Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P35611

- ADDA_HUMAN

UniProt

P35611 - ADDA_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Alpha-adducin

Gene

ADD1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Membrane-cytoskeleton-associated protein that promotes the assembly of the spectrin-actin network. Binds to calmodulin.

GO - Molecular functioni

  1. actin binding Source: ProtInc
  2. actin filament binding Source: BHF-UCL
  3. poly(A) RNA binding Source: UniProtKB
  4. protein heterodimerization activity Source: BHF-UCL
  5. protein homodimerization activity Source: BHF-UCL
  6. spectrin binding Source: BHF-UCL
  7. structural molecule activity Source: Ensembl
  8. transcription factor binding Source: BHF-UCL

GO - Biological processi

  1. actin cytoskeleton organization Source: BHF-UCL
  2. actin filament bundle assembly Source: BHF-UCL
  3. activation of signaling protein activity involved in unfolded protein response Source: Reactome
  4. apoptotic process Source: Reactome
  5. barbed-end actin filament capping Source: BHF-UCL
  6. cell morphogenesis Source: Ensembl
  7. cellular component disassembly involved in execution phase of apoptosis Source: Reactome
  8. cellular protein metabolic process Source: Reactome
  9. cellular response to retinoic acid Source: Ensembl
  10. cell volume homeostasis Source: Ensembl
  11. endoplasmic reticulum unfolded protein response Source: Reactome
  12. erythrocyte differentiation Source: Ensembl
  13. hemoglobin metabolic process Source: Ensembl
  14. homeostasis of number of cells within a tissue Source: Ensembl
  15. in utero embryonic development Source: Ensembl
  16. multicellular organism growth Source: Ensembl
  17. positive regulation of angiogenesis Source: Ensembl
  18. positive regulation of endocytosis Source: Ensembl
  19. positive regulation of protein binding Source: BHF-UCL
Complete GO annotation...

Keywords - Ligandi

Actin-binding, Calmodulin-binding

Enzyme and pathway databases

ReactomeiREACT_13541. Caspase-mediated cleavage of cytoskeletal proteins.
REACT_18273. XBP1(S) activates chaperone genes.

Names & Taxonomyi

Protein namesi
Recommended name:
Alpha-adducin
Alternative name(s):
Erythrocyte adducin subunit alpha
Gene namesi
Name:ADD1
Synonyms:ADDA
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 4

Organism-specific databases

HGNCiHGNC:243. ADD1.

Subcellular locationi

GO - Cellular componenti

  1. cytosol Source: Reactome
  2. dendritic spine Source: Ensembl
  3. F-actin capping protein complex Source: BHF-UCL
  4. focal adhesion Source: UniProtKB
  5. intermediate filament cytoskeleton Source: HPA
  6. nucleus Source: BHF-UCL
  7. perinuclear region of cytoplasm Source: Ensembl
  8. plasma membrane Source: HPA
  9. postsynaptic density Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoskeleton, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi445 – 4451T → D: Abolishes phosphorylation by ROCK2; when associated with D-480. 1 Publication
Mutagenesisi480 – 4801T → D: Abolishes phosphorylation by ROCK2; when associated with D-445. 1 Publication

Organism-specific databases

PharmGKBiPA31.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 737737Alpha-adducinPRO_0000218530Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionine1 Publication
Modified residuei12 – 121Phosphoserine2 Publications
Modified residuei59 – 591Phosphoserine; by PKA1 Publication
Modified residuei331 – 3311Phosphothreonine1 Publication
Modified residuei334 – 3341Phosphoserine1 Publication
Modified residuei358 – 3581Phosphoserine3 Publications
Modified residuei408 – 4081Phosphoserine; by PKA1 Publication
Modified residuei431 – 4311Phosphoserine1 Publication
Modified residuei436 – 4361Phosphoserine; by PKA2 Publications
Modified residuei445 – 4451Phosphothreonine; by ROCK21 Publication
Modified residuei465 – 4651Phosphoserine4 Publications
Modified residuei480 – 4801Phosphothreonine; by ROCK21 Publication
Modified residuei481 – 4811Phosphoserine; by PKA1 Publication
Modified residuei586 – 5861Phosphoserine1 Publication
Modified residuei707 – 7071Phosphoserine2 Publications
Modified residuei710 – 7101Phosphoserine2 Publications
Modified residuei714 – 7141Phosphoserine1 Publication
Modified residuei716 – 7161Phosphoserine; by PKC1 Publication
Modified residuei726 – 7261Phosphoserine; by PKA and PKC1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiP35611.
PaxDbiP35611.
PRIDEiP35611.

PTM databases

PhosphoSiteiP35611.

Miscellaneous databases

PMAP-CutDBP35611.

Expressioni

Tissue specificityi

Expressed in all tissues. Found in much higher levels in reticulocytes than the beta subunit.

Gene expression databases

BgeeiP35611.
CleanExiHS_ADD1.
ExpressionAtlasiP35611. baseline and differential.
GenevestigatoriP35611.

Organism-specific databases

HPAiCAB009794.
HPA035873.
HPA035874.

Interactioni

Subunit structurei

Heterodimer of an alpha and a beta subunit or an alpha and a gamma subunit.

Protein-protein interaction databases

BioGridi106631. 25 interactions.
IntActiP35611. 11 interactions.
MINTiMINT-1499912.
STRINGi9606.ENSP00000264758.

Structurei

3D structure databases

DisProtiDP00240.
ProteinModelPortaliP35611.
SMRiP35611. Positions 161-396.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni717 – 73418Interaction with calmodulinSequence AnalysisAdd
BLAST

Domaini

Each subunit is comprised of three regions: a NH2-terminal protease-resistant globular head region, a short connecting subdomain, and a protease-sensitive tail region.

Sequence similaritiesi

Phylogenomic databases

eggNOGiCOG0235.
GeneTreeiENSGT00390000016462.
HOGENOMiHOG000116349.
HOVERGENiHBG004180.
InParanoidiP35611.
OMAiWTKEDGH.
PhylomeDBiP35611.
TreeFamiTF313003.

Family and domain databases

Gene3Di3.40.225.10. 1 hit.
InterProiIPR027766. ADD1.
IPR001303. Aldolase_II/adducin_N.
[Graphical view]
PANTHERiPTHR10672:SF4. PTHR10672:SF4. 1 hit.
PfamiPF00596. Aldolase_II. 1 hit.
[Graphical view]
SMARTiSM01007. Aldolase_II. 1 hit.
[Graphical view]
SUPFAMiSSF53639. SSF53639. 1 hit.

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. Align

Note: Additional isoforms seem to exist.

Isoform 1 (identifier: P35611-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNGDSRAAVV TSPPPTTAPH KERYFDRVDE NNPEYLRERN MAPDLRQDFN
60 70 80 90 100
MMEQKKRVSM ILQSPAFCEE LESMIQEQFK KGKNPTGLLA LQQIADFMTT
110 120 130 140 150
NVPNVYPAAP QGGMAALNMS LGMVTPVNDL RGSDSIAYDK GEKLLRCKLA
160 170 180 190 200
AFYRLADLFG WSQLIYNHIT TRVNSEQEHF LIVPFGLLYS EVTASSLVKI
210 220 230 240 250
NLQGDIVDRG STNLGVNQAG FTLHSAIYAA RPDVKCVVHI HTPAGAAVSA
260 270 280 290 300
MKCGLLPISP EALSLGEVAY HDYHGILVDE EEKVLIQKNL GPKSKVLILR
310 320 330 340 350
NHGLVSVGES VEEAFYYIHN LVVACEIQVR TLASAGGPDN LVLLNPEKYK
360 370 380 390 400
AKSRSPGSPV GEGTGSPPKW QIGEQEFEAL MRMLDNLGYR TGYPYRYPAL
410 420 430 440 450
REKSKKYSDV EVPASVTGYS FASDGDSGTC SPLRHSFQKQ QREKTRWLNS
460 470 480 490 500
GRGDEASEEG QNGSSPKSKT KWTKEDGHRT STSAVPNLFV PLNTNPKEVQ
510 520 530 540 550
EMRNKIREQN LQDIKTAGPQ SQVLCGVVMD RSLVQGELVT ASKAIIEKEY
560 570 580 590 600
QPHVIVSTTG PNPFTTLTDR ELEEYRREVE RKQKGSEENL DEAREQKEKS
610 620 630 640 650
PPDQPAVPHP PPSTPIKLEE DLVPEPTTGD DSDAATFKPT LPDLSPDEPS
660 670 680 690 700
EALGFPMLEK EEEAHRPPSP TEAPTEASPE PAPDPAPVAE EAAPSAVEEG
710 720 730
AAADPGSDGS PGKSPSKKKK KFRTPSFLKK SKKKSDS
Length:737
Mass (Da):80,955
Last modified:December 1, 2000 - v2
Checksum:iDF13AB30B12F20B6
GO
Isoform 2 (identifier: P35611-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     621-631: DLVPEPTTGDD → GDGCAREYLLP
     632-737: Missing.

Show »
Length:631
Mass (Da):69,985
Checksum:i350DDCF58AB61357
GO
Isoform 3 (identifier: P35611-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     471-471: K → KVWTNITHDHVKPLLQSLSSGVCVPSCITNCL

Show »
Length:768
Mass (Da):84,303
Checksum:iD97BFFA790F661CA
GO
Isoform 4 (identifier: P35611-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     535-535: Q → QDAPLSDCTETIEGLELTEQTFSPAKSLSFRK
     621-631: DLVPEPTTGDD → GDGCAREYLLP
     632-737: Missing.

Note: No experimental confirmation available.

Show »
Length:662
Mass (Da):73,382
Checksum:i28B30DE00E7C3624
GO
Isoform 5 (identifier: P35611-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     472-511: WTKEDGHRTS...MRNKIREQNL → VWTNITHDHV...LVCAYLTVHS
     512-737: Missing.

Note: No experimental confirmation available.

Show »
Length:511
Mass (Da):56,286
Checksum:i4CD8F88129465C07
GO
Isoform 6 (identifier: P35611-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     471-471: K → KVWTNITHDHVKPLLQSLSSGVCVPSCITNCL
     621-631: DLVPEPTTGDD → GDGCAREYLLP
     632-737: Missing.

Show »
Length:662
Mass (Da):73,333
Checksum:i2F406B91F481F774
GO

Sequence cautioni

The sequence CAA98970.1 differs from that shown. Reason: Erroneous gene model prediction. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti606 – 6061A → E in AAB05645. (PubMed:7774961)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti6 – 61R → C.
Corresponds to variant rs2295497 [ dbSNP | Ensembl ].
VAR_022108
Natural varianti270 – 2701Y → N.
Corresponds to variant rs4971 [ dbSNP | Ensembl ].
VAR_014863
Natural varianti376 – 3761E → D.
Corresponds to variant rs4972 [ dbSNP | Ensembl ].
VAR_014864
Natural varianti460 – 4601G → W.2 Publications
Corresponds to variant rs4961 [ dbSNP | Ensembl ].
VAR_014184
Natural varianti510 – 5101N → I.
Corresponds to variant rs4962 [ dbSNP | Ensembl ].
VAR_014865
Natural varianti586 – 5861S → C.2 Publications
Corresponds to variant rs4963 [ dbSNP | Ensembl ].
VAR_014185

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei471 – 4711K → KVWTNITHDHVKPLLQSLSS GVCVPSCITNCL in isoform 3 and isoform 6. 1 PublicationVSP_000174
Alternative sequencei472 – 51140WTKED…REQNL → VWTNITHDHVKPLLQSLSSG VCVPSCITNCLVCAYLTVHS in isoform 5. 1 PublicationVSP_055402Add
BLAST
Alternative sequencei512 – 737226Missing in isoform 5. 1 PublicationVSP_055403Add
BLAST
Alternative sequencei535 – 5351Q → QDAPLSDCTETIEGLELTEQ TFSPAKSLSFRK in isoform 4. 1 PublicationVSP_054420
Alternative sequencei621 – 63111DLVPEPTTGDD → GDGCAREYLLP in isoform 2, isoform 4 and isoform 6. 2 PublicationsVSP_000175Add
BLAST
Alternative sequencei632 – 737106Missing in isoform 2, isoform 4 and isoform 6. 2 PublicationsVSP_000176Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X58141 mRNA. Translation: CAA41149.1.
L07261 mRNA. No translation available.
L29296
, L29286, L29287, L29289, L29290, L29291, L29292, L29293, L29294, L29295, L29297, L29298 Genomic DNA. Translation: AAB05645.1.
AK295457 mRNA. Translation: BAG58391.1.
Z74617 Genomic DNA. Translation: CAA98970.1. Sequence problems.
Z68280 Genomic DNA. No translation available.
AL390065, AL121750, BX465861 Genomic DNA. Translation: CAM21299.1.
BX465861, AL121750, AL390065 Genomic DNA. Translation: CAM25274.1.
AL121750, AL390065, BX465861 Genomic DNA. Translation: CAM28230.1.
AL121750, AL390065, BX465861 Genomic DNA. Translation: CAM28231.1.
AL121750, AL390065, BX465861 Genomic DNA. Translation: CAM28232.1.
CH471131 Genomic DNA. Translation: EAW82498.1.
CH471131 Genomic DNA. Translation: EAW82499.1.
CH471131 Genomic DNA. Translation: EAW82501.1.
CH471131 Genomic DNA. Translation: EAW82502.1.
CH471131 Genomic DNA. Translation: EAW82503.1.
CH471131 Genomic DNA. Translation: EAW82504.1.
CH471131 Genomic DNA. Translation: EAW82505.1.
BC042998 mRNA. Translation: AAH42998.1.
AH004561 mRNA. Translation: AAB30914.2.
CCDSiCCDS3363.1. [P35611-3]
CCDS43205.1. [P35611-1]
CCDS75094.1. [P35611-4]
PIRiS18207.
RefSeqiNP_001110.2. NM_001119.4. [P35611-1]
NP_001273574.1. NM_001286645.1. [P35611-4]
NP_054908.2. NM_014189.3. [P35611-3]
NP_054909.2. NM_014190.3. [P35611-2]
NP_789771.1. NM_176801.2. [P35611-6]
XP_005247994.1. XM_005247937.1. [P35611-4]
UniGeneiHs.183706.

Genome annotation databases

EnsembliENST00000264758; ENSP00000264758; ENSG00000087274. [P35611-3]
ENST00000355842; ENSP00000348100; ENSG00000087274. [P35611-4]
ENST00000398123; ENSP00000381191; ENSG00000087274. [P35611-6]
ENST00000398125; ENSP00000381193; ENSG00000087274. [P35611-6]
ENST00000398129; ENSP00000381197; ENSG00000087274. [P35611-1]
GeneIDi118.
KEGGihsa:118.
UCSCiuc003gfp.3. human. [P35611-2]
uc003gfq.3. human. [P35611-3]
uc003gfr.3. human. [P35611-1]
uc003gfs.3. human.

Polymorphism databases

DMDMi12644231.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X58141 mRNA. Translation: CAA41149.1 .
L07261 mRNA. No translation available.
L29296
, L29286 , L29287 , L29289 , L29290 , L29291 , L29292 , L29293 , L29294 , L29295 , L29297 , L29298 Genomic DNA. Translation: AAB05645.1 .
AK295457 mRNA. Translation: BAG58391.1 .
Z74617 Genomic DNA. Translation: CAA98970.1 . Sequence problems.
Z68280 Genomic DNA. No translation available.
AL390065 , AL121750 , BX465861 Genomic DNA. Translation: CAM21299.1 .
BX465861 , AL121750 , AL390065 Genomic DNA. Translation: CAM25274.1 .
AL121750 , AL390065 , BX465861 Genomic DNA. Translation: CAM28230.1 .
AL121750 , AL390065 , BX465861 Genomic DNA. Translation: CAM28231.1 .
AL121750 , AL390065 , BX465861 Genomic DNA. Translation: CAM28232.1 .
CH471131 Genomic DNA. Translation: EAW82498.1 .
CH471131 Genomic DNA. Translation: EAW82499.1 .
CH471131 Genomic DNA. Translation: EAW82501.1 .
CH471131 Genomic DNA. Translation: EAW82502.1 .
CH471131 Genomic DNA. Translation: EAW82503.1 .
CH471131 Genomic DNA. Translation: EAW82504.1 .
CH471131 Genomic DNA. Translation: EAW82505.1 .
BC042998 mRNA. Translation: AAH42998.1 .
AH004561 mRNA. Translation: AAB30914.2 .
CCDSi CCDS3363.1. [P35611-3 ]
CCDS43205.1. [P35611-1 ]
CCDS75094.1. [P35611-4 ]
PIRi S18207.
RefSeqi NP_001110.2. NM_001119.4. [P35611-1 ]
NP_001273574.1. NM_001286645.1. [P35611-4 ]
NP_054908.2. NM_014189.3. [P35611-3 ]
NP_054909.2. NM_014190.3. [P35611-2 ]
NP_789771.1. NM_176801.2. [P35611-6 ]
XP_005247994.1. XM_005247937.1. [P35611-4 ]
UniGenei Hs.183706.

3D structure databases

DisProti DP00240.
ProteinModelPortali P35611.
SMRi P35611. Positions 161-396.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 106631. 25 interactions.
IntActi P35611. 11 interactions.
MINTi MINT-1499912.
STRINGi 9606.ENSP00000264758.

PTM databases

PhosphoSitei P35611.

Polymorphism databases

DMDMi 12644231.

Proteomic databases

MaxQBi P35611.
PaxDbi P35611.
PRIDEi P35611.

Protocols and materials databases

DNASUi 118.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000264758 ; ENSP00000264758 ; ENSG00000087274 . [P35611-3 ]
ENST00000355842 ; ENSP00000348100 ; ENSG00000087274 . [P35611-4 ]
ENST00000398123 ; ENSP00000381191 ; ENSG00000087274 . [P35611-6 ]
ENST00000398125 ; ENSP00000381193 ; ENSG00000087274 . [P35611-6 ]
ENST00000398129 ; ENSP00000381197 ; ENSG00000087274 . [P35611-1 ]
GeneIDi 118.
KEGGi hsa:118.
UCSCi uc003gfp.3. human. [P35611-2 ]
uc003gfq.3. human. [P35611-3 ]
uc003gfr.3. human. [P35611-1 ]
uc003gfs.3. human.

Organism-specific databases

CTDi 118.
GeneCardsi GC04P002849.
HGNCi HGNC:243. ADD1.
HPAi CAB009794.
HPA035873.
HPA035874.
MIMi 102680. gene.
neXtProti NX_P35611.
PharmGKBi PA31.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0235.
GeneTreei ENSGT00390000016462.
HOGENOMi HOG000116349.
HOVERGENi HBG004180.
InParanoidi P35611.
OMAi WTKEDGH.
PhylomeDBi P35611.
TreeFami TF313003.

Enzyme and pathway databases

Reactomei REACT_13541. Caspase-mediated cleavage of cytoskeletal proteins.
REACT_18273. XBP1(S) activates chaperone genes.

Miscellaneous databases

ChiTaRSi ADD1. human.
GeneWikii ADD1.
GenomeRNAii 118.
NextBioi 35472207.
PMAP-CutDB P35611.
PROi P35611.
SOURCEi Search...

Gene expression databases

Bgeei P35611.
CleanExi HS_ADD1.
ExpressionAtlasi P35611. baseline and differential.
Genevestigatori P35611.

Family and domain databases

Gene3Di 3.40.225.10. 1 hit.
InterProi IPR027766. ADD1.
IPR001303. Aldolase_II/adducin_N.
[Graphical view ]
PANTHERi PTHR10672:SF4. PTHR10672:SF4. 1 hit.
Pfami PF00596. Aldolase_II. 1 hit.
[Graphical view ]
SMARTi SM01007. Aldolase_II. 1 hit.
[Graphical view ]
SUPFAMi SSF53639. SSF53639. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Primary structure and domain organization of human alpha and beta adducin."
    Joshi R.L., Gilligan D.M., Otto E., McLaughlin T., Bennett V.D.
    J. Cell Biol. 115:665-675(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PROTEIN SEQUENCE OF 24-36; 41-47; 516-569 AND 722-729, VARIANT CYS-586.
    Tissue: Reticulocyte.
  2. "Cloning and mapping of the alpha-adducin gene close to D4S95 and assessment of its relationship to Huntington disease."
    Goldberg Y.P., Lin B.Y., Andrew S.E., Nasir J., Graham R., Glaves M.L., Hutchinson G., Theilmann J., Ginzinger D.G., Schappert K.
    Hum. Mol. Genet. 1:669-675(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 6).
  3. "Genomic organization of the human alpha-adducin gene and its alternately spliced isoforms."
    Lin B., Nasir J., McDonald H., Graham R., Rommens J.M., Goldberg Y.P., Hayden M.R.
    Genomics 25:93-99(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
    Tissue: Hippocampus.
  5. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Testis.
  8. "Cloning of the alpha-adducin gene from the Huntington's disease candidate region of chromosome 4 by exon amplification."
    Taylor S.A., Snell R.G., Buckler A., Ambrose C., Duyao M., Church D., Lin C.S., Altherr M., Bates G.P., Groot N.
    Nat. Genet. 2:223-227(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 531-737 (ISOFORMS 1/3).
  9. "Adducin regulation. Definition of the calmodulin-binding domain and sites of phosphorylation by protein kinases A and C."
    Matsuoka Y., Hughes C.A., Bennett V.
    J. Biol. Chem. 271:25157-25166(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION AT SER-59; SER-408; SER-436; SER-481; SER-716 AND SER-726, PARTIAL PROTEIN SEQUENCE.
  10. "Phosphorylation of adducin by Rho-kinase plays a crucial role in cell motility."
    Fukata Y., Oshiro N., Kinoshita N., Kawano Y., Matsuoka Y., Bennett V., Matsuura Y., Kaibuchi K.
    J. Cell Biol. 145:347-361(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION AT THR-445 AND THR-480, MUTAGENESIS OF THR-445 AND THR-480.
  11. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-707 AND SER-710, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  12. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-358, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Platelet.
  13. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-12; THR-331; SER-334; SER-358; SER-431; SER-436 AND SER-465, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  14. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  15. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-465, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  16. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-465, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  17. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  18. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-12; SER-358; SER-465; SER-586; SER-707; SER-710 AND SER-714, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  19. "Human alpha-adducin gene, blood pressure, and sodium metabolism."
    Kamitani A., Wong Z.Y., Fraser R., Davies D.L., Connor J.M., Foy C.J., Watt G.C., Harrap S.B.
    Hypertension 32:138-143(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT TRP-460.
  20. "Patterns of single-nucleotide polymorphisms in candidate genes for blood-pressure homeostasis."
    Halushka M.K., Fan J.-B., Bentley K., Hsie L., Shen N., Weder A., Cooper R., Lipshutz R., Chakravarti A.
    Nat. Genet. 22:239-247(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS TRP-460 AND CYS-586.

Entry informationi

Entry nameiADDA_HUMAN
AccessioniPrimary (citable) accession number: P35611
Secondary accession number(s): A2A3N8
, A2A3P0, B4DI79, D3DVR3, D3DVR4, D3DVR5, Q13734, Q14729, Q16156, Q86XM2, Q9UJB6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 1, 1994
Last sequence update: December 1, 2000
Last modified: November 26, 2014
This is version 148 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3