P36406 (TRI23_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 130.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: E3 ubiquitin-protein ligase TRIM23 EC=6.3.2.- Alternative name(s): ADP-ribosylation factor domain-containing protein 1 GTP-binding protein ARD-1 RING finger protein 46 Tripartite motif-containing protein 23 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 574 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Acts as an E3 ubiquitin-protein ligase. In the presence of the human cytomegalovirus (HCMV) protein UL144, participates in 'Lys-63'-linked auto-ubiquitination of TRAF6 resulting in the virally controlled activation of NF-kappa-B at early time of infection. The C-terminus can act as an allosteric activator of the cholera toxin catalytic subunit. Ref.6 |
| Pathway | |
| Subunit structure | Interacts with PSCD1. Interacts with human cytomegalovirus protein UL144; this interaction might causes auto-ubiquitination of TRAF6, leading to NF-kappaB activation. Ref.5 Ref.7 |
| Subcellular location | Endomembrane system. Golgi apparatus membrane. Lysosome membrane. Note: Membrane-associated with the Golgi complex and lysosomal structures. Ref.4 |
| Domain | The RING-type zinc finger domain is responsible for E3 ubiquitin ligase activity. |
| Sequence similarities | In the C-terminal section; belongs to the small GTPase superfamily. Arf family. Contains 1 B box-type zinc finger. Contains 1 RING-type zinc finger. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| itself | 3 | EBI-740098,EBI-740098 | ||
| GEM | P55040 | 3 | EBI-740098,EBI-744104 | |
| Hoxa1 | P09022 | 2 | EBI-740098,EBI-3957603 | From a different organism. |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform Alpha (identifier: P36406-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Beta (identifier: P36406-2) The sequence of this isoform differs from the canonical sequence as follows: 551-574: GMGLYEGLDWLSRQLVAAGVLDVA → VFQIICDQYTGKEVVTEKG | ||||||
| Isoform Gamma (identifier: P36406-3) The sequence of this isoform differs from the canonical sequence as follows: 541-574: WYIQGCDARSGMGLYEGLDWLSRQLVAAGVLDVA → CFSDNM |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 574 | 574 | E3 ubiquitin-protein ligase TRIM23 | PRO_0000207483 | |||||
Regions | |||||||||
| Zinc finger | 31 – 76 | 46 | RING-type; degenerate | ||||||
| Zinc finger | 122 – 168 | 47 | B box-type; degenerate | ||||||
| Nucleotide binding | 411 – 418 | 8 | GTP By similarity | ||||||
| Nucleotide binding | 454 – 458 | 5 | GTP By similarity | ||||||
| Nucleotide binding | 513 – 516 | 4 | GTP By similarity | ||||||
| Region | 390 – 574 | 185 | ARF-like | ||||||
| Coiled coil | 352 – 379 | 28 | Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 541 – 574 | 34 | WYIQG…VLDVA → CFSDNM in isoform Gamma. | VSP_000297 | |||||
| Alternative sequence | 551 – 574 | 24 | GMGLY…VLDVA → VFQIICDQYTGKEVVTEKG in isoform Beta. | VSP_000296 | |||||
| Natural variant | 480 | 1 | D → N. Corresponds to variant rs34046496 [ dbSNP | Ensembl ]. | VAR_048320 | |||||
Experimental info | |||||||||
| Mutagenesis | 34 | 1 | C → A: Loss of E3 ubiquitin-protein ligase activity. Ref.6 | ||||||
| Mutagenesis | 53 | 1 | H → A: Loss of E3 ubiquitin-protein ligase activity. Ref.6 | ||||||
| Mutagenesis | 418 | 1 | T → N: Maintains GTPase activity. Increases interaction with PSCD1. Ref.5 | ||||||
| Mutagenesis | 458 | 1 | K → I: Suppresses GTPase activity. Decreases interaction with PSCD1. Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "ARD 1, a 64-kDa guanine nucleotide-binding protein with a carboxyl-terminal ADP-ribosylation factor domain." Mishima K., Tsuchiya M., Nightingale M.S., Moss J., Vaughan M. J. Biol. Chem. 268:8801-8807(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA). |
| [2] | "The tripartite motif family identifies cell compartments." Reymond A., Meroni G., Fantozzi A., Merla G., Cairo S., Luzi L., Riganelli D., Zanaria E., Messali S., Cainarca S., Guffanti A., Minucci S., Pelicci P.G., Ballabio A. EMBO J. 20:2140-2151(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA; BETA AND GAMMA). |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM ALPHA). Tissue: Brain. |
| [4] | "Localization of ADP-ribosylation factor domain protein 1 (ARD1) in lysosomes and Golgi apparatus." Vitale N., Horiba K., Ferrans V.J., Moss J., Vaughan M. Proc. Natl. Acad. Sci. U.S.A. 95:8613-8618(1998) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [5] | "Specific functional interaction of human cytohesin-1 and ADP-ribosylation factor domain protein (ARD1)." Vitale N., Pacheco-Rodriguez G., Ferrans V.J., Riemenschneider W., Moss J., Vaughan M. J. Biol. Chem. 275:21331-21339(2000) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH PSCD1, MUTAGENESIS OF THR-418 AND LYS-458. |
| [6] | "E3 ubiquitin ligase activity of the trifunctional ARD1 (ADP-ribosylation factor domain protein 1)." Vichi A., Payne D.M., Pacheco-Rodriguez G., Moss J., Vaughan M. Proc. Natl. Acad. Sci. U.S.A. 102:1945-1950(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, MUTAGENESIS OF CYS-34 AND HIS-53. |
| [7] | "Identification of TRIM23 as a cofactor involved in the regulation of NF-kappaB by human cytomegalovirus." Poole E., Groves I., MacDonald A., Pang Y., Alcami A., Sinclair J. J. Virol. 83:3581-3590(2009) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH HUMAN CYTOMEGALOVIRUS PROTEIN UL144. |
| [8] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | L04510 mRNA. Translation: AAA35940.1. AF230397 mRNA. Translation: AAG50176.1. AF230398 mRNA. Translation: AAG50177.1. AF230399 mRNA. Translation: AAG50178.1. BC022510 mRNA. Translation: AAH22510.1. |
| IPI | IPI00003328. IPI00018593. IPI00220244. |
| PIR | A46054. |
| RefSeq | NP_001647.1. NM_001656.3. NP_150230.1. NM_033227.2. NP_150231.1. NM_033228.2. |
| UniGene | Hs.792. |
3D structure databases | |
| ProteinModelPortal | P36406. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P36406. 40 interactions. |
| MINT | MINT-1442172. |
| STRING | 9606.ENSP00000231524. |
PTM databases | |
| PhosphoSite | P36406. |
Polymorphism databases | |
| DMDM | 543839. |
Proteomic databases | |
| PaxDb | P36406. |
| PRIDE | P36406. |
Protocols and materials databases | |
| DNASU | 373. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000231524; ENSP00000231524; ENSG00000113595. ENST00000274327; ENSP00000274327; ENSG00000113595. ENST00000381018; ENSP00000370406; ENSG00000113595. |
| GeneID | 373. |
| KEGG | hsa:373. |
| UCSC | uc003jtw.3. human. uc003jtx.3. human. uc003jty.3. human. |
Organism-specific databases | |
| CTD | 373. |
| GeneCards | GC05M064885. |
| HGNC | HGNC:660. TRIM23. |
| HPA | HPA039605. |
| MIM | 601747. gene. |
| neXtProt | NX_P36406. |
| PharmGKB | PA24943. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG1100. |
| HOGENOM | HOG000008208. |
| HOVERGEN | HBG000551. |
| InParanoid | P36406. |
| KO | K07963. |
| OMA | RAVRCPF. |
| OrthoDB | EOG4001HX. |
| PhylomeDB | P36406. |
Enzyme and pathway databases | |
| UniPathway | UPA00143. |
Gene expression databases | |
| ArrayExpress | P36406. |
| Bgee | P36406. |
| CleanEx | HS_TRIM23. |
| Genevestigator | P36406. |
| GermOnline | ENSG00000113595. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.30.40.10. 1 hit. |
| InterPro | IPR003649. Bbox_C. IPR027417. P-loop_NTPase. IPR005225. Small_GTP-bd_dom. IPR024156. Small_GTPase_ARF. IPR006689. Small_GTPase_ARF/SAR. IPR000315. Znf_B-box. IPR007087. Znf_C2H2. IPR001841. Znf_RING. IPR013083. Znf_RING/FYVE/PHD. IPR017907. Znf_RING_CS. [Graphical view] |
| Pfam | PF00025. Arf. 1 hit. PF00643. zf-B_box. 1 hit. [Graphical view] |
| PRINTS | PR00328. SAR1GTPBP. |
| SMART | SM00177. ARF. 1 hit. SM00502. BBC. 1 hit. SM00336. BBOX. 2 hits. SM00184. RING. 1 hit. [Graphical view] |
| SUPFAM | SSF52540. SSF52540. 1 hit. |
| TIGRFAMs | TIGR00231. small_GTP. 1 hit. |
| PROSITE | PS51417. ARF. 1 hit. PS50119. ZF_BBOX. 1 hit. PS00518. ZF_RING_1. 1 hit. PS50089. ZF_RING_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 373. |
| NextBio | 1557. |
| SOURCE | Search... |
Entry information
| Entry name | TRI23_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P36406 Secondary accession number(s): Q9BZY4, Q9BZY5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 5 Human chromosome 5: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with
