Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Hepatocyte nuclear factor 1-beta

Gene

HNF1B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Transcription factor, probably binds to the inverted palindrome 5'-GTTAATNATTAAC-3'.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi231 – 311Homeobox; HNF1-typePROSITE-ProRule annotationAdd BLAST81

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Activator

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000108753-MONOMER.
ReactomeiR-HSA-210744. Regulation of gene expression in late stage (branching morphogenesis) pancreatic bud precursor cells.
R-HSA-210747. Regulation of gene expression in early pancreatic precursor cells.
SIGNORiP35680.

Names & Taxonomyi

Protein namesi
Recommended name:
Hepatocyte nuclear factor 1-beta
Short name:
HNF-1-beta
Short name:
HNF-1B
Alternative name(s):
Homeoprotein LFB3
Transcription factor 2
Short name:
TCF-2
Variant hepatic nuclear factor 1
Short name:
vHNF1
Gene namesi
Name:HNF1B
Synonyms:TCF2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:11630. HNF1B.

Subcellular locationi

GO - Cellular componenti

  • nucleoplasm Source: HPA
  • nucleus Source: UniProtKB
  • transcription factor complex Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Involvement in diseasei

Renal cysts and diabetes syndrome (RCAD)10 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal dominant disorder comprising non-diabetic renal disease resulting from abnormal renal development, and diabetes, which in some cases occurs earlier than age 25 years and is thus consistent with a diagnosis of maturity-onset diabetes of the young (MODY5). The renal disease is highly variable and includes renal cysts, glomerular tufts, aberrant nephrogenesis, primitive tubules, irregular collecting systems, oligomeganephronia, enlarged renal pelves, abnormal calyces, small kidney, single kidney, horseshoe kidney, and hyperuricemic nephropathy. Affected individuals may also have abnormalities of the genital tract.
See also OMIM:137920
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04601236S → F in RCAD; gain-of-function mutation. 1 PublicationCorresponds to variant rs544890850dbSNPEnsembl.1
Natural variantiVAR_04601361V → G in RCAD. 1 PublicationCorresponds to variant rs147816724dbSNPEnsembl.1
Natural variantiVAR_04601476G → C in RCAD. 1 PublicationCorresponds to variant rs144425830dbSNPEnsembl.1
Natural variantiVAR_046015110V → G in RCAD. 1 Publication1
Natural variantiVAR_046016112R → P in RCAD. 2 Publications1
Natural variantiVAR_046017136Q → E in RCAD. 2 Publications1
Natural variantiVAR_046018148S → L in RCAD. 1 Publication1
Natural variantiVAR_046019148S → W in RCAD. 1 PublicationCorresponds to variant rs121918674dbSNPEnsembl.1
Natural variantiVAR_046020151S → P in RCAD. 1 Publication1
Natural variantiVAR_046021153H → N in RCAD; has diminished transcriptional activity by loss of DNA binding activity. 1 Publication1
Natural variantiVAR_046022156K → E in RCAD. 1 Publication1
Natural variantiVAR_046023164K → Q in RCAD. 2 Publications1
Natural variantiVAR_046024165R → H in RCAD. 2 PublicationsCorresponds to variant rs121918675dbSNPEnsembl.1
Natural variantiVAR_046025235R → Q in RCAD. 1 Publication1
Natural variantiVAR_046026241A → T in RCAD. 1 PublicationCorresponds to variant rs761415487dbSNPEnsembl.1
Natural variantiVAR_046027260E → D in RCAD; insignificant differences in transactivation ability between wild-type and mutated HNF1B. 1 PublicationCorresponds to variant rs536638039dbSNPEnsembl.1
Natural variantiVAR_046028276R → G in RCAD. 1 Publication1
Natural variantiVAR_046029276R → Q in RCAD. 1 Publication1
Natural variantiVAR_046030285G → D in RCAD. 1 Publication1
Natural variantiVAR_046031295R → C in RCAD. 1 Publication1
Natural variantiVAR_046032295R → H in RCAD. 2 Publications1
Natural variantiVAR_046033295R → P in RCAD. 1 Publication1
Natural variantiVAR_046034370G → S in RCAD. 1 PublicationCorresponds to variant rs113042313dbSNPEnsembl.1
Diabetes mellitus, non-insulin-dependent (NIDDM)1 Publication
Disease susceptibility may be associated with variations affecting the gene represented in this entry.
Disease descriptionA multifactorial disorder of glucose homeostasis caused by a lack of sensitivity to the body's own insulin. Affected individuals usually have an obese body habitus and manifestations of a metabolic syndrome characterized by diabetes, insulin resistance, hypertension and hypertriglyceridemia. The disease results in long-term complications that affect the eyes, kidneys, nerves, and blood vessels.
See also OMIM:125853
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_017665465S → R in NIDDM; 22% reduction in activity. 1 PublicationCorresponds to variant rs121918673dbSNPEnsembl.1
Prostate cancer, hereditary, 11 (HPC11)1 Publication
Disease susceptibility is associated with variations affecting the gene represented in this entry.
Disease descriptionA condition associated with familial predisposition to cancer of the prostate. Most prostate cancers are adenocarcinomas that develop in the acini of the prostatic ducts. Other rare histopathologic types of prostate cancer that occur in approximately 5% of patients include small cell carcinoma, mucinous carcinoma, prostatic ductal carcinoma, transitional cell carcinoma, squamous cell carcinoma, basal cell carcinoma, adenoid cystic carcinoma (basaloid), signet-ring cell carcinoma and neuroendocrine carcinoma.
See also OMIM:611955

Keywords - Diseasei

Diabetes mellitus

Organism-specific databases

DisGeNETi6928.
MalaCardsiHNF1B.
MIMi125853. phenotype.
137920. phenotype.
611955. phenotype.
OpenTargetsiENSG00000275410.
ENSG00000276194.
Orphaneti261265. 17q12 microdeletion syndrome.
34528. Autosomal dominant primary hypomagnesemia with hypocalciuria.
97364. Bilateral multicystic dysplastic kidney.
247775. Classic Mayer-Rokitansky-Kuster-Hauser syndrome.
1331. Familial prostate cancer.
2578. MURCS association.
93111. Renal cysts and diabetes syndrome.
97363. Unilateral multicystic dysplastic kidney.
PharmGKBiPA162391083.

Polymorphism and mutation databases

BioMutaiHNF1B.
DMDMi547664.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000491211 – 557Hepatocyte nuclear factor 1-betaAdd BLAST557

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei49PhosphoserineBy similarity1
Modified residuei52PhosphoserineBy similarity1
Modified residuei75PhosphoserineBy similarity1
Modified residuei80PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiP35680.
PeptideAtlasiP35680.
PRIDEiP35680.

PTM databases

iPTMnetiP35680.
PhosphoSitePlusiP35680.

Expressioni

Gene expression databases

BgeeiENSG00000108753.
CleanExiHS_HNF1B.
ExpressionAtlasiP35680. baseline and differential.
GenevisibleiP35680. HS.

Organism-specific databases

HPAiCAB068192.
HPA002083.

Interactioni

Subunit structurei

Binds DNA as a dimer. Can form homodimer or heterodimer with HNF1-alpha.1 Publication

GO - Molecular functioni

  • protein homodimerization activity Source: UniProtKB

Protein-protein interaction databases

BioGridi112790. 5 interactors.
IntActiP35680. 6 interactors.
STRINGi9606.ENSP00000225893.

Structurei

Secondary structure

1557
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi91 – 98Combined sources8
Helixi101 – 113Combined sources13
Helixi118 – 132Combined sources15
Helixi136 – 143Combined sources8
Helixi147 – 154Combined sources8
Helixi162 – 181Combined sources20
Turni182 – 185Combined sources4
Helixi240 – 252Combined sources13
Helixi258 – 275Combined sources18
Helixi283 – 286Combined sources4
Helixi293 – 304Combined sources12
Beta strandi316 – 321Combined sources6

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2DA6NMR-A233-321[»]
2H8RX-ray3.20A/B91-310[»]
ProteinModelPortaliP35680.
SMRiP35680.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP35680.

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 31DimerizationBy similarityAdd BLAST31

Sequence similaritiesi

Belongs to the HNF1 homeobox family.Curated
Contains 1 homeobox DNA-binding domain.PROSITE-ProRule annotation

Keywords - Domaini

Homeobox

Phylogenomic databases

eggNOGiENOG410IFA0. Eukaryota.
ENOG410ZZZ0. LUCA.
GeneTreeiENSGT00860000133745.
HOGENOMiHOG000015305.
HOVERGENiHBG005980.
InParanoidiP35680.
KOiK08034.
OMAiTHKQEPP.
OrthoDBiEOG091G052F.
PhylomeDBiP35680.
TreeFamiTF320327.

Family and domain databases

Gene3Di1.10.10.60. 1 hit.
1.10.260.40. 1 hit.
InterProiIPR006899. HNF-1_N.
IPR023219. HNF1_dimer_dom.
IPR006897. HNF1b_C.
IPR001356. Homeobox_dom.
IPR009057. Homeodomain-like.
IPR010982. Lambda_DNA-bd_dom.
[Graphical view]
PfamiPF04814. HNF-1_N. 1 hit.
PF04812. HNF-1B_C. 1 hit.
PF00046. Homeobox. 1 hit.
[Graphical view]
SMARTiSM00389. HOX. 1 hit.
[Graphical view]
SUPFAMiSSF100957. SSF100957. 1 hit.
SSF46689. SSF46689. 1 hit.
SSF47413. SSF47413. 1 hit.
PROSITEiPS00027. HOMEOBOX_1. 1 hit.
PS50071. HOMEOBOX_2. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform A (identifier: P35680-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVSKLTSLQQ ELLSALLSSG VTKEVLVQAL EELLPSPNFG VKLETLPLSP
60 70 80 90 100
GSGAEPDTKP VFHTLTNGHA KGRLSGDEGS EDGDDYDTPP ILKELQALNT
110 120 130 140 150
EEAAEQRAEV DRMLSEDPWR AAKMIKGYMQ QHNIPQREVV DVTGLNQSHL
160 170 180 190 200
SQHLNKGTPM KTQKRAALYT WYVRKQREIL RQFNQTVQSS GNMTDKSSQD
210 220 230 240 250
QLLFLFPEFS QQSHGPGQSD DACSEPTNKK MRRNRFKWGP ASQQILYQAY
260 270 280 290 300
DRQKNPSKEE REALVEECNR AECLQRGVSP SKAHGLGSNL VTEVRVYNWF
310 320 330 340 350
ANRRKEEAFR QKLAMDAYSS NQTHSLNPLL SHGSPHHQPS SSPPNKLSGV
360 370 380 390 400
RYSQQGNNEI TSSSTISHHG NSAMVTSQSV LQQVSPASLD PGHNLLSPDG
410 420 430 440 450
KMISVSGGGL PPVSTLTNIH SLSHHNPQQS QNLIMTPLSG VMAIAQSLNT
460 470 480 490 500
SQAQSVPVIN SVAGSLAALQ PVQFSQQLHS PHQQPLMQQS PGSHMAQQPF
510 520 530 540 550
MAAVTQLQNS HMYAHKQEPP QYSHTSRFPS AMVVTDTSSI STLTNMSSSK

QCPLQAW
Length:557
Mass (Da):61,324
Last modified:June 1, 1994 - v1
Checksum:i9E1ECC7423B73980
GO
Isoform B (identifier: P35680-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     183-208: Missing.

Show »
Length:531
Mass (Da):58,379
Checksum:iCEC69B827DD176D3
GO
Isoform C (identifier: P35680-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     350-400: VRYSQQGNNE...PGHNLLSPDG → KQRLGLTASA...SHCQNILPWK
     401-557: Missing.

Show »
Length:399
Mass (Da):44,764
Checksum:iCA374B25AB5A2A48
GO
Isoform 4 (identifier: P35680-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     96-125: Missing.
     183-208: Missing.
     447-483: SLNTSQAQSVPVINSVAGSLAALQPVQFSQQLHSPHQ → MSSTSLVMPTHHLLRAQQQGPCFPHHHPLGSCHGKAQ
     484-557: Missing.

Show »
Length:427
Mass (Da):46,907
Checksum:iDE3646E9A2B068E7
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04601236S → F in RCAD; gain-of-function mutation. 1 PublicationCorresponds to variant rs544890850dbSNPEnsembl.1
Natural variantiVAR_04601361V → G in RCAD. 1 PublicationCorresponds to variant rs147816724dbSNPEnsembl.1
Natural variantiVAR_04601476G → C in RCAD. 1 PublicationCorresponds to variant rs144425830dbSNPEnsembl.1
Natural variantiVAR_046015110V → G in RCAD. 1 Publication1
Natural variantiVAR_046016112R → P in RCAD. 2 Publications1
Natural variantiVAR_046017136Q → E in RCAD. 2 Publications1
Natural variantiVAR_046018148S → L in RCAD. 1 Publication1
Natural variantiVAR_046019148S → W in RCAD. 1 PublicationCorresponds to variant rs121918674dbSNPEnsembl.1
Natural variantiVAR_046020151S → P in RCAD. 1 Publication1
Natural variantiVAR_046021153H → N in RCAD; has diminished transcriptional activity by loss of DNA binding activity. 1 Publication1
Natural variantiVAR_046022156K → E in RCAD. 1 Publication1
Natural variantiVAR_046023164K → Q in RCAD. 2 Publications1
Natural variantiVAR_046024165R → H in RCAD. 2 PublicationsCorresponds to variant rs121918675dbSNPEnsembl.1
Natural variantiVAR_046025235R → Q in RCAD. 1 Publication1
Natural variantiVAR_046026241A → T in RCAD. 1 PublicationCorresponds to variant rs761415487dbSNPEnsembl.1
Natural variantiVAR_046027260E → D in RCAD; insignificant differences in transactivation ability between wild-type and mutated HNF1B. 1 PublicationCorresponds to variant rs536638039dbSNPEnsembl.1
Natural variantiVAR_046028276R → G in RCAD. 1 Publication1
Natural variantiVAR_046029276R → Q in RCAD. 1 Publication1
Natural variantiVAR_046030285G → D in RCAD. 1 Publication1
Natural variantiVAR_046031295R → C in RCAD. 1 Publication1
Natural variantiVAR_046032295R → H in RCAD. 2 Publications1
Natural variantiVAR_046033295R → P in RCAD. 1 Publication1
Natural variantiVAR_046034370G → S in RCAD. 1 PublicationCorresponds to variant rs113042313dbSNPEnsembl.1
Natural variantiVAR_017665465S → R in NIDDM; 22% reduction in activity. 1 PublicationCorresponds to variant rs121918673dbSNPEnsembl.1
Natural variantiVAR_012058492G → S in diabetes; early onset association; unknown pathological significance. 1 PublicationCorresponds to variant rs1805035dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_05332796 – 125Missing in isoform 4. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_002254183 – 208Missing in isoform B and isoform 4. 3 PublicationsAdd BLAST26
Alternative sequenceiVSP_002255350 – 400VRYSQ…LSPDG → KQRLGLTASATQPSWFLPRI LSGLRVFRGANAFEMILGPL SHCQNILPWK in isoform C. 1 PublicationAdd BLAST51
Alternative sequenceiVSP_002256401 – 557Missing in isoform C. 1 PublicationAdd BLAST157
Alternative sequenceiVSP_053328447 – 483SLNTS…HSPHQ → MSSTSLVMPTHHLLRAQQQG PCFPHHHPLGSCHGKAQ in isoform 4. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_053329484 – 557Missing in isoform 4. 1 PublicationAdd BLAST74

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X58840 mRNA. Translation: CAA41652.1.
X71348 mRNA. Translation: CAB59223.1.
U90287
, U90279, U90280, U90281, U90282, U90283, U90284, U90285, U90286 Genomic DNA. Translation: AAC63388.1.
HM116556 mRNA. Translation: ADM43493.1.
AK296633 mRNA. Translation: BAG59235.1.
AC091199 Genomic DNA. No translation available.
AC113211 Genomic DNA. No translation available.
BC017714 mRNA. Translation: AAH17714.1.
CCDSiCCDS11324.1. [P35680-1]
CCDS58538.1. [P35680-2]
PIRiS34412.
RefSeqiNP_000449.1. NM_000458.3. [P35680-1]
NP_001159395.1. NM_001165923.3. [P35680-2]
NP_001291215.1. NM_001304286.1.
UniGeneiHs.191144.

Genome annotation databases

EnsembliENST00000610754; ENSP00000484591; ENSG00000276194. [P35680-1]
ENST00000617811; ENSP00000480291; ENSG00000275410. [P35680-1]
ENST00000621123; ENSP00000482711; ENSG00000275410. [P35680-2]
ENST00000633792; ENSP00000488080; ENSG00000276194. [P35680-2]
GeneIDi6928.
KEGGihsa:6928.
UCSCiuc010wdi.3. human. [P35680-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Wikipedia

Hepatocyte nuclear factors entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X58840 mRNA. Translation: CAA41652.1.
X71348 mRNA. Translation: CAB59223.1.
U90287
, U90279, U90280, U90281, U90282, U90283, U90284, U90285, U90286 Genomic DNA. Translation: AAC63388.1.
HM116556 mRNA. Translation: ADM43493.1.
AK296633 mRNA. Translation: BAG59235.1.
AC091199 Genomic DNA. No translation available.
AC113211 Genomic DNA. No translation available.
BC017714 mRNA. Translation: AAH17714.1.
CCDSiCCDS11324.1. [P35680-1]
CCDS58538.1. [P35680-2]
PIRiS34412.
RefSeqiNP_000449.1. NM_000458.3. [P35680-1]
NP_001159395.1. NM_001165923.3. [P35680-2]
NP_001291215.1. NM_001304286.1.
UniGeneiHs.191144.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2DA6NMR-A233-321[»]
2H8RX-ray3.20A/B91-310[»]
ProteinModelPortaliP35680.
SMRiP35680.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112790. 5 interactors.
IntActiP35680. 6 interactors.
STRINGi9606.ENSP00000225893.

PTM databases

iPTMnetiP35680.
PhosphoSitePlusiP35680.

Polymorphism and mutation databases

BioMutaiHNF1B.
DMDMi547664.

Proteomic databases

PaxDbiP35680.
PeptideAtlasiP35680.
PRIDEiP35680.

Protocols and materials databases

DNASUi6928.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000610754; ENSP00000484591; ENSG00000276194. [P35680-1]
ENST00000617811; ENSP00000480291; ENSG00000275410. [P35680-1]
ENST00000621123; ENSP00000482711; ENSG00000275410. [P35680-2]
ENST00000633792; ENSP00000488080; ENSG00000276194. [P35680-2]
GeneIDi6928.
KEGGihsa:6928.
UCSCiuc010wdi.3. human. [P35680-1]

Organism-specific databases

CTDi6928.
DisGeNETi6928.
GeneCardsiHNF1B.
HGNCiHGNC:11630. HNF1B.
HPAiCAB068192.
HPA002083.
MalaCardsiHNF1B.
MIMi125853. phenotype.
137920. phenotype.
189907. gene.
611955. phenotype.
neXtProtiNX_P35680.
OpenTargetsiENSG00000275410.
ENSG00000276194.
Orphaneti261265. 17q12 microdeletion syndrome.
34528. Autosomal dominant primary hypomagnesemia with hypocalciuria.
97364. Bilateral multicystic dysplastic kidney.
247775. Classic Mayer-Rokitansky-Kuster-Hauser syndrome.
1331. Familial prostate cancer.
2578. MURCS association.
93111. Renal cysts and diabetes syndrome.
97363. Unilateral multicystic dysplastic kidney.
PharmGKBiPA162391083.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IFA0. Eukaryota.
ENOG410ZZZ0. LUCA.
GeneTreeiENSGT00860000133745.
HOGENOMiHOG000015305.
HOVERGENiHBG005980.
InParanoidiP35680.
KOiK08034.
OMAiTHKQEPP.
OrthoDBiEOG091G052F.
PhylomeDBiP35680.
TreeFamiTF320327.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000108753-MONOMER.
ReactomeiR-HSA-210744. Regulation of gene expression in late stage (branching morphogenesis) pancreatic bud precursor cells.
R-HSA-210747. Regulation of gene expression in early pancreatic precursor cells.
SIGNORiP35680.

Miscellaneous databases

ChiTaRSiHNF1B. human.
EvolutionaryTraceiP35680.
GeneWikiiHNF1B.
GenomeRNAii6928.
PROiP35680.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000108753.
CleanExiHS_HNF1B.
ExpressionAtlasiP35680. baseline and differential.
GenevisibleiP35680. HS.

Family and domain databases

Gene3Di1.10.10.60. 1 hit.
1.10.260.40. 1 hit.
InterProiIPR006899. HNF-1_N.
IPR023219. HNF1_dimer_dom.
IPR006897. HNF1b_C.
IPR001356. Homeobox_dom.
IPR009057. Homeodomain-like.
IPR010982. Lambda_DNA-bd_dom.
[Graphical view]
PfamiPF04814. HNF-1_N. 1 hit.
PF04812. HNF-1B_C. 1 hit.
PF00046. Homeobox. 1 hit.
[Graphical view]
SMARTiSM00389. HOX. 1 hit.
[Graphical view]
SUPFAMiSSF100957. SSF100957. 1 hit.
SSF46689. SSF46689. 1 hit.
SSF47413. SSF47413. 1 hit.
PROSITEiPS00027. HOMEOBOX_1. 1 hit.
PS50071. HOMEOBOX_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiHNF1B_HUMAN
AccessioniPrimary (citable) accession number: P35680
Secondary accession number(s): B4DKM3, E0YMJ9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 1, 1994
Last sequence update: June 1, 1994
Last modified: November 30, 2016
This is version 187 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.