length:574
    Mass (Da):64,067
    Last modified:June 1, 1994 - v1
    Checksum:iCB85923B29BF0320
    GO
    Isoform Beta (identifier: P36406-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         551-574: GMGLYEGLDWLSRQLVAAGVLDVA → VFQIICDQYTGKEVVTEKG

    Show »
    Length:569
    Mass (Da):63,690
    Checksum:i21399953A4224B7A
    GO
    Isoform Gamma (identifier: P36406-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         541-574: WYIQGCDARSGMGLYEGLDWLSRQLVAAGVLDVA → CFSDNM

    Show »
    Length:546
    Mass (Da):61,068
    Checksum:iD21D92EED6E967A2
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti480 – 4801D → N.
    Corresponds to variant rs34046496 [ dbSNP | Ensembl ].
    VAR_048320

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei541 – 57434WYIQG…VLDVA → CFSDNM in isoform Gamma. 1 PublicationVSP_000297Add
    BLAST
    Alternative sequencei551 – 57424GMGLY…VLDVA → VFQIICDQYTGKEVVTEKG in isoform Beta. 1 PublicationVSP_000296Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L04510 mRNA. Translation: AAA35940.1.
    AF230397 mRNA. Translation: AAG50176.1.
    AF230398 mRNA. Translation: AAG50177.1.
    AF230399 mRNA. Translation: AAG50178.1.
    BC022510 mRNA. Translation: AAH22510.1.
    CCDSiCCDS3986.1. [P36406-3]
    CCDS3987.1. [P36406-1]
    CCDS43322.1. [P36406-2]
    PIRiA46054.
    RefSeqiNP_001647.1. NM_001656.3. [P36406-1]
    NP_150230.1. NM_033227.2. [P36406-2]
    NP_150231.1. NM_033228.2. [P36406-3]
    UniGeneiHs.792.

    Genome annotation databases

    EnsembliENST00000231524; ENSP00000231524; ENSG00000113595. [P36406-1]
    ENST00000274327; ENSP00000274327; ENSG00000113595. [P36406-3]
    ENST00000381018; ENSP00000370406; ENSG00000113595. [P36406-2]
    GeneIDi373.
    KEGGihsa:373.
    UCSCiuc003jtw.3. human. [P36406-3]
    uc003jtx.3. human. [P36406-2]
    uc003jty.3. human. [P36406-1]

    Polymorphism databases

    DMDMi543839.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L04510 mRNA. Translation: AAA35940.1 .
    AF230397 mRNA. Translation: AAG50176.1 .
    AF230398 mRNA. Translation: AAG50177.1 .
    AF230399 mRNA. Translation: AAG50178.1 .
    BC022510 mRNA. Translation: AAH22510.1 .
    CCDSi CCDS3986.1. [P36406-3 ]
    CCDS3987.1. [P36406-1 ]
    CCDS43322.1. [P36406-2 ]
    PIRi A46054.
    RefSeqi NP_001647.1. NM_001656.3. [P36406-1 ]
    NP_150230.1. NM_033227.2. [P36406-2 ]
    NP_150231.1. NM_033228.2. [P36406-3 ]
    UniGenei Hs.792.

    3D structure databases

    ProteinModelPortali P36406.
    SMRi P36406. Positions 16-79, 127-219, 371-565.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 106868. 55 interactions.
    IntActi P36406. 44 interactions.
    MINTi MINT-1442172.
    STRINGi 9606.ENSP00000231524.

    PTM databases

    PhosphoSitei P36406.

    Polymorphism databases

    DMDMi 543839.

    Proteomic databases

    MaxQBi P36406.
    PaxDbi P36406.
    PRIDEi P36406.

    Protocols and materials databases

    DNASUi 373.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000231524 ; ENSP00000231524 ; ENSG00000113595 . [P36406-1 ]
    ENST00000274327 ; ENSP00000274327 ; ENSG00000113595 . [P36406-3 ]
    ENST00000381018 ; ENSP00000370406 ; ENSG00000113595 . [P36406-2 ]
    GeneIDi 373.
    KEGGi hsa:373.
    UCSCi uc003jtw.3. human. [P36406-3 ]
    uc003jtx.3. human. [P36406-2 ]
    uc003jty.3. human. [P36406-1 ]

    Organism-specific databases

    CTDi 373.
    GeneCardsi GC05M064885.
    HGNCi HGNC:660. TRIM23.
    HPAi HPA039605.
    MIMi 601747. gene.
    neXtProti NX_P36406.
    PharmGKBi PA24943.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG1100.
    HOGENOMi HOG000008208.
    HOVERGENi HBG000551.
    InParanoidi P36406.
    KOi K07963.
    OMAi RAVRCPF.
    OrthoDBi EOG76DTS0.
    PhylomeDBi P36406.
    TreeFami TF320703.

    Enzyme and pathway databases

    UniPathwayi UPA00143 .

    Miscellaneous databases

    GeneWikii TRIM23.
    GenomeRNAii 373.
    NextBioi 1557.
    PROi P36406.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P36406.
    Bgeei P36406.
    CleanExi HS_TRIM23.
    Genevestigatori P36406.

    Family and domain databases

    Gene3Di 3.30.40.10. 1 hit.
    3.40.50.300. 1 hit.
    InterProi IPR003649. Bbox_C.
    IPR027417. P-loop_NTPase.
    IPR005225. Small_GTP-bd_dom.
    IPR024156. Small_GTPase_ARF.
    IPR006689. Small_GTPase_ARF/SAR.
    IPR000315. Znf_B-box.
    IPR007087. Znf_C2H2.
    IPR001841. Znf_RING.
    IPR013083. Znf_RING/FYVE/PHD.
    IPR017907. Znf_RING_CS.
    [Graphical view ]
    Pfami PF00025. Arf. 1 hit.
    PF00643. zf-B_box. 1 hit.
    [Graphical view ]
    PRINTSi PR00328. SAR1GTPBP.
    SMARTi SM00177. ARF. 1 hit.
    SM00502. BBC. 1 hit.
    SM00336. BBOX. 2 hits.
    SM00184. RING. 1 hit.
    [Graphical view ]
    SUPFAMi SSF52540. SSF52540. 1 hit.
    TIGRFAMsi TIGR00231. small_GTP. 1 hit.
    PROSITEi PS51417. ARF. 1 hit.
    PS50119. ZF_BBOX. 1 hit.
    PS00518. ZF_RING_1. 1 hit.
    PS50089. ZF_RING_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "ARD 1, a 64-kDa guanine nucleotide-binding protein with a carboxyl-terminal ADP-ribosylation factor domain."
      Mishima K., Tsuchiya M., Nightingale M.S., Moss J., Vaughan M.
      J. Biol. Chem. 268:8801-8807(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA).
    2. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA; BETA AND GAMMA).
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM ALPHA).
      Tissue: Brain.
    4. "Localization of ADP-ribosylation factor domain protein 1 (ARD1) in lysosomes and Golgi apparatus."
      Vitale N., Horiba K., Ferrans V.J., Moss J., Vaughan M.
      Proc. Natl. Acad. Sci. U.S.A. 95:8613-8618(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION.
    5. "Specific functional interaction of human cytohesin-1 and ADP-ribosylation factor domain protein (ARD1)."
      Vitale N., Pacheco-Rodriguez G., Ferrans V.J., Riemenschneider W., Moss J., Vaughan M.
      J. Biol. Chem. 275:21331-21339(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH PSCD1, MUTAGENESIS OF THR-418 AND LYS-458.
    6. "E3 ubiquitin ligase activity of the trifunctional ARD1 (ADP-ribosylation factor domain protein 1)."
      Vichi A., Payne D.M., Pacheco-Rodriguez G., Moss J., Vaughan M.
      Proc. Natl. Acad. Sci. U.S.A. 102:1945-1950(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, MUTAGENESIS OF CYS-34 AND HIS-53.
    7. "Identification of TRIM23 as a cofactor involved in the regulation of NF-kappaB by human cytomegalovirus."
      Poole E., Groves I., MacDonald A., Pang Y., Alcami A., Sinclair J.
      J. Virol. 83:3581-3590(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH HUMAN CYTOMEGALOVIRUS PROTEIN UL144.

    Entry informationi

    Entry nameiTRI23_HUMAN
    AccessioniPrimary (citable) accession number: P36406
    Secondary accession number(s): Q9BZY4, Q9BZY5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 1, 1994
    Last sequence update: June 1, 1994
    Last modified: October 1, 2014
    This is version 143 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 5
      Human chromosome 5: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3