P35858 (ALS_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 126.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Insulin-like growth factor-binding protein complex acid labile subunit Short name=ALS | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 605 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Involved in protein-protein interactions that result in protein complexes, receptor-ligand binding or cell adhesion. |
| Subunit structure | Forms a ternary complex of about 140 to 150 kDa with IGF-I or IGF-II and IGFBP-3. |
| Subcellular location | |
| Tissue specificity | Plasma. |
| Sequence similarities | Contains 19 LRR (leucine-rich) repeats. Contains 1 LRRCT domain. Contains 1 LRRNT domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Cell adhesion |
| Cellular component | Secreted |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Leucine-rich repeat Repeat Signal |
| PTM | Glycoprotein |
| Technical term | Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cell adhesion Inferred from electronic annotation. Source: UniProtKB-KW signal transductionTraceable author statement PubMed 1384485. Source: ProtInc |
| Cellular_component | extracellular space Traceable author statement PubMed 1384485. Source: ProtInc nucleusInferred from direct assay. Source: HPA |
| Molecular_function | insulin-like growth factor binding Traceable author statement Ref.1. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P35858-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P35858-2) The sequence of this isoform differs from the canonical sequence as follows: 5-5: K → KAGDLEPQFTPERRFRLCWYQAHSGRALLGPPPQASPPA | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 27 | 27 | Ref.5 | ||||||
| Chain | 28 – 605 | 578 | Insulin-like growth factor-binding protein complex acid labile subunit | PRO_0000020695 | |||||
Regions | |||||||||
| Domain | 32 – 74 | 43 | LRRNT | ||||||
| Repeat | 75 – 96 | 22 | LRR 1 | ||||||
| Repeat | 99 – 120 | 22 | LRR 2 | ||||||
| Repeat | 123 – 144 | 22 | LRR 3 | ||||||
| Repeat | 147 – 168 | 22 | LRR 4 | ||||||
| Repeat | 171 – 192 | 22 | LRR 5 | ||||||
| Repeat | 195 – 216 | 22 | LRR 6 | ||||||
| Repeat | 219 – 240 | 22 | LRR 7 | ||||||
| Repeat | 243 – 264 | 22 | LRR 8 | ||||||
| Repeat | 267 – 288 | 22 | LRR 9 | ||||||
| Repeat | 291 – 312 | 22 | LRR 10 | ||||||
| Repeat | 315 – 336 | 22 | LRR 11 | ||||||
| Repeat | 339 – 360 | 22 | LRR 12 | ||||||
| Repeat | 363 – 384 | 22 | LRR 13 | ||||||
| Repeat | 387 – 408 | 22 | LRR 14 | ||||||
| Repeat | 411 – 432 | 22 | LRR 15 | ||||||
| Repeat | 435 – 456 | 22 | LRR 16 | ||||||
| Repeat | 459 – 480 | 22 | LRR 17 | ||||||
| Repeat | 483 – 504 | 22 | LRR 18 | ||||||
| Repeat | 507 – 528 | 22 | LRR 19 | ||||||
| Domain | 536 – 605 | 70 | LRRCT | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 64 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 85 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 96 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 368 | 1 | N-linked (GlcNAc...) Ref.6 Ref.7 | ||||||
| Glycosylation | 515 | 1 | N-linked (GlcNAc...) Ref.6 | ||||||
| Glycosylation | 580 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 5 | 1 | K → KAGDLEPQFTPERRFRLCWY QAHSGRALLGPPPQASPPA in isoform 2. | VSP_044605 | |||||
| Natural variant | 97 | 1 | L → F. Corresponds to variant rs35947557 [ dbSNP | Ensembl ]. | VAR_050658 | |||||
| Natural variant | 307 | 1 | P → L. Corresponds to variant rs34297640 [ dbSNP | Ensembl ]. | VAR_050659 | |||||
| Natural variant | 498 | 1 | P → S. Corresponds to variant rs9282730 [ dbSNP | Ensembl ]. | VAR_022034 | |||||
| Natural variant | 548 | 1 | R → W. Corresponds to variant rs9282731 [ dbSNP | Ensembl ]. | VAR_022035 | |||||
Experimental info | |||||||||
| Sequence conflict | 10 | 1 | L → P in BAG64250. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Structure and functional expression of the acid-labile subunit of the insulin-like growth factor-binding protein complex." Leong S.R., Baxter R.C., Camerato T., Dai J., Wood W.I. Mol. Endocrinol. 6:870-876(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PARTIAL PROTEIN SEQUENCE. Tissue: Liver. |
| [2] | "Conservation of a growth hormone-responsive promoter element in the human and mouse acid-labile subunit genes." Suwanichkul A., Boisclair Y.R., Olney R.C., Durham S.K., Powell D.R. Endocrinology 141:833-838(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Thymus. |
| [4] | "The sequence and analysis of duplication-rich human chromosome 16." Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J. Pennacchio L.A.Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "High molecular weight insulin-like growth factor binding protein complex. Purification and properties of the acid-labile subunit from human serum." Baxter R.C., Martin J.L., Beniac V.A. J. Biol. Chem. 264:11843-11848(1989) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 28-35. |
| [6] | "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry." Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D. J. Proteome Res. 4:2070-2080(2005) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-368 AND ASN-515, MASS SPECTROMETRY. Tissue: Plasma. |
| [7] | "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry." Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H. J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-368, MASS SPECTROMETRY. Tissue: Liver. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | M86826 mRNA. Translation: AAA36047.1. AF192554 Genomic DNA. Translation: AAF06774.1. AK303146 mRNA. Translation: BAG64250.1. AC012180 Genomic DNA. No translation available. AL031724 Genomic DNA. Translation: CAC36078.1. |
| IPI | IPI00020996. IPI00925635. |
| PIR | A41915. |
| RefSeq | NP_001139478.1. NM_001146006.1. NP_004961.1. NM_004970.2. |
| UniGene | Hs.839. |
3D structure databases | |
| ProteinModelPortal | P35858. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000215539. |
Polymorphism databases | |
| DMDM | 543800. |
Proteomic databases | |
| PaxDb | P35858. |
| PeptideAtlas | P35858. |
| PRIDE | P35858. |
Protocols and materials databases | |
| DNASU | 3483. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000215539; ENSP00000215539; ENSG00000099769. ENST00000415638; ENSP00000416683; ENSG00000099769. |
| GeneID | 3483. |
| KEGG | hsa:3483. |
| UCSC | uc002cmy.3. human. |
Organism-specific databases | |
| CTD | 3483. |
| GeneCards | GC16M001840. |
| HGNC | HGNC:5468. IGFALS. |
| HPA | HPA040692. HPA040948. |
| MIM | 601489. gene+phenotype. |
| neXtProt | NX_P35858. |
| Orphanet | 140941. Short stature due to primary acid-labile subunit deficiency. |
| PharmGKB | PA29702. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG4886. |
| HOGENOM | HOG000033909. |
| HOVERGEN | HBG000327. |
| InParanoid | P35858. |
| OMA | HLDRGCL. |
| OrthoDB | EOG4FFD1R. |
| PhylomeDB | P35858. |
Enzyme and pathway databases | |
| Reactome | REACT_116125. Disease. |
Gene expression databases | |
| ArrayExpress | P35858. |
| Bgee | P35858. |
| CleanEx | HS_IGFALS. |
| Genevestigator | P35858. |
| GermOnline | ENSG00000099769. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR000483. Cys-rich_flank_reg_C. IPR001611. Leu-rich_rpt. IPR003591. Leu-rich_rpt_typical-subtyp. IPR000372. LRR-contain_N. [Graphical view] |
| Pfam | PF00560. LRR_1. 1 hit. PF01462. LRRNT. 1 hit. [Graphical view] |
| SMART | SM00369. LRR_TYP. 11 hits. SM00082. LRRCT. 1 hit. SM00013. LRRNT. 1 hit. [Graphical view] |
| PROSITE | PS51450. LRR. 18 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 3483. |
| NextBio | 13696. |
| SOURCE | Search... |
Entry information
| Entry name | ALS_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P35858 Secondary accession number(s): B4DZY8, E9PGU3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 16 Human chromosome 16: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
