P35916 (VGFR3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 153.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Vascular endothelial growth factor receptor 3 Short name=VEGFR-3 EC=2.7.10.1 Alternative name(s): Fms-like tyrosine kinase 4 Short name=FLT-4 Tyrosine-protein kinase receptor FLT4 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1363 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Tyrosine-protein kinase that acts as a cell-surface receptor for VEGFC and VEGFD, and plays an essential role in adult lymphangiogenesis and in the development of the vascular network and the cardiovascular system during embryonic development. Promotes proliferation, survival and migration of endothelial cells, and regulates angiogenic sprouting. Signaling by activated FLT4 leads to enhanced production of VEGFC, and to a lesser degree VEGFA, thereby creating a positive feedback loop that enhances FLT4 signaling. Modulates KDR signaling by forming heterodimers. The secreted isoform 3 may function as a decoy receptor for VEGFC and/or VEGFD and play an important role as a negative regulator of VEGFC-mediated lymphangiogenesis and angiogenesis. Binding of vascular growth factors to isoform 1 or isoform 2 leads to the activation of several signaling cascades; isoform 2 seems to be less efficient in signal transduction, because it has a truncated C-terminus and therefore lacks several phosphorylation sites. Mediates activation of the MAPK1/ERK2, MAPK3/ERK1 signaling pathway, of MAPK8 and the JUN signaling pathway, and of the AKT1 signaling pathway. Phosphorylates SHC1. Mediates phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase. Promotes phosphorylation of MAPK8 at 'Thr-183' and 'Tyr-185', and of AKT1 at 'Ser-473'. Ref.5 Ref.14 Ref.15 Ref.16 Ref.18 Ref.19 Ref.20 Ref.22 Ref.23 Ref.24 Ref.25 Ref.27 Ref.28 Ref.29 Ref.30 |
| Catalytic activity | ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate. Ref.13 Ref.17 |
| Enzyme regulation | Present in an inactive conformation in the absence of bound ligand. Binding of VEGFC or VEGFD leads to dimerization and activation by autophosphorylation on tyrosine residues. Inhibited by MAZ51. Ref.19 Ref.24 Ref.27 |
| Subunit structure | Interacts with VEGFC and VEGFD. Monomer in the absence of bound VEGFC or VEGFD. Homodimer in the presence of bound VEGFC or VEGFD. Can also form a heterodimer with KDR. Interacts with PTPN14; the interaction is enhanced by stimulation with VEGFC. Interacts with CRK, GRB2, PTK2/FAK1, SHC1, PIK3R1 and PTPN11/SHP-2. Identified in a complex with SRC and ITGB1. Ref.5 Ref.6 Ref.14 Ref.15 Ref.17 Ref.18 Ref.19 Ref.20 Ref.22 Ref.25 Ref.26 Ref.27 Ref.28 |
| Subcellular location | Cell membrane; Single-pass type I membrane protein Ref.6 Ref.13 Ref.22 Ref.29. Cytoplasm Ref.6 Ref.13 Ref.22 Ref.29. Nucleus. Note: Ligand-mediated autophosphorylation leads to rapid internalization. Ref.6 Ref.13 Ref.22 Ref.29 Isoform 1: Cell membrane; Single-pass type I membrane protein Ref.6 Ref.13 Ref.22 Ref.29. Note: Ligand-mediated autophosphorylation leads to rapid internalization. Ref.6 Ref.13 Ref.22 Ref.29 Isoform 2: Cell membrane; Single-pass type I membrane protein Ref.6 Ref.13 Ref.22 Ref.29. |
| Tissue specificity | Detected in endothelial cells (at protein level). Widely expressed. Detected in fetal spleen, lung and brain. Detected in adult liver, muscle, thymus, placenta, lung, testis, ovary, prostate, heart, and kidney. Ref.1 Ref.14 Ref.28 |
| Domain | The first and second Ig-like C2-type (immunoglobulin-like) domains are sufficient for VEGFC binding. |
| Post-translational modification | Autophosphorylated on tyrosine residues upon ligand binding. Autophosphorylation occurs in trans, i.e. one subunit of the dimeric receptor phosphorylates tyrosine residues on the other subunit. Phosphorylation in response to H2O2 is mediated by a process that requires SRC and PRKCD activity. Phosphorylation at Tyr-1068 is required for autophosphorylation at additional tyrosine residues. Phosphorylation at Tyr-1063 and Tyr-1337 is important for interaction with CRK and subsequent activation of MAPK8. Phosphorylation at Tyr-1230, Tyr-1231 and Tyr-1337 is important for interaction with GRB2 and subsequent activation of the AKT1 and MAPK1/ERK2 and/or MAPK3/ERK1 signaling pathways. In response to endothelial cell adhesion onto collagen, can also be phosphorylated in the absence of FLT4 kinase activity by SRC at Tyr-830, Tyr-833, Tyr-853, Tyr-1063, Tyr-1333, and Tyr-1337. Ref.5 Ref.14 Ref.15 Ref.17 Ref.18 Ref.19 Ref.20 Ref.24 Ref.27 |
| Involvement in disease | Lymphedema, hereditary, 1A (LMPH1A) [MIM:153100]: A chronic disabling condition which results in swelling of the extremities due to altered lymphatic flow. Patients with lymphedema suffer from recurrent local infections and physical impairment. Hemangioma, capillary infantile (HCI) [MIM:602089]: A condition characterized by dull red, firm, dome-shaped hemangiomas, sharply demarcated from surrounding skin, usually presenting at birth or occurring within the first two or three months of life. They result from highly proliferative, localized growth of capillary endothelium and generally undergo regression and involution without scarring. Plays an important role in tumor lymphangiogenesis, in cancer cell survival, migration, and formation of metastases. |
| Sequence similarities | Belongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily. Contains 7 Ig-like C2-type (immunoglobulin-like) domains. Contains 1 protein kinase domain. |
| Sequence caution | The sequence CAA48290.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| HSP90AB1 | P08238 | 2 | EBI-1005467,EBI-352572 | |
| KDR | P35968 | 3 | EBI-1005467,EBI-1005487 | |
| VEGFC | P49767 | 2 | EBI-1005467,EBI-3405539 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P35916-2) Also known as: Long; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P35916-1) Also known as: Short; The sequence of this isoform differs from the canonical sequence as follows: 1298-1363: SCKGPGQNVAVTRAHPDSQGRRRRPERGARGGQVFYNSEYGELSEPSEEDHCSPSARVTFFTDNSY → R | ||||||
| Isoform 3 (identifier: P35916-3) Also known as: sVegfr3; The sequence of this isoform differs from the canonical sequence as follows: 724-765: VDLADSNQKL...CVNSSASVAV → REGGPGEGQV...ESTWRTPTRS 766-1298: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 24 | 24 | Ref.12 | ||||||||
| Chain | 25 – 1363 | 1339 | Vascular endothelial growth factor receptor 3 | PRO_0000016776 | |||||||
Regions | |||||||||||
| Topological domain | 25 – 775 | 751 | Extracellular Potential | ||||||||
| Transmembrane | 776 – 796 | 21 | Helical; Potential | ||||||||
| Topological domain | 797 – 1363 | 567 | Cytoplasmic Potential | ||||||||
| Domain | 30 – 127 | 98 | Ig-like C2-type 1 | ||||||||
| Domain | 151 – 213 | 63 | Ig-like C2-type 2 | ||||||||
| Domain | 219 – 326 | 108 | Ig-like C2-type 3 | ||||||||
| Domain | 331 – 415 | 85 | Ig-like C2-type 4 | ||||||||
| Domain | 422 – 552 | 131 | Ig-like C2-type 5 | ||||||||
| Domain | 555 – 671 | 117 | Ig-like C2-type 6 | ||||||||
| Domain | 678 – 764 | 87 | Ig-like C2-type 7 | ||||||||
| Domain | 845 – 1173 | 329 | Protein kinase | ||||||||
| Nucleotide binding | 851 – 859 | 9 | ATP By similarity | ||||||||
Sites | |||||||||||
| Active site | 1037 | 1 | Proton acceptor By similarity | ||||||||
| Binding site | 879 | 1 | ATP Probable | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 830 | 1 | Phosphotyrosine; by SRC Ref.27 | ||||||||
| Modified residue | 833 | 1 | Phosphotyrosine; by SRC Ref.27 | ||||||||
| Modified residue | 853 | 1 | Phosphotyrosine; by SRC Ref.27 | ||||||||
| Modified residue | 1063 | 1 | Phosphotyrosine; by autocatalysis and SRC Ref.20 Ref.27 | ||||||||
| Modified residue | 1068 | 1 | Phosphotyrosine; by autocatalysis Ref.20 Ref.27 | ||||||||
| Modified residue | 1230 | 1 | Phosphotyrosine; by autocatalysis Ref.17 Ref.20 | ||||||||
| Modified residue | 1231 | 1 | Phosphotyrosine; by autocatalysis Ref.17 Ref.20 | ||||||||
| Modified residue | 1265 | 1 | Phosphotyrosine; by autocatalysis Ref.17 | ||||||||
| Modified residue | 1333 | 1 | Phosphotyrosine; by autocatalysis and SRC Ref.17 Ref.27 | ||||||||
| Modified residue | 1337 | 1 | Phosphotyrosine; by autocatalysis and SRC Ref.17 Ref.20 Ref.27 | ||||||||
| Modified residue | 1363 | 1 | Phosphotyrosine; by autocatalysis Ref.17 | ||||||||
| Glycosylation | 33 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 104 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 166 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 251 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 299 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 411 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 515 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 527 | 1 | N-linked (GlcNAc...) Ref.21 | ||||||||
| Glycosylation | 594 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 683 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 690 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 758 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 51 ↔ 111 | By similarity | |||||||||
| Disulfide bond | 158 ↔ 206 | By similarity | |||||||||
| Disulfide bond | 252 ↔ 310 | By similarity | |||||||||
| Disulfide bond | 445 ↔ 534 | By similarity | |||||||||
| Disulfide bond | 578 ↔ 653 | By similarity | |||||||||
| Disulfide bond | 699 ↔ 751 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 724 – 765 | 42 | VDLAD…ASVAV → REGGPGEGQVRRPARPTIPN PGGPAPPPHPLQESTWRTPT RS in isoform 3. | VSP_041993 | |||||||
| Alternative sequence | 766 – 1298 | 533 | Missing in isoform 3. | VSP_041994 | |||||||
| Alternative sequence | 1298 – 1363 | 66 | SCKGP…TDNSY → R in isoform 2. | VSP_041995 | |||||||
| Natural variant | 149 | 1 | N → D. Ref.39 Corresponds to variant rs34221241 [ dbSNP | Ensembl ]. | VAR_042062 | |||||||
| Natural variant | 378 | 1 | R → C in a renal clear cell carcinoma sample; somatic mutation. Ref.39 | VAR_042063 | |||||||
| Natural variant | 494 | 1 | T → A. Ref.38 Ref.39 Corresponds to variant rs307826 [ dbSNP | Ensembl ]. | VAR_018407 | |||||||
| Natural variant | 527 | 1 | N → S. Ref.39 Corresponds to variant rs35874891 [ dbSNP | Ensembl ]. | VAR_034379 | |||||||
| Natural variant | 641 | 1 | P → S. Ref.37 Ref.39 Corresponds to variant rs55667289 [ dbSNP | Ensembl ]. | VAR_018408 | |||||||
| Natural variant | 857 | 1 | G → R in LMPH1A; loss of kinase activity. Ref.19 Ref.37 | VAR_018409 | |||||||
| Natural variant | 868 | 1 | H → Y. Ref.39 Corresponds to variant rs35171798 [ dbSNP | Ensembl ]. | VAR_042064 | |||||||
| Natural variant | 890 | 1 | H → Q. Ref.4 Ref.7 Ref.8 Ref.38 Corresponds to variant rs448012 [ dbSNP | Ensembl ]. | VAR_018410 | |||||||
| Natural variant | 954 | 1 | P → S in HCI. Ref.38 Corresponds to variant rs34255532 [ dbSNP | Ensembl ]. | VAR_018411 | |||||||
| Natural variant | 1010 | 1 | T → I in a metastatic melanoma sample; somatic mutation. Ref.39 | VAR_042065 | |||||||
| Natural variant | 1031 | 1 | R → Q. Ref.39 Corresponds to variant rs56082504 [ dbSNP | Ensembl ]. | VAR_042066 | |||||||
| Natural variant | 1035 | 1 | H → R in LMPH1A; loss of kinase activity. Ref.36 | VAR_018412 | |||||||
| Natural variant | 1041 | 1 | R → P in LMPH1A; loss of kinase activity. Ref.17 Ref.37 | VAR_018413 | |||||||
| Natural variant | 1044 | 1 | L → P in LMPH1A; loss of kinase activity. Ref.37 | VAR_018414 | |||||||
| Natural variant | 1049 | 1 | D → N. Ref.39 Corresponds to variant rs56310180 [ dbSNP | Ensembl ]. | VAR_042067 | |||||||
| Natural variant | 1075 | 1 | R → Q. Ref.39 | VAR_042068 | |||||||
| Natural variant | 1114 | 1 | P → L in LMPH1A; loss of kinase activity. Ref.35 Ref.37 | VAR_018415 | |||||||
| Natural variant | 1137 | 1 | P → S in HCI. Ref.38 | VAR_018416 | |||||||
| Natural variant | 1146 | 1 | R → H. Ref.4 Ref.7 Ref.38 Ref.39 Corresponds to variant rs1130379 [ dbSNP | Ensembl ]. | VAR_018417 | |||||||
Experimental info | |||||||||||
| Mutagenesis | 879 | 1 | K → G: Abolishes enzyme activity. Ref.17 | ||||||||
| Mutagenesis | 1063 | 1 | Y → F: Loss of phosphorylation site. No effect on stimulation of cell proliferation and cell migration. Ref.20 Ref.27 | ||||||||
| Mutagenesis | 1068 | 1 | Y → F: Global loss of autophosphorylation. Abolishes stimulation of cell proliferation and cell migration. Ref.20 Ref.27 | ||||||||
| Mutagenesis | 1230 | 1 | Y → F: Loss of phosphorylation site. Strongly reduces stimulation of cell proliferation and cell migration. Ref.17 Ref.20 | ||||||||
| Mutagenesis | 1231 | 1 | Y → F: Loss of phosphorylation site. Strongly reduces stimulation of cell proliferation and cell migration. Ref.17 Ref.20 | ||||||||
| Mutagenesis | 1265 | 1 | Y → F: Loss of phosphorylation site. No effect on stimulation of cell proliferation and cell migration. Ref.17 | ||||||||
| Mutagenesis | 1333 | 1 | Y → F: Loss of phosphorylation site. Reduced autophosphorylation. Ref.14 Ref.17 | ||||||||
| Mutagenesis | 1337 | 1 | Y → F: Reduced autophosphorylation. Strongly reduces stimulation of cell proliferation and cell migration. Ref.14 Ref.17 Ref.27 | ||||||||
| Mutagenesis | 1363 | 1 | Y → F: Loss of phosphorylation site. Slighly reduced autophosphorylation. Ref.14 Ref.17 | ||||||||
| Sequence conflict | 24 | 1 | G → D in CAA49505. Ref.3 | ||||||||
| Sequence conflict | 24 | 1 | G → D in AAO89504. Ref.7 | ||||||||
| Sequence conflict | 24 | 1 | G → D in AAO89505. Ref.7 | ||||||||
| Sequence conflict | 538 | 1 | N → D in BAF84368. Ref.8 | ||||||||
| Sequence conflict | 745 | 1 | R → P in CAA49505. Ref.3 | ||||||||
| Sequence conflict | 745 | 1 | R → P in AAO89504. Ref.7 | ||||||||
| Sequence conflict | 745 | 1 | R → P in AAO89505. Ref.7 | ||||||||
| Sequence conflict | 752 – 753 | 2 | NA → RP in CAA49505. Ref.3 | ||||||||
| Sequence conflict | 752 – 753 | 2 | NA → RP in AAO89504. Ref.7 | ||||||||
| Sequence conflict | 752 – 753 | 2 | NA → RP in AAO89505. Ref.7 | ||||||||
| Sequence conflict | 1128 | 1 | L → V in CAA49505. Ref.3 | ||||||||
| Sequence conflict | 1128 | 1 | L → V in AAO89504. Ref.7 | ||||||||
| Sequence conflict | 1128 | 1 | L → V in AAO89505. Ref.7 | ||||||||
| Sequence conflict | 1164 | 1 | E → D in CAA49505. Ref.3 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "FLT4 receptor tyrosine kinase contains seven immunoglobulin-like loops and is expressed in multiple human tissues and cell lines." Pajusola K., Aprelikova O., Korhonen J., Kaipainen A., Pertovaara L., Alitalo R., Alitalo K. Cancer Res. 52:5738-5743(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY. |
| [2] | Erratum Pajusola K., Aprelikova O., Korhonen J., Kaipainen A., Pertovaara L., Alitalo R., Alitalo K. Cancer Res. 53:3845-3845(1993) |
| [3] | "Chromosomal localization of FLT4, a novel receptor-type tyrosine kinase gene." Galland F., Karamysheva A., Mattei M.-G., Rosnet O., Marchetto S., Birnbaum D. Genomics 13:475-478(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [4] | "The FLT4 gene encodes a transmembrane tyrosine kinase related to the vascular endothelial growth factor receptor." Galland F., Karamysheva A., Pebusque M.-J., Borg J.-P., Rottapel R., Dubreuil P., Rosnet O., Birnbaum D. Oncogene 8:1233-1240(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), VARIANTS GLN-890 AND HIS-1146. Tissue: Placenta. |
| [5] | "Vascular endothelial growth factor-related protein: a ligand and specific activator of the tyrosine kinase receptor Flt4." Lee J., Gray A., Yuan J., Luoh S.-M., Avraham H., Wood W.I. Proc. Natl. Acad. Sci. U.S.A. 93:1988-1992(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), INTERACTION WITH VEGFC, PHOSPHORYLATION, FUNCTION IN CELL PROLIFERATION. |
| [6] | "Novel splice variants derived from the receptor tyrosine kinase superfamily are potential therapeutics for rheumatoid arthritis." Jin P., Zhang J., Sumariwalla P.F., Ni I., Jorgensen B., Crawford D., Phillips S., Feldmann M., Shepard H.M., Paleolog E.M. Arthritis Res. Ther. 10:R73-R73(2008) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), INTERACTION WITH VEGFD, SUBCELLULAR LOCATION. |
| [7] | Lian Z., Feitelson M. Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), VARIANTS GLN-890 AND HIS-1146. |
| [8] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT GLN-890. Tissue: Placenta. |
| [9] | "The DNA sequence and comparative analysis of human chromosome 5." Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S. Rubin E.M.Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [10] | "FLT4, a novel class III receptor tyrosine kinase in chromosome 5q33-qter." Aprelikova O., Pajusola K., Partanen J., Armstrong E., Alitalo R., Bailey S.K., McMahon J., Wasmuth J., Huebner K., Alitalo K. Cancer Res. 52:746-748(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 761-1190. |
| [11] | "Two human FLT4 receptor tyrosine kinase isoforms with distinct carboxy terminal tails are produced by alternative processing of primary transcripts." Pajusola K., Aprelikova O., Armstrong E., Morris S., Alitalo K. Oncogene 8:2931-2937(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1293-1363 (ISOFORM 1), ALTERNATIVE SPLICING. |
| [12] | "Signal peptide prediction based on analysis of experimentally verified cleavage sites." Zhang Z., Henzel W.J. Protein Sci. 13:2819-2824(2004) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 25-39. |
| [13] | "Biochemical characterization of two isoforms of FLT4, a VEGF receptor-related tyrosine kinase." Borg J.P., deLapeyriere O., Noguchi T., Rottapel R., Dubreuil P., Birnbaum D. Oncogene 10:973-984(1995) [PubMed] [Europe PMC] [Abstract] Cited for: CATALYTIC ACTIVITY, GLYCOSYLATION, SUBCELLULAR LOCATION. |
| [14] | "Mutation at tyrosine residue 1337 abrogates ligand-dependent transforming capacity of the FLT4 receptor." Fournier E., Dubreuil P., Birnbaum D., Borg J.P. Oncogene 11:921-931(1995) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN CELL PROLIFERATION AND PHOSPHORYLATION OF SHC1, CHARACTERIZATION OF ISOFORM 1 AND ISOFORM 2, INTERACTION WITH SHC1 AND GRB2, AUTOPHOSPHORYLATION, MUTAGENESIS OF TYR-1333; TYR-1337 AND TYR-1363, TISSUE SPECIFICITY. |
| [15] | "Vascular endothelial growth factor D (VEGF-D) is a ligand for the tyrosine kinases VEGF receptor 2 (Flk1) and VEGF receptor 3 (Flt4)." Achen M.G., Jeltsch M., Kukk E., Maekinen T., Vitali A., Wilks A.F., Alitalo K., Stacker S.A. Proc. Natl. Acad. Sci. U.S.A. 95:548-553(1998) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH VEGFD, FUNCTION AS VEGFD RECEPTOR, AUTOPHOSPHORYLATION. |
| [16] | "Isolated lymphatic endothelial cells transduce growth, survival and migratory signals via the VEGF-C/D receptor VEGFR-3." Makinen T., Veikkola T., Mustjoki S., Karpanen T., Catimel B., Nice E.C., Wise L., Mercer A., Kowalski H., Kerjaschki D., Stacker S.A., Achen M.G., Alitalo K. EMBO J. 20:4762-4773(2001) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION AS RECEPTOR FOR VEGFC AND VEGFD IN CELL SURVIVAL; PROLIFERATION AND MIGRATION, FUNCTION IN ACTIVATION OF PROTEIN KINASE C; AKT1; PIK3R1; MAPK1/ERK2 AND MAPK3/ERK1. |
| [17] | "Ligand-induced vascular endothelial growth factor receptor-3 (VEGFR-3) heterodimerization with VEGFR-2 in primary lymphatic endothelial cells regulates tyrosine phosphorylation sites." Dixelius J., Makinen T., Wirzenius M., Karkkainen M.J., Wernstedt C., Alitalo K., Claesson-Welsh L. J. Biol. Chem. 278:40973-40979(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH KDR, CATALYTIC ACTIVITY, AUTOPHOSPHORYLATION, CHARACTERIZATION OF VARIANT LMPH1A PRO-1041, MUTAGENESIS OF LYS-879; TYR-1230; TYR-1231; TYR-1265; TYR-1333; TYR-1337 AND TYR-1363, PHOSPHORYLATION AT TYR-1230; TYR-1231; TYR-1265; TYR-1333; TYR-1337 AND TYR-1363. |
| [18] | "Heterodimerization with vascular endothelial growth factor receptor-2 (VEGFR-2) is necessary for VEGFR-3 activity." Alam A., Herault J.P., Barron P., Favier B., Fons P., Delesque-Touchard N., Senegas I., Laboudie P., Bonnin J., Cassan C., Savi P., Ruggeri B., Carmeliet P., Bono F., Herbert J.M. Biochem. Biophys. Res. Commun. 324:909-915(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN KDR SIGNALING AND IN ANGIOGENESIS, INTERACTION WITH KDR, PHOSPHORYLATION. |
| [19] | "Activation of vascular endothelial growth factor receptor-3 and its downstream signaling promote cell survival under oxidative stress." Wang J.F., Zhang X., Groopman J.E. J. Biol. Chem. 279:27088-27097(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN CELL SURVIVAL, PHOSPHORYLATION IN RESPONSE TO OXIDATIVE STRESS, INTERACTION WITH PIK3R1; SHC1; GRB2, PTPN11/SHP-2 AND PLCG1, ENZYME REGULATION BY MAZ51, CHARACTERIZATION OF VARIANT LMPH1A ARG-857. |
| [20] | "Direct recruitment of CRK and GRB2 to VEGFR-3 induces proliferation, migration, and survival of endothelial cells through the activation of ERK, AKT, and JNK pathways." Salameh A., Galvagni F., Bardelli M., Bussolino F., Oliviero S. Blood 106:3423-3431(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN ACTIVATION OF AKT1; MAPK1/ERK2; MAPK3/ERK1 AND MAPK8, FUNCTION IN PROMOTING CELL SURVIVAL; PROLIFERATION AND MIGRATION, CHARACTERIZATION OF ISOFORM 1 AND ISOFORM 2, INTERACTION WITH CRK AND GRB2, PHOSPHORYLATION AT TYR-1063; TYR-1068; TYR-1230; TYR-1231 AND TYR-1337, MUTAGENESIS OF TYR-1063; TYR-1068; TYR-1230 AND TYR-1231. |
| [21] | "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry." Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D. J. Proteome Res. 4:2070-2080(2005) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-527, MASS SPECTROMETRY. Tissue: Plasma. |
| [22] | "Vascular endothelial growth factor receptor-3 and focal adhesion kinase bind and suppress apoptosis in breast cancer cells." Garces C.A., Kurenova E.V., Golubovskaya V.M., Cance W.G. Cancer Res. 66:1446-1454(2006) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN PROMOTING CELL SURVIVAL, INTERACTION WITH PTK2/FAK1, SUBCELLULAR LOCATION. |
| [23] | "Cooperative and redundant roles of VEGFR-2 and VEGFR-3 signaling in adult lymphangiogenesis." Goldman J., Rutkowski J.M., Shields J.D., Pasquier M.C., Cui Y., Schmokel H.G., Willey S., Hicklin D.J., Pytowski B., Swartz M.A. FASEB J. 21:1003-1012(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN LYMPHANGIOGENESIS. |
| [24] | "Autocrine loop between vascular endothelial growth factor (VEGF)-C and VEGF receptor-3 positively regulates tumor-associated lymphangiogenesis in oral squamoid cancer cells." Matsuura M., Onimaru M., Yonemitsu Y., Suzuki H., Nakano T., Ishibashi H., Shirasuna K., Sueishi K. Am. J. Pathol. 175:1709-1721(2009) [PubMed] [Europe PMC] [Abstract] Cited for: ROLE IN CANCER, FUNCTION AS VEGFC RECEPTOR IN TUMOR LYMPHANGIOGENESIS; CELL PROLIFERATION; CELL SURVIVAL; IN ACTIVATION OF PIK3R1; AKT1 AND MAP KINASES AND IN UP-REGULATION OF VEGFA AND VEGFC EXPRESSION, ENZYME REGULATION, AUTOPHOSPHORYLATION. |
| [25] | "Small molecule chloropyramine hydrochloride (C4) targets the binding site of focal adhesion kinase and vascular endothelial growth factor receptor 3 and suppresses breast cancer growth in vivo." Kurenova E.V., Hunt D.L., He D., Magis A.T., Ostrov D.A., Cance W.G. J. Med. Chem. 52:4716-4724(2009) [PubMed] [Europe PMC] [Abstract] Cited for: ROLE IN CANCER, INTERACTION WITH PTK2/FAK1. |
| [26] | "Protein tyrosine phosphatase PTPN14 is a regulator of lymphatic function and choanal development in humans." Au A.C., Hernandez P.A., Lieber E., Nadroo A.M., Shen Y.M., Kelley K.A., Gelb B.D., Diaz G.A. Am. J. Hum. Genet. 87:436-444(2010) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH PTPN14. |
| [27] | "Endothelial cell adhesion to the extracellular matrix induces c-Src-dependent VEGFR-3 phosphorylation without the activation of the receptor intrinsic kinase activity." Galvagni F., Pennacchini S., Salameh A., Rocchigiani M., Neri F., Orlandini M., Petraglia F., Gotta S., Sardone G.L., Matteucci G., Terstappen G.C., Oliviero S. Circ. Res. 106:1839-1848(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT TYR-830; TYR-833; TYR-853; TYR-1063; TYR-1068; TYR-1333 AND TYR-1337, IDENTIFICATION IN A COMPLEX WITH SRC AND ITGB1, MUTAGENESIS OF TYR-1063; TYR-1068 AND TYR-1337, ENZYME REGULATION BY MAZ51, INTERACTION WITH ITGB1; CRK AND SHC1, FUNCTION IN ACTIVATION OF MAPK8 AND IN REGULATION OF ANGIOGENIC SPROUTING, MASS SPECTROMETRY. |
| [28] | "VEGF receptor 2/-3 heterodimers detected in situ by proximity ligation on angiogenic sprouts." Nilsson I., Bahram F., Li X., Gualandi L., Koch S., Jarvius M., Soderberg O., Anisimov A., Kholova I., Pytowski B., Baldwin M., Yla-Herttuala S., Alitalo K., Kreuger J., Claesson-Welsh L. EMBO J. 29:1377-1388(2010) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH KDR, FUNCTION IN MODULATING KDR SIGNALING AND IN ANGIOGENESIS, TISSUE SPECIFICITY. |
| [29] | "Ephrin-B2 controls VEGF-induced angiogenesis and lymphangiogenesis." Wang Y., Nakayama M., Pitulescu M.E., Schmidt T.S., Bochenek M.L., Sakakibara A., Adams S., Davy A., Deutsch U., Luthi U., Barberis A., Benjamin L.E., Makinen T., Nobes C.D., Adams R.H. Nature 465:483-486(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN ACTIVATION OF SIGNALING PATHWAYS, SUBCELLULAR LOCATION. |
| [30] | "Combined blockade of VEGFR-2 and VEGFR-3 inhibits inflammatory lymphangiogenesis in early and middle stages." Yuen D., Pytowski B., Chen L. Invest. Ophthalmol. Vis. Sci. 52:2593-2597(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN LYMPHANGIOGENESIS. |
| [31] | "VEGF receptor protein-tyrosine kinases: structure and regulation." Roskoski R. Jr. Biochem. Biophys. Res. Commun. 375:287-291(2008) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW ON STRUCTURE AND FUNCTION. |
| [32] | "VEGFs and receptors involved in angiogenesis versus lymphangiogenesis." Lohela M., Bry M., Tammela T., Alitalo K. Curr. Opin. Cell Biol. 21:154-165(2009) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW ON ROLE IN LYMPHANGIOGENESIS AND CANCER. |
| [33] | "Signal transduction by vascular endothelial growth factor receptors." Koch S., Tugues S., Li X., Gualandi L., Claesson-Welsh L. Biochem. J. 437:169-183(2011) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW ON LIGAND SPECIFICITY; FUNCTION; STRUCTURE; PHOSPHORYLATION AND SIGNALING. |
| [34] | "Lymphangiogenesis and cancer metastasis." Al-Rawi M.A., Jiang W.G. Front. Biosci. 16:723-739(2011) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW ON FUNCTION IN LYMPHANGIOGENESIS AND ROLE IN CANCER. |
| [35] | "Hereditary lymphedema: evidence for linkage and genetic heterogeneity." Ferrell R.E., Levinson K.L., Esman J.H., Kimak M.A., Lawrence E.C., Barmada M.M., Finegold D.N. Hum. Mol. Genet. 7:2073-2078(1998) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT LMPH1A LEU-1114. |
| [36] | "Congenital hereditary lymphedema caused by a mutation that inactivates VEGFR3 tyrosine kinase." Irrthum A., Karkkainen M.J., Devriendt K., Alitalo K., Vikkula M. Am. J. Hum. Genet. 67:295-301(2000) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN LMPH1A, CHARACTERIZATION OF VARIANT LMPH1A ARG-1035. |
| [37] | "Missense mutations interfere with VEGFR-3 signalling in primary lymphoedema." Karkkainen M.J., Ferrell R.E., Lawrence E.C., Kimak M.A., Levinson K.L., McTigue M.A., Alitalo K., Finegold D.N. Nat. Genet. 25:153-159(2000) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS LMPH1A ARG-857; PRO-1041; PRO-1044 AND LEU-1114, VARIANT SER-641, CHARACTERIZATION OF VARIANTS. |
| [38] | "Somatic mutation of vascular endothelial growth factor receptors in juvenile hemangioma." Walter J.W., North P.E., Waner M., Mizeracki A., Blei F., Walker J.W.T., Reinisch J.F., Marchuk D.A. Genes Chromosomes Cancer 33:295-303(2002) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS HCI SER-954 AND SER-1137, VARIANTS ALA-494; GLN-890 AND HIS-1146. |
| [39] | "Patterns of somatic mutation in human cancer genomes." Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. Stratton M.R.Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] ASP-149; CYS-378; ALA-494; SER-527; SER-641; TYR-868; ILE-1010; GLN-1031; ASN-1049; GLN-1075 AND HIS-1146. |
| + | Additional computationally mapped references. |
Web resources
| GeneReviews |
| Wikipedia FLT4 entry |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X69878 mRNA. Translation: CAA49505.1. U43143 mRNA. Translation: AAA85215.1. EU826564 mRNA. Translation: ACF47600.1. AY233382 mRNA. Translation: AAO89504.1. AY233383 mRNA. Translation: AAO89505.1. AK291679 mRNA. Translation: BAF84368.1. AC122714 Genomic DNA. No translation available. X68203 mRNA. Translation: CAA48290.1. Different initiation. S66407 mRNA. Translation: AAB28539.1. |
| IPI | IPI00293565. IPI00337568. |
| PIR | A48999. |
| RefSeq | NP_002011.2. NM_002020.4. NP_891555.2. NM_182925.4. |
| UniGene | Hs.646917. |
3D structure databases | |
| ProteinModelPortal | P35916. |
| SMR | P35916. Positions 28-462, 632-765, 822-1180. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-5739N. |
| IntAct | P35916. 4 interactions. |
| MINT | MINT-1182429. |
| STRING | 9606.ENSP00000261937. |
PTM databases | |
| PhosphoSite | P35916. |
Polymorphism databases | |
| DMDM | 1718189. |
Proteomic databases | |
| PaxDb | P35916. |
| PRIDE | P35916. |
Protocols and materials databases | |
| DNASU | 2324. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000261937; ENSP00000261937; ENSG00000037280. ENST00000393347; ENSP00000377016; ENSG00000037280. |
| GeneID | 2324. |
| KEGG | hsa:2324. |
| UCSC | uc003mlz.4. human. uc003mma.4. human. |
Organism-specific databases | |
| CTD | 2324. |
| GeneCards | GC05M180028. |
| HGNC | HGNC:3767. FLT4. |
| MIM | 136352. gene. 153100. phenotype. 602089. phenotype. |
| neXtProt | NX_P35916. |
| Orphanet | 79452. Milroy disease. |
| PharmGKB | PA28183. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0515. |
| HOGENOM | HOG000037949. |
| HOVERGEN | HBG053432. |
| KO | K05097. |
| OMA | QINEEFC. |
| OrthoDB | EOG49W2DJ. |
| PhylomeDB | P35916. |
Enzyme and pathway databases | |
| BRENDA | 2.7.10.1. 2681. |
| Pathway_Interaction_DB | vegfr1_2_pathway. Signaling events mediated by VEGFR1 and VEGFR2. lymphangiogenesis_pathway. VEGFR3 signaling in lymphatic endothelium. |
| Reactome | REACT_111102. Signal Transduction. |
Gene expression databases | |
| ArrayExpress | P35916. |
| Bgee | P35916. |
| CleanEx | HS_FLT4. |
| Genevestigator | P35916. |
| GermOnline | ENSG00000037280. Homo sapiens. |
Family and domain databases | |
| Gene3D | 2.60.40.10. 9 hits. |
| InterPro | IPR007110. Ig-like_dom. IPR013783. Ig-like_fold. IPR013098. Ig_I-set. IPR003599. Ig_sub. IPR003598. Ig_sub2. IPR011009. Kinase-like_dom. IPR000719. Prot_kinase_cat_dom. IPR017441. Protein_kinase_ATP_BS. IPR001245. Ser-Thr/Tyr_kinase_cat_dom. IPR008266. Tyr_kinase_AS. IPR020635. Tyr_kinase_cat_dom. IPR001824. Tyr_kinase_rcpt_3_CS. IPR009137. Tyr_kinase_VEGFR3_rcpt_N. IPR009134. Tyr_kinase_VEGFR_rcpt_N. [Graphical view] |
| Pfam | PF07679. I-set. 2 hits. PF07714. Pkinase_Tyr. 1 hit. [Graphical view] |
| PRINTS | PR01832. VEGFRECEPTOR. PR01835. VEGFRECEPTR3. |
| SMART | SM00409. IG. 4 hits. SM00408. IGc2. 2 hits. SM00219. TyrKc. 1 hit. [Graphical view] |
| SUPFAM | SSF56112. Kinase_like. 1 hit. |
| PROSITE | PS50835. IG_LIKE. 6 hits. PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00109. PROTEIN_KINASE_TYR. 1 hit. PS00240. RECEPTOR_TYR_KIN_III. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | P35916. |
| ChEMBL | CHEMBL1955. |
| ChiTaRS | FLT4. human. |
| DrugBank | DB00398. Sorafenib. DB01268. Sunitinib. |
| GenomeRNAi | 2324. |
| NextBio | 9433. |
| SOURCE | Search... |
Entry information
| Entry name | VGFR3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P35916 Secondary accession number(s): A8K6L4 Q86W08 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| Human chromosome 5 Human chromosome 5: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
