P35813 (PPM1A_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 137.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Protein phosphatase 1A EC=3.1.3.16 Alternative name(s): Protein phosphatase 2C isoform alpha Short name=PP2C-alpha Protein phosphatase IA | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 382 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Enzyme with a broad specificity. Negatively regulates TGF-beta signaling through dephosphorylating SMAD2 and SMAD3, resulting in their dissociation from SMAD4, nuclear export of the SMADs and termination of the TGF-beta-mediated signaling. Ref.8 |
| Catalytic activity | A phosphoprotein + H2O = a protein + phosphate. |
| Cofactor | Binds 2 magnesium or manganese ions per subunit. |
| Subunit structure | Monomer. Interacts with SMAD2; the interaction dephosphorylates SMAD2 in its C-terminal SXS motif resulting in disruption of the SMAD2/SMAD4 complex, SMAD2 nuclear export and termination of the TGF-beta-mediated signaling. Interacts with SMAD2; the interaction dephosphorylates SMAD2 in its C-terminal SXS motif resulting in disruption of the SMAD2/SMAD4 complex, SMAD2 nuclear export and termination of the TGF-beta-mediated signaling. Ref.8 |
| Subcellular location | |
| Sequence similarities | Belongs to the PP2C family. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| ARRB1 | P49407 | 4 | EBI-989143,EBI-743313 | |
| ARRB2 | P32121 | 3 | EBI-989143,EBI-714559 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform Alpha-1 (identifier: P35813-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Alpha-2 (identifier: P35813-2) The sequence of this isoform differs from the canonical sequence as follows: 318-324: EIIKKQG → GGSFNKK 325-382: Missing. | ||||||
| Isoform 3 (identifier: P35813-3) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MFCSGRKWVAEATICTKLMKREKRRMGKRRAKKAKREEKKKGGERRRNEKRGNQMKRMCERKKYETDLEDQDIM | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 382 | 382 | Protein phosphatase 1A | PRO_0000057741 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 60 | 1 | Manganese 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 60 | 1 | Manganese 2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 61 | 1 | Manganese 1; via carbonyl oxygen | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 239 | 1 | Manganese 2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 282 | 1 | Manganese 2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 375 | 1 | Phosphoserine Ref.9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 377 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Lipidation | 2 | 1 | N-myristoyl glycine Ref.10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MFCSGRKWVAEATICTKLMK REKRRMGKRRAKKAKREEKK KGGERRRNEKRGNQMKRMCE RKKYETDLEDQDIM in isoform 3. | VSP_045687 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 318 – 324 | 7 | EIIKKQG → GGSFNKK in isoform Alpha-2. | VSP_005085 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 325 – 382 | 58 | Missing in isoform Alpha-2. | VSP_005086 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 239 | 1 | D → N: No effect on binding SMAD2. Ref.8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 342 | 1 | I → T in AK097843. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Isoform 3: | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 54 | 1 | Q → R in AK097843. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 9 – 19 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 22 – 31 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 33 – 35 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 38 – 46 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 47 – 49 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 50 – 63 | 14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 66 – 80 | 15 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 83 – 86 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 88 – 91 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 94 – 118 | 25 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 129 – 134 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 136 – 146 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 148 – 153 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 156 – 160 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 169 – 177 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 188 – 190 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 200 – 202 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 210 – 212 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 213 – 216 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 220 – 225 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 228 – 230 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 231 – 237 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 239 – 242 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 247 – 258 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 264 – 277 | 14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 284 – 290 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 299 – 319 | 21 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 330 – 339 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 347 – 349 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 350 – 354 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 355 – 365 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Mammalian protein serine/threonine phosphatase 2C: cDNA cloning and comparative analysis of amino acid sequences." Mann D.J., Campbell D.G., McGowan C.H., Cohen P.T.W. Biochim. Biophys. Acta 1130:100-104(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA-1). |
| [2] | "Protein phosphatase 2Calpha inhibits the human stress-responsive p38 and JNK MAPK pathways." Takekawa M., Maeda T., Saito H. EMBO J. 17:4744-4752(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA-2). |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Testis. |
| [4] | "Human protein factory for converting the transcriptome into an in vitro-expressed proteome." Goshima N., Kawamura Y., Fukumoto A., Miura A., Honma R., Satoh R., Wakamatsu A., Yamamoto J., Kimura K., Nishikawa T., Andoh T., Iida Y., Ishikawa K., Ito E., Kagawa N., Kaminaga C., Kanehori K., Kawakami B. Nomura N.Nat. Methods 5:1011-1017(2008) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM ALPHA-1). |
| [5] | "The DNA sequence and analysis of human chromosome 14." Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H. Weissenbach J.Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM ALPHA-1). Tissue: Colon and Lung. |
| [8] | "PPM1A functions as a Smad phosphatase to terminate TGFbeta signaling." Lin X., Duan X., Liang Y.Y., Su Y., Wrighton K.H., Long J., Hu M., Davis C.M., Wang J., Brunicardi F.C., Shi Y., Chen Y.G., Meng A., Feng X.H. Cell 125:915-928(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SMAD2 AND SMAD3, FUNCTION, SUBCELLULAR LOCATION, MUTAGENESIS OF ASP-239. |
| [9] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-375, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [10] | "Strategy for comprehensive identification of human N-myristoylated proteins using an insect cell-free protein synthesis system." Suzuki T., Moriya K., Nagatoshi K., Ota Y., Ezure T., Ando E., Tsunasawa S., Utsumi T. Proteomics 10:1780-1793(2010) [PubMed] [Europe PMC] [Abstract] Cited for: MYRISTOYLATION AT GLY-2. |
| [11] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [12] | "Crystal structure of the protein serine/threonine phosphatase 2C at 2.0-A resolution." Das A.K., Helps N.R., Cohen P.T.W., Barford D. EMBO J. 15:6798-6809(1996) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.6 ANGSTROMS). |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | S87759 mRNA. Translation: AAB21784.1. AF070670 mRNA. Translation: AAC28354.1. AK097843 mRNA. No translation available. AB451247 mRNA. Translation: BAG70061.1. AL132778 Genomic DNA. No translation available. AL157756 Genomic DNA. No translation available. CH471061 Genomic DNA. Translation: EAW80774.1. BC026691 mRNA. Translation: AAH26691.1. BC063243 mRNA. Translation: AAH63243.1. | ||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00020950. IPI00216196. | ||||||||||||||||||||||||||||||||||||||||||
| PIR | S22423. | ||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_066283.1. NM_021003.4. NP_808820.1. NM_177951.2. NP_808821.2. NM_177952.2. | ||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.130036. | ||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | P35813. | ||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||
| IntAct | P35813. 9 interactions. | ||||||||||||||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000327255. | ||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | P35813. | ||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||
| DMDM | 548442. | ||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||
| PaxDb | P35813. | ||||||||||||||||||||||||||||||||||||||||||
| PeptideAtlas | P35813. | ||||||||||||||||||||||||||||||||||||||||||
| PRIDE | P35813. | ||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||
| DNASU | 5494. | ||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000325642; ENSP00000327255; ENSG00000100614. ENST00000325658; ENSP00000314850; ENSG00000100614. ENST00000395076; ENSP00000378514; ENSG00000100614. ENST00000529574; ENSP00000432966; ENSG00000100614. | ||||||||||||||||||||||||||||||||||||||||||
| GeneID | 5494. | ||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:5494. | ||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc001xew.4. human. uc001xex.4. human. | ||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||
| CTD | 5494. | ||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC14P060712. | ||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:9275. PPM1A. | ||||||||||||||||||||||||||||||||||||||||||
| HPA | HPA029209. | ||||||||||||||||||||||||||||||||||||||||||
| MIM | 606108. gene. | ||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_P35813. | ||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA33603. | ||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||
| eggNOG | COG0631. | ||||||||||||||||||||||||||||||||||||||||||
| HOGENOM | HOG000233895. | ||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG053647. | ||||||||||||||||||||||||||||||||||||||||||
| InParanoid | P35813. | ||||||||||||||||||||||||||||||||||||||||||
| KO | K04457. | ||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG4GMTX1. | ||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | bmppathway. BMP receptor signaling. smad2_3pathway. Regulation of cytoplasmic and nuclear SMAD2/3 signaling. | ||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_111102. Signal Transduction. REACT_71. Gene Expression. | ||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | P35813. | ||||||||||||||||||||||||||||||||||||||||||
| Bgee | P35813. | ||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_PPM1A. | ||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | P35813. | ||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000100614. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||
| Gene3D | 1.10.10.430. 1 hit. 3.60.40.10. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR001932. PP2C-like. IPR012911. PP2C_C. IPR000222. PP2C_Mn2_Asp60_BS. IPR015655. Protein_Pase_2C. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| PANTHER | PTHR13832. PTHR13832. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00481. PP2C. 1 hit. PF07830. PP2C_C. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00331. PP2C_SIG. 1 hit. SM00332. PP2Cc. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF81606. PP2C-related. 1 hit. SSF81601. PP2C_C. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS01032. PP2C. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||
| BindingDB | P35813. | ||||||||||||||||||||||||||||||||||||||||||
| ChEMBL | CHEMBL2437. | ||||||||||||||||||||||||||||||||||||||||||
| ChiTaRS | PPM1A. human. | ||||||||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | P35813. | ||||||||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 5494. | ||||||||||||||||||||||||||||||||||||||||||
| NextBio | 21242. | ||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | PPM1A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P35813 Secondary accession number(s): B5BU11, J3KNM0, O75551 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 14 Human chromosome 14: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
