Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

E3 ubiquitin-protein ligase TRIM23

Gene

TRIM23

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Acts as an E3 ubiquitin-protein ligase. In the presence of the human cytomegalovirus (HCMV) protein UL144, participates in 'Lys-63'-linked auto-ubiquitination of TRAF6 resulting in the virally controlled activation of NF-kappa-B at early time of infection. The C-terminus can act as an allosteric activator of the cholera toxin catalytic subunit.1 Publication

Pathwayi

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri31 – 7646RING-type; degeneratePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri122 – 16847B box-type; degeneratePROSITE-ProRule annotationAdd
BLAST
Nucleotide bindingi411 – 4188GTPBy similarity
Nucleotide bindingi454 – 4585GTPBy similarity
Nucleotide bindingi513 – 5164GTPBy similarity

GO - Molecular functioni

  • enzyme activator activity Source: ProtInc
  • GDP binding Source: HGNC
  • GTPase activity Source: HGNC
  • GTP binding Source: HGNC
  • identical protein binding Source: IntAct
  • ligase activity Source: UniProtKB-KW
  • ubiquitin-protein transferase activity Source: HGNC
  • zinc ion binding Source: InterPro

GO - Biological processi

  • positive regulation of catalytic activity Source: GOC
  • protein ubiquitination Source: HGNC
  • small GTPase mediated signal transduction Source: InterPro
  • viral process Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Ligase

Keywords - Biological processi

Host-virus interaction, Ubl conjugation pathway

Keywords - Ligandi

GTP-binding, Metal-binding, Nucleotide-binding, Zinc

Enzyme and pathway databases

UniPathwayiUPA00143.

Names & Taxonomyi

Protein namesi
Recommended name:
E3 ubiquitin-protein ligase TRIM23 (EC:6.3.2.-)
Alternative name(s):
ADP-ribosylation factor domain-containing protein 1
GTP-binding protein ARD-1
RING finger protein 46
Tripartite motif-containing protein 23
Gene namesi
Name:TRIM23
Synonyms:ARD1, ARFD1, RNF46
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 5

Organism-specific databases

HGNCiHGNC:660. TRIM23.

Subcellular locationi

GO - Cellular componenti

  • extracellular exosome Source: UniProtKB
  • Golgi membrane Source: HGNC
  • lysosomal membrane Source: HGNC
  • nucleus Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Golgi apparatus, Lysosome, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi34 – 341C → A: Loss of E3 ubiquitin-protein ligase activity. 1 Publication
Mutagenesisi53 – 531H → A: Loss of E3 ubiquitin-protein ligase activity. 1 Publication
Mutagenesisi418 – 4181T → N: Maintains GTPase activity. Increases interaction with PSCD1. 1 Publication
Mutagenesisi458 – 4581K → I: Suppresses GTPase activity. Decreases interaction with PSCD1. 1 Publication

Organism-specific databases

PharmGKBiPA24943.

Polymorphism and mutation databases

BioMutaiTRIM23.
DMDMi543839.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 574574E3 ubiquitin-protein ligase TRIM23PRO_0000207483Add
BLAST

Proteomic databases

MaxQBiP36406.
PaxDbiP36406.
PRIDEiP36406.

PTM databases

PhosphoSiteiP36406.

Expressioni

Gene expression databases

BgeeiP36406.
CleanExiHS_TRIM23.
ExpressionAtlasiP36406. baseline and differential.
GenevestigatoriP36406.

Organism-specific databases

HPAiHPA039605.

Interactioni

Subunit structurei

Interacts with PSCD1. Interacts with human cytomegalovirus protein UL144; this interaction might causes auto-ubiquitination of TRAF6, leading to NF-kappaB activation.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
itself4EBI-740098,EBI-740098
G2XKQ03EBI-740098,EBI-10175576
ANKRD36BP1Q96IX93EBI-740098,EBI-744859
AQP1P299723EBI-740098,EBI-745213
ARFGAP1Q8N6T33EBI-740098,EBI-716933
ARHGEF3Q9NR813EBI-740098,EBI-10312733
ATPAF2Q8N5M13EBI-740098,EBI-1166928
BAG1Q999335EBI-740098,EBI-1030678
C19orf57Q0VDD74EBI-740098,EBI-741210
C8orf33Q9H7E93EBI-740098,EBI-715389
CARD9Q9H2573EBI-740098,EBI-751319
CCDC146Q8IYE0-23EBI-740098,EBI-10247802
CCDC25Q86WR03EBI-740098,EBI-2690264
CDC20BQ86Y333EBI-740098,EBI-10260504
CDR2Q018503EBI-740098,EBI-1181367
CFAP53Q96M913EBI-740098,EBI-742422
COX5BP106064EBI-740098,EBI-1053725
CREB5Q02930-33EBI-740098,EBI-10192698
CXCL14O957153EBI-740098,EBI-2798068
DCXO436023EBI-740098,EBI-8646694
DMC1Q145653EBI-740098,EBI-930865
DMRT3Q9NQL93EBI-740098,EBI-9679045
DOCK2Q926083EBI-740098,EBI-448771
EAF2Q96CJ13EBI-740098,EBI-1245604
EXOC3-AS1Q8N2X63EBI-740098,EBI-749333
FAM103A1Q9BTL33EBI-740098,EBI-744023
FAM110AQ9BQ893EBI-740098,EBI-1752811
FAM133AQ8N9E03EBI-740098,EBI-10268158
FAM193BQ96PV7-23EBI-740098,EBI-10292648
FAM208BQ5VWN6-23EBI-740098,EBI-10172380
FAM83AQ86UY53EBI-740098,EBI-1384254
FAM90A1Q86YD73EBI-740098,EBI-6658203
FBF1Q8TES7-63EBI-740098,EBI-10244131
FLJ38668C0H5X23EBI-740098,EBI-10176227
GATA2P237693EBI-740098,EBI-2806671
GEMP550403EBI-740098,EBI-744104
GMCL1P1Q8NEA93EBI-740098,EBI-745707
GPANK1O958723EBI-740098,EBI-751540
GPKOWQ929173EBI-740098,EBI-746309
HAUS1Q96CS23EBI-740098,EBI-2514791
Hoxa1P090222EBI-740098,EBI-3957603From a different organism.
HOXB5P090673EBI-740098,EBI-3893317
HSPB7Q9UBY93EBI-740098,EBI-739361
IQUBQ8NA543EBI-740098,EBI-10220600
JOSD1Q150403EBI-740098,EBI-2510602
KAT5Q929933EBI-740098,EBI-399080
KIFC3Q9BVG83EBI-740098,EBI-2125614
KLHL42Q9P2K63EBI-740098,EBI-739890
KRT6AP025385EBI-740098,EBI-702198
LGALS8O002143EBI-740098,EBI-740058
LINC00526Q96FQ73EBI-740098,EBI-10286106
LMO2P257913EBI-740098,EBI-739696
MORN4Q8NDC43EBI-740098,EBI-10269566
MRPL4Q9BYD33EBI-740098,EBI-721368
MRPL45Q9BRJ23EBI-740098,EBI-2514313
MTFR2Q6P4443EBI-740098,EBI-10252703
NEK6Q9HC983EBI-740098,EBI-740364
NFU1Q9UMS03EBI-740098,EBI-725252
NXT2Q9NPJ83EBI-740098,EBI-752122
PHF1O431893EBI-740098,EBI-530034
PIAS2O759283EBI-740098,EBI-348555
PIK3R2O004593EBI-740098,EBI-346930
PKP4Q995693EBI-740098,EBI-726447
POLLQ9UGP5-23EBI-740098,EBI-10320765
PPIL2Q133563EBI-740098,EBI-7705988
PPP1R18Q6NYC83EBI-740098,EBI-2557469
PSMA1P257865EBI-740098,EBI-359352
RNF213Q63HN8-63EBI-740098,EBI-10248548
RSRC2Q7L4I2-23EBI-740098,EBI-10256202
RTP5Q14D333EBI-740098,EBI-10217913
SH2D4AQ9H7883EBI-740098,EBI-747035
SH2D4AQ9H788-23EBI-740098,EBI-10308083
SIAH1Q8IUQ43EBI-740098,EBI-747107
SLC25A6P122363EBI-740098,EBI-356254
SMG9Q9H0W83EBI-740098,EBI-2872322
SNAI1O958633EBI-740098,EBI-1045459
SNAI2O436233EBI-740098,EBI-9876238
SNRPBP14678-23EBI-740098,EBI-372475
SORBS3O605043EBI-740098,EBI-741237
SPG21Q9NZD83EBI-740098,EBI-742688
STK19B7ZLI83EBI-740098,EBI-10176124
TBC1D22BQ9NU193EBI-740098,EBI-8787464
TMSB4XQ0P5Q03EBI-740098,EBI-10226570
TNFAIP3P215803EBI-740098,EBI-527670
TRAF1Q130773EBI-740098,EBI-359224
TRIM29Q0P6H73EBI-740098,EBI-10226710
TRIM29Q141343EBI-740098,EBI-702370
TRIM42A1L4B63EBI-740098,EBI-10172216
TROAPQ128155EBI-740098,EBI-2349743
TSHZ3A1L0U73EBI-740098,EBI-10171826
TXNDC5Q86UY03EBI-740098,EBI-2825190
UBE2IQ7KZS03EBI-740098,EBI-10180829
USP20Q9Y2K63EBI-740098,EBI-2511991
UTP23Q9BRU93EBI-740098,EBI-5457544
WDR25Q64LD23EBI-740098,EBI-744560
ZC2HC1CQ53FD03EBI-740098,EBI-740767
ZNF564Q8TBZ83EBI-740098,EBI-10273713
ZNF581Q9P0T44EBI-740098,EBI-745520

Protein-protein interaction databases

BioGridi106868. 145 interactions.
IntActiP36406. 135 interactions.
MINTiMINT-1442172.
STRINGi9606.ENSP00000231524.

Structurei

3D structure databases

ProteinModelPortaliP36406.
SMRiP36406. Positions 16-79, 127-219, 371-565.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni390 – 574185ARF-likeAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili352 – 37928Sequence AnalysisAdd
BLAST

Domaini

The RING-type zinc finger domain is responsible for E3 ubiquitin ligase activity.

Sequence similaritiesi

In the C-terminal section; belongs to the small GTPase superfamily. Arf family.Curated
Contains 1 B box-type zinc finger.PROSITE-ProRule annotation
Contains 1 RING-type zinc finger.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri31 – 7646RING-type; degeneratePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri122 – 16847B box-type; degeneratePROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Coiled coil, Zinc-finger

Phylogenomic databases

eggNOGiCOG1100.
GeneTreeiENSGT00780000121855.
HOGENOMiHOG000008208.
HOVERGENiHBG000551.
InParanoidiP36406.
KOiK07963.
OMAiRAVRCPF.
OrthoDBiEOG76DTS0.
PhylomeDBiP36406.
TreeFamiTF320703.

Family and domain databases

Gene3Di3.30.40.10. 1 hit.
3.40.50.300. 1 hit.
InterProiIPR003649. Bbox_C.
IPR027417. P-loop_NTPase.
IPR005225. Small_GTP-bd_dom.
IPR024156. Small_GTPase_ARF.
IPR006689. Small_GTPase_ARF/SAR.
IPR000315. Znf_B-box.
IPR007087. Znf_C2H2.
IPR001841. Znf_RING.
IPR013083. Znf_RING/FYVE/PHD.
IPR017907. Znf_RING_CS.
[Graphical view]
PfamiPF00025. Arf. 1 hit.
PF00643. zf-B_box. 1 hit.
[Graphical view]
PRINTSiPR00328. SAR1GTPBP.
SMARTiSM00177. ARF. 1 hit.
SM00502. BBC. 1 hit.
SM00336. BBOX. 2 hits.
SM00184. RING. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
TIGRFAMsiTIGR00231. small_GTP. 1 hit.
PROSITEiPS51417. ARF. 1 hit.
PS50119. ZF_BBOX. 1 hit.
PS00518. ZF_RING_1. 1 hit.
PS50089. ZF_RING_2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform Alpha (identifier: P36406-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MATLVVNKLG AGVDSGRQGS RGTAVVKVLE CGVCEDVFSL QGDKVPRLLL
60 70 80 90 100
CGHTVCHDCL TRLPLHGRAI RCPFDRQVTD LGDSGVWGLK KNFALLELLE
110 120 130 140 150
RLQNGPIGQY GAAEESIGIS GESIIRCDED EAHLASVYCT VCATHLCSEC
160 170 180 190 200
SQVTHSTKTL AKHRRVPLAD KPHEKTMCSQ HQVHAIEFVC LEEGCQTSPL
210 220 230 240 250
MCCVCKEYGK HQGHKHSVLE PEANQIRASI LDMAHCIRTF TEEISDYSRK
260 270 280 290 300
LVGIVQHIEG GEQIVEDGIG MAHTEHVPGT AENARSCIRA YFYDLHETLC
310 320 330 340 350
RQEEMALSVV DAHVREKLIW LRQQQEDMTI LLSEVSAACL HCEKTLQQDD
360 370 380 390 400
CRVVLAKQEI TRLLETLQKQ QQQFTEVADH IQLDASIPVT FTKDNRVHIG
410 420 430 440 450
PKMEIRVVTL GLDGAGKTTI LFKLKQDEFM QPIPTIGFNV ETVEYKNLKF
460 470 480 490 500
TIWDVGGKHK LRPLWKHYYL NTQAVVFVVD SSHRDRISEA HSELAKLLTE
510 520 530 540 550
KELRDALLLI FANKQDVAGA LSVEEITELL SLHKLCCGRS WYIQGCDARS
560 570
GMGLYEGLDW LSRQLVAAGV LDVA
Length:574
Mass (Da):64,067
Last modified:June 1, 1994 - v1
Checksum:iCB85923B29BF0320
GO
Isoform Beta (identifier: P36406-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     551-574: GMGLYEGLDWLSRQLVAAGVLDVA → VFQIICDQYTGKEVVTEKG

Show »
Length:569
Mass (Da):63,690
Checksum:i21399953A4224B7A
GO
Isoform Gamma (identifier: P36406-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     541-574: WYIQGCDARSGMGLYEGLDWLSRQLVAAGVLDVA → CFSDNM

Show »
Length:546
Mass (Da):61,068
Checksum:iD21D92EED6E967A2
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti480 – 4801D → N.
Corresponds to variant rs34046496 [ dbSNP | Ensembl ].
VAR_048320

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei541 – 57434WYIQG…VLDVA → CFSDNM in isoform Gamma. 1 PublicationVSP_000297Add
BLAST
Alternative sequencei551 – 57424GMGLY…VLDVA → VFQIICDQYTGKEVVTEKG in isoform Beta. 1 PublicationVSP_000296Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L04510 mRNA. Translation: AAA35940.1.
AF230397 mRNA. Translation: AAG50176.1.
AF230398 mRNA. Translation: AAG50177.1.
AF230399 mRNA. Translation: AAG50178.1.
BC022510 mRNA. Translation: AAH22510.1.
CCDSiCCDS3986.1. [P36406-3]
CCDS3987.1. [P36406-1]
CCDS43322.1. [P36406-2]
PIRiA46054.
RefSeqiNP_001647.1. NM_001656.3. [P36406-1]
NP_150230.1. NM_033227.2. [P36406-2]
NP_150231.1. NM_033228.2. [P36406-3]
UniGeneiHs.792.

Genome annotation databases

EnsembliENST00000231524; ENSP00000231524; ENSG00000113595. [P36406-1]
ENST00000274327; ENSP00000274327; ENSG00000113595. [P36406-3]
ENST00000381018; ENSP00000370406; ENSG00000113595. [P36406-2]
GeneIDi373.
KEGGihsa:373.
UCSCiuc003jtw.3. human. [P36406-3]
uc003jtx.3. human. [P36406-2]
uc003jty.3. human. [P36406-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L04510 mRNA. Translation: AAA35940.1.
AF230397 mRNA. Translation: AAG50176.1.
AF230398 mRNA. Translation: AAG50177.1.
AF230399 mRNA. Translation: AAG50178.1.
BC022510 mRNA. Translation: AAH22510.1.
CCDSiCCDS3986.1. [P36406-3]
CCDS3987.1. [P36406-1]
CCDS43322.1. [P36406-2]
PIRiA46054.
RefSeqiNP_001647.1. NM_001656.3. [P36406-1]
NP_150230.1. NM_033227.2. [P36406-2]
NP_150231.1. NM_033228.2. [P36406-3]
UniGeneiHs.792.

3D structure databases

ProteinModelPortaliP36406.
SMRiP36406. Positions 16-79, 127-219, 371-565.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi106868. 145 interactions.
IntActiP36406. 135 interactions.
MINTiMINT-1442172.
STRINGi9606.ENSP00000231524.

PTM databases

PhosphoSiteiP36406.

Polymorphism and mutation databases

BioMutaiTRIM23.
DMDMi543839.

Proteomic databases

MaxQBiP36406.
PaxDbiP36406.
PRIDEiP36406.

Protocols and materials databases

DNASUi373.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000231524; ENSP00000231524; ENSG00000113595. [P36406-1]
ENST00000274327; ENSP00000274327; ENSG00000113595. [P36406-3]
ENST00000381018; ENSP00000370406; ENSG00000113595. [P36406-2]
GeneIDi373.
KEGGihsa:373.
UCSCiuc003jtw.3. human. [P36406-3]
uc003jtx.3. human. [P36406-2]
uc003jty.3. human. [P36406-1]

Organism-specific databases

CTDi373.
GeneCardsiGC05M064885.
HGNCiHGNC:660. TRIM23.
HPAiHPA039605.
MIMi601747. gene.
neXtProtiNX_P36406.
PharmGKBiPA24943.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiCOG1100.
GeneTreeiENSGT00780000121855.
HOGENOMiHOG000008208.
HOVERGENiHBG000551.
InParanoidiP36406.
KOiK07963.
OMAiRAVRCPF.
OrthoDBiEOG76DTS0.
PhylomeDBiP36406.
TreeFamiTF320703.

Enzyme and pathway databases

UniPathwayiUPA00143.

Miscellaneous databases

GeneWikiiTRIM23.
GenomeRNAii373.
NextBioi1557.
PROiP36406.
SOURCEiSearch...

Gene expression databases

BgeeiP36406.
CleanExiHS_TRIM23.
ExpressionAtlasiP36406. baseline and differential.
GenevestigatoriP36406.

Family and domain databases

Gene3Di3.30.40.10. 1 hit.
3.40.50.300. 1 hit.
InterProiIPR003649. Bbox_C.
IPR027417. P-loop_NTPase.
IPR005225. Small_GTP-bd_dom.
IPR024156. Small_GTPase_ARF.
IPR006689. Small_GTPase_ARF/SAR.
IPR000315. Znf_B-box.
IPR007087. Znf_C2H2.
IPR001841. Znf_RING.
IPR013083. Znf_RING/FYVE/PHD.
IPR017907. Znf_RING_CS.
[Graphical view]
PfamiPF00025. Arf. 1 hit.
PF00643. zf-B_box. 1 hit.
[Graphical view]
PRINTSiPR00328. SAR1GTPBP.
SMARTiSM00177. ARF. 1 hit.
SM00502. BBC. 1 hit.
SM00336. BBOX. 2 hits.
SM00184. RING. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
TIGRFAMsiTIGR00231. small_GTP. 1 hit.
PROSITEiPS51417. ARF. 1 hit.
PS50119. ZF_BBOX. 1 hit.
PS00518. ZF_RING_1. 1 hit.
PS50089. ZF_RING_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "ARD 1, a 64-kDa guanine nucleotide-binding protein with a carboxyl-terminal ADP-ribosylation factor domain."
    Mishima K., Tsuchiya M., Nightingale M.S., Moss J., Vaughan M.
    J. Biol. Chem. 268:8801-8807(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA).
  2. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA; BETA AND GAMMA).
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM ALPHA).
    Tissue: Brain.
  4. "Localization of ADP-ribosylation factor domain protein 1 (ARD1) in lysosomes and Golgi apparatus."
    Vitale N., Horiba K., Ferrans V.J., Moss J., Vaughan M.
    Proc. Natl. Acad. Sci. U.S.A. 95:8613-8618(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION.
  5. "Specific functional interaction of human cytohesin-1 and ADP-ribosylation factor domain protein (ARD1)."
    Vitale N., Pacheco-Rodriguez G., Ferrans V.J., Riemenschneider W., Moss J., Vaughan M.
    J. Biol. Chem. 275:21331-21339(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH PSCD1, MUTAGENESIS OF THR-418 AND LYS-458.
  6. "E3 ubiquitin ligase activity of the trifunctional ARD1 (ADP-ribosylation factor domain protein 1)."
    Vichi A., Payne D.M., Pacheco-Rodriguez G., Moss J., Vaughan M.
    Proc. Natl. Acad. Sci. U.S.A. 102:1945-1950(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, MUTAGENESIS OF CYS-34 AND HIS-53.
  7. "Identification of TRIM23 as a cofactor involved in the regulation of NF-kappaB by human cytomegalovirus."
    Poole E., Groves I., MacDonald A., Pang Y., Alcami A., Sinclair J.
    J. Virol. 83:3581-3590(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH HUMAN CYTOMEGALOVIRUS PROTEIN UL144.

Entry informationi

Entry nameiTRI23_HUMAN
AccessioniPrimary (citable) accession number: P36406
Secondary accession number(s): Q9BZY4, Q9BZY5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 1, 1994
Last sequence update: June 1, 1994
Last modified: May 27, 2015
This is version 150 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.