Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P35611

- ADDA_HUMAN

UniProt

P35611 - ADDA_HUMAN

Protein

Alpha-adducin

Gene

ADD1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 146 (01 Oct 2014)
      Sequence version 2 (01 Dec 2000)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Membrane-cytoskeleton-associated protein that promotes the assembly of the spectrin-actin network. Binds to calmodulin.

    GO - Molecular functioni

    1. actin binding Source: ProtInc
    2. actin filament binding Source: BHF-UCL
    3. poly(A) RNA binding Source: UniProtKB
    4. protein heterodimerization activity Source: BHF-UCL
    5. protein homodimerization activity Source: BHF-UCL
    6. spectrin binding Source: BHF-UCL
    7. structural molecule activity Source: Ensembl
    8. transcription factor binding Source: BHF-UCL

    GO - Biological processi

    1. actin cytoskeleton organization Source: BHF-UCL
    2. actin filament bundle assembly Source: BHF-UCL
    3. activation of signaling protein activity involved in unfolded protein response Source: Reactome
    4. apoptotic process Source: Reactome
    5. barbed-end actin filament capping Source: BHF-UCL
    6. cell morphogenesis Source: Ensembl
    7. cellular component disassembly involved in execution phase of apoptosis Source: Reactome
    8. cellular protein metabolic process Source: Reactome
    9. cellular response to retinoic acid Source: Ensembl
    10. cell volume homeostasis Source: Ensembl
    11. endoplasmic reticulum unfolded protein response Source: Reactome
    12. erythrocyte differentiation Source: Ensembl
    13. hemoglobin metabolic process Source: Ensembl
    14. homeostasis of number of cells within a tissue Source: Ensembl
    15. in utero embryonic development Source: Ensembl
    16. multicellular organism growth Source: Ensembl
    17. positive regulation of angiogenesis Source: Ensembl
    18. positive regulation of endocytosis Source: Ensembl
    19. positive regulation of protein binding Source: BHF-UCL

    Keywords - Ligandi

    Actin-binding, Calmodulin-binding

    Enzyme and pathway databases

    ReactomeiREACT_13541. Caspase-mediated cleavage of cytoskeletal proteins.
    REACT_18273. XBP1(S) activates chaperone genes.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Alpha-adducin
    Alternative name(s):
    Erythrocyte adducin subunit alpha
    Gene namesi
    Name:ADD1
    Synonyms:ADDA
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 4

    Organism-specific databases

    HGNCiHGNC:243. ADD1.

    Subcellular locationi

    GO - Cellular componenti

    1. cytoskeleton Source: InterPro
    2. cytosol Source: Reactome
    3. dendritic spine Source: Ensembl
    4. F-actin capping protein complex Source: BHF-UCL
    5. intermediate filament cytoskeleton Source: HPA
    6. nucleus Source: BHF-UCL
    7. perinuclear region of cytoplasm Source: Ensembl
    8. plasma membrane Source: HPA
    9. postsynaptic density Source: Ensembl

    Keywords - Cellular componenti

    Cell membrane, Cytoplasm, Cytoskeleton, Membrane

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi445 – 4451T → D: Abolishes phosphorylation by ROCK2; when associated with D-480. 1 Publication
    Mutagenesisi480 – 4801T → D: Abolishes phosphorylation by ROCK2; when associated with D-445. 1 Publication

    Organism-specific databases

    PharmGKBiPA31.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 737737Alpha-adducinPRO_0000218530Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei1 – 11N-acetylmethionine1 Publication
    Modified residuei12 – 121Phosphoserine2 Publications
    Modified residuei59 – 591Phosphoserine; by PKA1 Publication
    Modified residuei331 – 3311Phosphothreonine1 Publication
    Modified residuei334 – 3341Phosphoserine1 Publication
    Modified residuei358 – 3581Phosphoserine3 Publications
    Modified residuei408 – 4081Phosphoserine; by PKA1 Publication
    Modified residuei431 – 4311Phosphoserine1 Publication
    Modified residuei436 – 4361Phosphoserine; by PKA2 Publications
    Modified residuei445 – 4451Phosphothreonine; by ROCK21 Publication
    Modified residuei465 – 4651Phosphoserine4 Publications
    Modified residuei480 – 4801Phosphothreonine; by ROCK21 Publication
    Modified residuei481 – 4811Phosphoserine; by PKA1 Publication
    Modified residuei586 – 5861Phosphoserine1 Publication
    Modified residuei707 – 7071Phosphoserine2 Publications
    Modified residuei710 – 7101Phosphoserine2 Publications
    Modified residuei714 – 7141Phosphoserine1 Publication
    Modified residuei716 – 7161Phosphoserine; by PKC1 Publication
    Modified residuei726 – 7261Phosphoserine; by PKA and PKC1 Publication

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    MaxQBiP35611.
    PaxDbiP35611.
    PRIDEiP35611.

    PTM databases

    PhosphoSiteiP35611.

    Miscellaneous databases

    PMAP-CutDBP35611.

    Expressioni

    Tissue specificityi

    Expressed in all tissues. Found in much higher levels in reticulocytes than the beta subunit.

    Gene expression databases

    ArrayExpressiP35611.
    BgeeiP35611.
    CleanExiHS_ADD1.
    GenevestigatoriP35611.

    Organism-specific databases

    HPAiCAB009794.
    HPA035873.
    HPA035874.

    Interactioni

    Subunit structurei

    Heterodimer of an alpha and a beta subunit or an alpha and a gamma subunit.

    Protein-protein interaction databases

    BioGridi106631. 22 interactions.
    IntActiP35611. 11 interactions.
    MINTiMINT-1499912.
    STRINGi9606.ENSP00000264758.

    Structurei

    3D structure databases

    DisProtiDP00240.
    ProteinModelPortaliP35611.
    SMRiP35611. Positions 161-396.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni717 – 73418Interaction with calmodulinSequence AnalysisAdd
    BLAST

    Domaini

    Each subunit is comprised of three regions: a NH2-terminal protease-resistant globular head region, a short connecting subdomain, and a protease-sensitive tail region.

    Sequence similaritiesi

    Phylogenomic databases

    eggNOGiCOG0235.
    HOGENOMiHOG000116349.
    HOVERGENiHBG004180.
    OMAiWTKEDGH.
    PhylomeDBiP35611.
    TreeFamiTF313003.

    Family and domain databases

    Gene3Di3.40.225.10. 1 hit.
    InterProiIPR027766. ADD1.
    IPR001303. Aldolase_II/adducin_N.
    [Graphical view]
    PANTHERiPTHR10672:SF4. PTHR10672:SF4. 1 hit.
    PfamiPF00596. Aldolase_II. 1 hit.
    [Graphical view]
    SMARTiSM01007. Aldolase_II. 1 hit.
    [Graphical view]
    SUPFAMiSSF53639. SSF53639. 1 hit.

    Sequences (6)i

    Sequence statusi: Complete.

    This entry describes 6 isoformsi produced by alternative splicing. Align

    Note: Additional isoforms seem to exist.

    Isoform 1 (identifier: P35611-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MNGDSRAAVV TSPPPTTAPH KERYFDRVDE NNPEYLRERN MAPDLRQDFN    50
    MMEQKKRVSM ILQSPAFCEE LESMIQEQFK KGKNPTGLLA LQQIADFMTT 100
    NVPNVYPAAP QGGMAALNMS LGMVTPVNDL RGSDSIAYDK GEKLLRCKLA 150
    AFYRLADLFG WSQLIYNHIT TRVNSEQEHF LIVPFGLLYS EVTASSLVKI 200
    NLQGDIVDRG STNLGVNQAG FTLHSAIYAA RPDVKCVVHI HTPAGAAVSA 250
    MKCGLLPISP EALSLGEVAY HDYHGILVDE EEKVLIQKNL GPKSKVLILR 300
    NHGLVSVGES VEEAFYYIHN LVVACEIQVR TLASAGGPDN LVLLNPEKYK 350
    AKSRSPGSPV GEGTGSPPKW QIGEQEFEAL MRMLDNLGYR TGYPYRYPAL 400
    REKSKKYSDV EVPASVTGYS FASDGDSGTC SPLRHSFQKQ QREKTRWLNS 450
    GRGDEASEEG QNGSSPKSKT KWTKEDGHRT STSAVPNLFV PLNTNPKEVQ 500
    EMRNKIREQN LQDIKTAGPQ SQVLCGVVMD RSLVQGELVT ASKAIIEKEY 550
    QPHVIVSTTG PNPFTTLTDR ELEEYRREVE RKQKGSEENL DEAREQKEKS 600
    PPDQPAVPHP PPSTPIKLEE DLVPEPTTGD DSDAATFKPT LPDLSPDEPS 650
    EALGFPMLEK EEEAHRPPSP TEAPTEASPE PAPDPAPVAE EAAPSAVEEG 700
    AAADPGSDGS PGKSPSKKKK KFRTPSFLKK SKKKSDS 737
    Length:737
    Mass (Da):80,955
    Last modified:December 1, 2000 - v2
    Checksum:iDF13AB30B12F20B6
    GO
    Isoform 2 (identifier: P35611-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         621-631: DLVPEPTTGDD → GDGCAREYLLP
         632-737: Missing.

    Show »
    Length:631
    Mass (Da):69,985
    Checksum:i350DDCF58AB61357
    GO
    Isoform 3 (identifier: P35611-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         471-471: K → KVWTNITHDHVKPLLQSLSSGVCVPSCITNCL

    Show »
    Length:768
    Mass (Da):84,303
    Checksum:iD97BFFA790F661CA
    GO
    Isoform 4 (identifier: P35611-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         535-535: Q → QDAPLSDCTETIEGLELTEQTFSPAKSLSFRK
         621-631: DLVPEPTTGDD → GDGCAREYLLP
         632-737: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:662
    Mass (Da):73,382
    Checksum:i28B30DE00E7C3624
    GO
    Isoform 5 (identifier: P35611-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         472-511: WTKEDGHRTS...MRNKIREQNL → VWTNITHDHV...LVCAYLTVHS
         512-737: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:511
    Mass (Da):56,286
    Checksum:i4CD8F88129465C07
    GO
    Isoform 6 (identifier: P35611-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         471-471: K → KVWTNITHDHVKPLLQSLSSGVCVPSCITNCL
         621-631: DLVPEPTTGDD → GDGCAREYLLP
         632-737: Missing.

    Show »
    Length:662
    Mass (Da):73,333
    Checksum:i2F406B91F481F774
    GO

    Sequence cautioni

    The sequence CAA98970.1 differs from that shown. Reason: Erroneous gene model prediction.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti606 – 6061A → E in AAB05645. (PubMed:7774961)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti6 – 61R → C.
    Corresponds to variant rs2295497 [ dbSNP | Ensembl ].
    VAR_022108
    Natural varianti270 – 2701Y → N.
    Corresponds to variant rs4971 [ dbSNP | Ensembl ].
    VAR_014863
    Natural varianti376 – 3761E → D.
    Corresponds to variant rs4972 [ dbSNP | Ensembl ].
    VAR_014864
    Natural varianti460 – 4601G → W.2 Publications
    Corresponds to variant rs4961 [ dbSNP | Ensembl ].
    VAR_014184
    Natural varianti510 – 5101N → I.
    Corresponds to variant rs4962 [ dbSNP | Ensembl ].
    VAR_014865
    Natural varianti586 – 5861S → C.2 Publications
    Corresponds to variant rs4963 [ dbSNP | Ensembl ].
    VAR_014185

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei471 – 4711K → KVWTNITHDHVKPLLQSLSS GVCVPSCITNCL in isoform 3 and isoform 6. 1 PublicationVSP_000174
    Alternative sequencei472 – 51140WTKED…REQNL → VWTNITHDHVKPLLQSLSSG VCVPSCITNCLVCAYLTVHS in isoform 5. 1 PublicationVSP_055402Add
    BLAST
    Alternative sequencei512 – 737226Missing in isoform 5. 1 PublicationVSP_055403Add
    BLAST
    Alternative sequencei535 – 5351Q → QDAPLSDCTETIEGLELTEQ TFSPAKSLSFRK in isoform 4. 1 PublicationVSP_054420
    Alternative sequencei621 – 63111DLVPEPTTGDD → GDGCAREYLLP in isoform 2, isoform 4 and isoform 6. 2 PublicationsVSP_000175Add
    BLAST
    Alternative sequencei632 – 737106Missing in isoform 2, isoform 4 and isoform 6. 2 PublicationsVSP_000176Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X58141 mRNA. Translation: CAA41149.1.
    L07261 mRNA. No translation available.
    L29296
    , L29286, L29287, L29289, L29290, L29291, L29292, L29293, L29294, L29295, L29297, L29298 Genomic DNA. Translation: AAB05645.1.
    AK295457 mRNA. Translation: BAG58391.1.
    Z74617 Genomic DNA. Translation: CAA98970.1. Sequence problems.
    Z68280 Genomic DNA. No translation available.
    AL390065, AL121750, BX465861 Genomic DNA. Translation: CAM21299.1.
    BX465861, AL121750, AL390065 Genomic DNA. Translation: CAM25274.1.
    AL121750, AL390065, BX465861 Genomic DNA. Translation: CAM28230.1.
    AL121750, AL390065, BX465861 Genomic DNA. Translation: CAM28231.1.
    AL121750, AL390065, BX465861 Genomic DNA. Translation: CAM28232.1.
    CH471131 Genomic DNA. Translation: EAW82498.1.
    CH471131 Genomic DNA. Translation: EAW82499.1.
    CH471131 Genomic DNA. Translation: EAW82501.1.
    CH471131 Genomic DNA. Translation: EAW82502.1.
    CH471131 Genomic DNA. Translation: EAW82503.1.
    CH471131 Genomic DNA. Translation: EAW82504.1.
    CH471131 Genomic DNA. Translation: EAW82505.1.
    BC042998 mRNA. Translation: AAH42998.1.
    AH004561 mRNA. Translation: AAB30914.2.
    CCDSiCCDS3363.1. [P35611-3]
    CCDS43205.1. [P35611-1]
    PIRiS18207.
    RefSeqiNP_001110.2. NM_001119.4. [P35611-1]
    NP_001273574.1. NM_001286645.1. [P35611-4]
    NP_054908.2. NM_014189.3. [P35611-3]
    NP_054909.2. NM_014190.3. [P35611-2]
    NP_789771.1. NM_176801.2.
    XP_005247994.1. XM_005247937.1. [P35611-4]
    UniGeneiHs.183706.

    Genome annotation databases

    EnsembliENST00000264758; ENSP00000264758; ENSG00000087274. [P35611-3]
    ENST00000355842; ENSP00000348100; ENSG00000087274. [P35611-4]
    ENST00000398123; ENSP00000381191; ENSG00000087274.
    ENST00000398125; ENSP00000381193; ENSG00000087274.
    ENST00000398129; ENSP00000381197; ENSG00000087274. [P35611-1]
    ENST00000446856; ENSP00000399828; ENSG00000087274. [P35611-1]
    GeneIDi118.
    KEGGihsa:118.
    UCSCiuc003gfo.3. human.
    uc003gfp.3. human. [P35611-2]
    uc003gfq.3. human. [P35611-3]
    uc003gfr.3. human. [P35611-1]

    Polymorphism databases

    DMDMi12644231.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X58141 mRNA. Translation: CAA41149.1 .
    L07261 mRNA. No translation available.
    L29296
    , L29286 , L29287 , L29289 , L29290 , L29291 , L29292 , L29293 , L29294 , L29295 , L29297 , L29298 Genomic DNA. Translation: AAB05645.1 .
    AK295457 mRNA. Translation: BAG58391.1 .
    Z74617 Genomic DNA. Translation: CAA98970.1 . Sequence problems.
    Z68280 Genomic DNA. No translation available.
    AL390065 , AL121750 , BX465861 Genomic DNA. Translation: CAM21299.1 .
    BX465861 , AL121750 , AL390065 Genomic DNA. Translation: CAM25274.1 .
    AL121750 , AL390065 , BX465861 Genomic DNA. Translation: CAM28230.1 .
    AL121750 , AL390065 , BX465861 Genomic DNA. Translation: CAM28231.1 .
    AL121750 , AL390065 , BX465861 Genomic DNA. Translation: CAM28232.1 .
    CH471131 Genomic DNA. Translation: EAW82498.1 .
    CH471131 Genomic DNA. Translation: EAW82499.1 .
    CH471131 Genomic DNA. Translation: EAW82501.1 .
    CH471131 Genomic DNA. Translation: EAW82502.1 .
    CH471131 Genomic DNA. Translation: EAW82503.1 .
    CH471131 Genomic DNA. Translation: EAW82504.1 .
    CH471131 Genomic DNA. Translation: EAW82505.1 .
    BC042998 mRNA. Translation: AAH42998.1 .
    AH004561 mRNA. Translation: AAB30914.2 .
    CCDSi CCDS3363.1. [P35611-3 ]
    CCDS43205.1. [P35611-1 ]
    PIRi S18207.
    RefSeqi NP_001110.2. NM_001119.4. [P35611-1 ]
    NP_001273574.1. NM_001286645.1. [P35611-4 ]
    NP_054908.2. NM_014189.3. [P35611-3 ]
    NP_054909.2. NM_014190.3. [P35611-2 ]
    NP_789771.1. NM_176801.2.
    XP_005247994.1. XM_005247937.1. [P35611-4 ]
    UniGenei Hs.183706.

    3D structure databases

    DisProti DP00240.
    ProteinModelPortali P35611.
    SMRi P35611. Positions 161-396.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 106631. 22 interactions.
    IntActi P35611. 11 interactions.
    MINTi MINT-1499912.
    STRINGi 9606.ENSP00000264758.

    PTM databases

    PhosphoSitei P35611.

    Polymorphism databases

    DMDMi 12644231.

    Proteomic databases

    MaxQBi P35611.
    PaxDbi P35611.
    PRIDEi P35611.

    Protocols and materials databases

    DNASUi 118.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000264758 ; ENSP00000264758 ; ENSG00000087274 . [P35611-3 ]
    ENST00000355842 ; ENSP00000348100 ; ENSG00000087274 . [P35611-4 ]
    ENST00000398123 ; ENSP00000381191 ; ENSG00000087274 .
    ENST00000398125 ; ENSP00000381193 ; ENSG00000087274 .
    ENST00000398129 ; ENSP00000381197 ; ENSG00000087274 . [P35611-1 ]
    ENST00000446856 ; ENSP00000399828 ; ENSG00000087274 . [P35611-1 ]
    GeneIDi 118.
    KEGGi hsa:118.
    UCSCi uc003gfo.3. human.
    uc003gfp.3. human. [P35611-2 ]
    uc003gfq.3. human. [P35611-3 ]
    uc003gfr.3. human. [P35611-1 ]

    Organism-specific databases

    CTDi 118.
    GeneCardsi GC04P002849.
    HGNCi HGNC:243. ADD1.
    HPAi CAB009794.
    HPA035873.
    HPA035874.
    MIMi 102680. gene.
    neXtProti NX_P35611.
    PharmGKBi PA31.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0235.
    HOGENOMi HOG000116349.
    HOVERGENi HBG004180.
    OMAi WTKEDGH.
    PhylomeDBi P35611.
    TreeFami TF313003.

    Enzyme and pathway databases

    Reactomei REACT_13541. Caspase-mediated cleavage of cytoskeletal proteins.
    REACT_18273. XBP1(S) activates chaperone genes.

    Miscellaneous databases

    ChiTaRSi ADD1. human.
    GeneWikii ADD1.
    GenomeRNAii 118.
    NextBioi 459.
    PMAP-CutDB P35611.
    PROi P35611.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P35611.
    Bgeei P35611.
    CleanExi HS_ADD1.
    Genevestigatori P35611.

    Family and domain databases

    Gene3Di 3.40.225.10. 1 hit.
    InterProi IPR027766. ADD1.
    IPR001303. Aldolase_II/adducin_N.
    [Graphical view ]
    PANTHERi PTHR10672:SF4. PTHR10672:SF4. 1 hit.
    Pfami PF00596. Aldolase_II. 1 hit.
    [Graphical view ]
    SMARTi SM01007. Aldolase_II. 1 hit.
    [Graphical view ]
    SUPFAMi SSF53639. SSF53639. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Primary structure and domain organization of human alpha and beta adducin."
      Joshi R.L., Gilligan D.M., Otto E., McLaughlin T., Bennett V.D.
      J. Cell Biol. 115:665-675(1991) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PROTEIN SEQUENCE OF 24-36; 41-47; 516-569 AND 722-729, VARIANT CYS-586.
      Tissue: Reticulocyte.
    2. "Cloning and mapping of the alpha-adducin gene close to D4S95 and assessment of its relationship to Huntington disease."
      Goldberg Y.P., Lin B.Y., Andrew S.E., Nasir J., Graham R., Glaves M.L., Hutchinson G., Theilmann J., Ginzinger D.G., Schappert K.
      Hum. Mol. Genet. 1:669-675(1992) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 6).
    3. "Genomic organization of the human alpha-adducin gene and its alternately spliced isoforms."
      Lin B., Nasir J., McDonald H., Graham R., Rommens J.M., Goldberg Y.P., Hayden M.R.
      Genomics 25:93-99(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING.
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
      Tissue: Hippocampus.
    5. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
      Tissue: Testis.
    8. "Cloning of the alpha-adducin gene from the Huntington's disease candidate region of chromosome 4 by exon amplification."
      Taylor S.A., Snell R.G., Buckler A., Ambrose C., Duyao M., Church D., Lin C.S., Altherr M., Bates G.P., Groot N.
      Nat. Genet. 2:223-227(1992) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 531-737 (ISOFORMS 1/3).
    9. "Adducin regulation. Definition of the calmodulin-binding domain and sites of phosphorylation by protein kinases A and C."
      Matsuoka Y., Hughes C.A., Bennett V.
      J. Biol. Chem. 271:25157-25166(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION AT SER-59; SER-408; SER-436; SER-481; SER-716 AND SER-726, PARTIAL PROTEIN SEQUENCE.
    10. "Phosphorylation of adducin by Rho-kinase plays a crucial role in cell motility."
      Fukata Y., Oshiro N., Kinoshita N., Kawano Y., Matsuoka Y., Bennett V., Matsuura Y., Kaibuchi K.
      J. Cell Biol. 145:347-361(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION AT THR-445 AND THR-480, MUTAGENESIS OF THR-445 AND THR-480.
    11. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
      Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
      Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-707 AND SER-710, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    12. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-358, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Platelet.
    13. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-12; THR-331; SER-334; SER-358; SER-431; SER-436 AND SER-465, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    14. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
      Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
      Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    15. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-465, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    16. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-465, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    17. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    18. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-12; SER-358; SER-465; SER-586; SER-707; SER-710 AND SER-714, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    19. "Human alpha-adducin gene, blood pressure, and sodium metabolism."
      Kamitani A., Wong Z.Y., Fraser R., Davies D.L., Connor J.M., Foy C.J., Watt G.C., Harrap S.B.
      Hypertension 32:138-143(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANT TRP-460.
    20. "Patterns of single-nucleotide polymorphisms in candidate genes for blood-pressure homeostasis."
      Halushka M.K., Fan J.-B., Bentley K., Hsie L., Shen N., Weder A., Cooper R., Lipshutz R., Chakravarti A.
      Nat. Genet. 22:239-247(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANTS TRP-460 AND CYS-586.

    Entry informationi

    Entry nameiADDA_HUMAN
    AccessioniPrimary (citable) accession number: P35611
    Secondary accession number(s): A2A3N8
    , A2A3P0, B4DI79, D3DVR3, D3DVR4, D3DVR5, Q13734, Q14729, Q16156, Q86XM2, Q9UJB6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 1, 1994
    Last sequence update: December 1, 2000
    Last modified: October 1, 2014
    This is version 146 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human chromosome 4
      Human chromosome 4: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3