Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P35610

- SOAT1_HUMAN

UniProt

P35610 - SOAT1_HUMAN

Protein

Sterol O-acyltransferase 1

Gene

SOAT1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 140 (01 Oct 2014)
      Sequence version 3 (25 Jul 2003)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Catalyzes the formation of fatty acid-cholesterol esters. Plays a role in lipoprotein assembly and dietary cholesterol absorption. In addition to its acyltransferase activity, it may act as a ligase.

    Catalytic activityi

    Acyl-CoA + cholesterol = CoA + cholesterol ester.

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei460 – 46011 Publication

    GO - Molecular functioni

    1. cholesterol binding Source: BHF-UCL
    2. cholesterol O-acyltransferase activity Source: BHF-UCL
    3. fatty-acyl-CoA binding Source: BHF-UCL
    4. protein binding Source: IntAct
    5. sterol O-acyltransferase activity Source: BHF-UCL

    GO - Biological processi

    1. cholesterol efflux Source: BHF-UCL
    2. cholesterol esterification Source: BHF-UCL
    3. cholesterol homeostasis Source: BHF-UCL
    4. cholesterol metabolic process Source: BHF-UCL
    5. cholesterol storage Source: BHF-UCL
    6. macrophage derived foam cell differentiation Source: BHF-UCL
    7. positive regulation of amyloid precursor protein biosynthetic process Source: BHF-UCL
    8. very-low-density lipoprotein particle assembly Source: BHF-UCL

    Keywords - Molecular functioni

    Acyltransferase, Transferase

    Keywords - Biological processi

    Cholesterol metabolism, Lipid metabolism, Steroid metabolism, Sterol metabolism

    Enzyme and pathway databases

    BRENDAi2.3.1.26. 2681.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Sterol O-acyltransferase 1 (EC:2.3.1.26)
    Alternative name(s):
    Acyl-coenzyme A:cholesterol acyltransferase 1
    Short name:
    ACAT-1
    Cholesterol acyltransferase 1
    Gene namesi
    Name:SOAT1
    Synonyms:ACACT, ACACT1, ACAT, ACAT1, SOAT, STAT
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:11177. SOAT1.

    Subcellular locationi

    Endoplasmic reticulum membrane 1 Publication; Multi-pass membrane protein 1 Publication

    GO - Cellular componenti

    1. endoplasmic reticulum Source: BHF-UCL
    2. endoplasmic reticulum membrane Source: BHF-UCL
    3. integral component of membrane Source: UniProtKB-KW
    4. membrane Source: MGI

    Keywords - Cellular componenti

    Endoplasmic reticulum, Membrane

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi269 – 2691S → A or T: Nearly normal expression and enzyme activity. 1 Publication
    Mutagenesisi269 – 2691S → L: No expression nor activity. 1 Publication
    Mutagenesisi460 – 4601H → A, C or N: Loss of enzymatic activity. 1 Publication

    Organism-specific databases

    PharmGKBiPA36015.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 550550Sterol O-acyltransferase 1PRO_0000207640Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei1 – 11N-acetylmethionine1 Publication
    Disulfide bondi528 ↔ 5461 Publication

    Keywords - PTMi

    Acetylation, Disulfide bond

    Proteomic databases

    MaxQBiP35610.
    PaxDbiP35610.
    PRIDEiP35610.

    PTM databases

    PhosphoSiteiP35610.

    Expressioni

    Inductioni

    Highly activated by the presence of cholesterol.

    Gene expression databases

    ArrayExpressiP35610.
    BgeeiP35610.
    CleanExiHS_ACAT1.
    HS_SOAT1.
    GenevestigatoriP35610.

    Organism-specific databases

    HPAiCAB009533.
    HPA047171.

    Interactioni

    Subunit structurei

    May form homo- or heterodimers. Interacts with UBIAD1.1 Publication

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    UBIAD1Q9Y5Z93EBI-6621997,EBI-2819725

    Protein-protein interaction databases

    BioGridi112529. 4 interactions.
    IntActiP35610. 2 interactions.
    STRINGi9606.ENSP00000356591.

    Structurei

    3D structure databases

    ProteinModelPortaliP35610.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 140140CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini160 – 18122LumenalSequence AnalysisAdd
    BLAST
    Topological domaini201 – 22424CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini245 – 2451LumenalSequence Analysis
    Topological domaini265 – 32662CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini346 – 36419LumenalSequence AnalysisAdd
    BLAST
    Topological domaini388 – 44356CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini462 – 4621LumenalSequence Analysis
    Topological domaini485 – 50016CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini519 – 55032LumenalSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei141 – 15919HelicalSequence AnalysisAdd
    BLAST
    Transmembranei182 – 20019HelicalSequence AnalysisAdd
    BLAST
    Transmembranei225 – 24420HelicalSequence AnalysisAdd
    BLAST
    Transmembranei246 – 26419HelicalSequence AnalysisAdd
    BLAST
    Transmembranei327 – 34519HelicalSequence AnalysisAdd
    BLAST
    Transmembranei365 – 38723HelicalSequence AnalysisAdd
    BLAST
    Transmembranei444 – 46118HelicalSequence AnalysisAdd
    BLAST
    Transmembranei463 – 48422HelicalSequence AnalysisAdd
    BLAST
    Transmembranei501 – 51818HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG5056.
    HOGENOMiHOG000020782.
    HOVERGENiHBG058198.
    InParanoidiP35610.
    KOiK00637.
    OMAiFNFILHD.
    OrthoDBiEOG7ZPNJP.
    PhylomeDBiP35610.
    TreeFamiTF105767.

    Family and domain databases

    InterProiIPR004299. MBOAT_fam.
    IPR014371. Oat_ACAT_DAG_ARE.
    [Graphical view]
    PANTHERiPTHR10408. PTHR10408. 1 hit.
    PfamiPF03062. MBOAT. 1 hit.
    [Graphical view]
    PIRSFiPIRSF000439. Oat_ACAT_DAG_ARE. 1 hit.

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P35610-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MVGEEKMSLR NRLSKSRENP EEDEDQRNPA KESLETPSNG RIDIKQLIAK    50
    KIKLTAEAEE LKPFFMKEVG SHFDDFVTNL IEKSASLDNG GCALTTFSVL 100
    EGEKNNHRAK DLRAPPEQGK IFIARRSLLD ELLEVDHIRT IYHMFIALLI 150
    LFILSTLVVD YIDEGRLVLE FSLLSYAFGK FPTVVWTWWI MFLSTFSVPY 200
    FLFQHWATGY SKSSHPLIRS LFHGFLFMIF QIGVLGFGPT YVVLAYTLPP 250
    ASRFIIIFEQ IRFVMKAHSF VRENVPRVLN SAKEKSSTVP IPTVNQYLYF 300
    LFAPTLIYRD SYPRNPTVRW GYVAMKFAQV FGCFFYVYYI FERLCAPLFR 350
    NIKQEPFSAR VLVLCVFNSI LPGVLILFLT FFAFLHCWLN AFAEMLRFGD 400
    RMFYKDWWNS TSYSNYYRTW NVVVHDWLYY YAYKDFLWFF SKRFKSAAML 450
    AVFAVSAVVH EYALAVCLSF FYPVLFVLFM FFGMAFNFIV NDSRKKPIWN 500
    VLMWTSLFLG NGVLLCFYSQ EWYARQHCPL KNPTFLDYVR PRSWTCRYVF 550
    Length:550
    Mass (Da):64,735
    Last modified:July 25, 2003 - v3
    Checksum:i5F5ACD525D541DEE
    GO
    Isoform 2 (identifier: P35610-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-59: MVGEEKMSLRNRLSKSRENPEEDEDQRNPAKESLETPSNGRIDIKQLIAKKIKLTAEAE → M

    Show »
    Length:492
    Mass (Da):58,131
    Checksum:i285EF79CC80BF5E8
    GO
    Isoform 3 (identifier: P35610-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-65: Missing.

    Show »
    Length:485
    Mass (Da):57,238
    Checksum:i9C0D0F331D69376A
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti526 – 5261Q → R.1 Publication
    Corresponds to variant rs13306731 [ dbSNP | Ensembl ].
    VAR_052031

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 6565Missing in isoform 3. 1 PublicationVSP_045330Add
    BLAST
    Alternative sequencei1 – 5959MVGEE…TAEAE → M in isoform 2. 1 PublicationVSP_045331Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L21934 mRNA. Translation: AAC37532.2.
    AK290659 mRNA. Translation: BAF83348.1.
    AK300551 mRNA. Translation: BAG62257.1.
    AL451075, AL512326 Genomic DNA. Translation: CAI12676.1.
    AL512326, AL451075 Genomic DNA. Translation: CAI13574.1.
    CH471067 Genomic DNA. Translation: EAW91043.1.
    CH471067 Genomic DNA. Translation: EAW91044.1.
    BC028940 mRNA. Translation: AAH28940.1.
    CCDSiCCDS1330.1. [P35610-1]
    CCDS58047.1. [P35610-2]
    CCDS58048.1. [P35610-3]
    PIRiA59038. A48026.
    RefSeqiNP_001239440.1. NM_001252511.1. [P35610-2]
    NP_001239441.1. NM_001252512.1. [P35610-3]
    NP_003092.4. NM_003101.5. [P35610-1]
    UniGeneiHs.445588.

    Genome annotation databases

    EnsembliENST00000367619; ENSP00000356591; ENSG00000057252. [P35610-1]
    ENST00000539888; ENSP00000441356; ENSG00000057252. [P35610-3]
    ENST00000540564; ENSP00000445315; ENSG00000057252. [P35610-2]
    GeneIDi6646.
    KEGGihsa:6646.
    UCSCiuc001gml.3. human. [P35610-1]
    uc001gmm.3. human.

    Polymorphism databases

    DMDMi33302623.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L21934 mRNA. Translation: AAC37532.2 .
    AK290659 mRNA. Translation: BAF83348.1 .
    AK300551 mRNA. Translation: BAG62257.1 .
    AL451075 , AL512326 Genomic DNA. Translation: CAI12676.1 .
    AL512326 , AL451075 Genomic DNA. Translation: CAI13574.1 .
    CH471067 Genomic DNA. Translation: EAW91043.1 .
    CH471067 Genomic DNA. Translation: EAW91044.1 .
    BC028940 mRNA. Translation: AAH28940.1 .
    CCDSi CCDS1330.1. [P35610-1 ]
    CCDS58047.1. [P35610-2 ]
    CCDS58048.1. [P35610-3 ]
    PIRi A59038. A48026.
    RefSeqi NP_001239440.1. NM_001252511.1. [P35610-2 ]
    NP_001239441.1. NM_001252512.1. [P35610-3 ]
    NP_003092.4. NM_003101.5. [P35610-1 ]
    UniGenei Hs.445588.

    3D structure databases

    ProteinModelPortali P35610.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 112529. 4 interactions.
    IntActi P35610. 2 interactions.
    STRINGi 9606.ENSP00000356591.

    Chemistry

    BindingDBi P35610.
    ChEMBLi CHEMBL2782.
    DrugBanki DB00973. Ezetimibe.
    DB01094. Hesperetin.

    PTM databases

    PhosphoSitei P35610.

    Polymorphism databases

    DMDMi 33302623.

    Proteomic databases

    MaxQBi P35610.
    PaxDbi P35610.
    PRIDEi P35610.

    Protocols and materials databases

    DNASUi 6646.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000367619 ; ENSP00000356591 ; ENSG00000057252 . [P35610-1 ]
    ENST00000539888 ; ENSP00000441356 ; ENSG00000057252 . [P35610-3 ]
    ENST00000540564 ; ENSP00000445315 ; ENSG00000057252 . [P35610-2 ]
    GeneIDi 6646.
    KEGGi hsa:6646.
    UCSCi uc001gml.3. human. [P35610-1 ]
    uc001gmm.3. human.

    Organism-specific databases

    CTDi 6646.
    GeneCardsi GC01P179262.
    HGNCi HGNC:11177. SOAT1.
    HPAi CAB009533.
    HPA047171.
    MIMi 102642. gene.
    neXtProti NX_P35610.
    PharmGKBi PA36015.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5056.
    HOGENOMi HOG000020782.
    HOVERGENi HBG058198.
    InParanoidi P35610.
    KOi K00637.
    OMAi FNFILHD.
    OrthoDBi EOG7ZPNJP.
    PhylomeDBi P35610.
    TreeFami TF105767.

    Enzyme and pathway databases

    BRENDAi 2.3.1.26. 2681.

    Miscellaneous databases

    ChiTaRSi SOAT1. human.
    GeneWikii SOAT1.
    GenomeRNAii 6646.
    NextBioi 25899.
    PROi P35610.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P35610.
    Bgeei P35610.
    CleanExi HS_ACAT1.
    HS_SOAT1.
    Genevestigatori P35610.

    Family and domain databases

    InterProi IPR004299. MBOAT_fam.
    IPR014371. Oat_ACAT_DAG_ARE.
    [Graphical view ]
    PANTHERi PTHR10408. PTHR10408. 1 hit.
    Pfami PF03062. MBOAT. 1 hit.
    [Graphical view ]
    PIRSFi PIRSF000439. Oat_ACAT_DAG_ARE. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Molecular cloning and functional expression of human acyl-coenzyme A:cholesterol acyltransferase cDNA in mutant Chinese hamster ovary cells."
      Chang C.C.Y., Huh H.Y., Cadigan K.M., Chang T.-Y.
      J. Biol. Chem. 268:20747-20755(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ARG-526.
      Tissue: Macrophage.
    2. Chang C.C.Y., Chang T.-Y.
      Submitted (MAY-1999) to UniProtKB
      Cited for: SEQUENCE REVISION TO 207.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
    4. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Placenta.
    7. "Human acyl-CoA:cholesterol acyltransferase-1 in the endoplasmic reticulum contains seven transmembrane domains."
      Lin S., Cheng D., Liu M.S., Chen J., Chang T.-Y.
      J. Biol. Chem. 274:23276-23285(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: TOPOLOGY.
    8. "The active site His-460 of human acyl-coenzyme A:cholesterol acyltransferase 1 resides in a hitherto undisclosed transmembrane domain."
      Guo Z.Y., Lin S., Heinen J.A., Chang C.C., Chang T.Y.
      J. Biol. Chem. 280:37814-37826(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION, TOPOLOGY, ACTIVE SITE, DISULFIDE BOND, MUTAGENESIS OF SER-269 AND HIS-460.
    9. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    10. Cited for: INTERACTION WITH UBIAD1.

    Entry informationi

    Entry nameiSOAT1_HUMAN
    AccessioniPrimary (citable) accession number: P35610
    Secondary accession number(s): A6NC40
    , A8K3P4, A9Z1V7, B4DU95, Q5T0X4, Q8N1E4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 1, 1994
    Last sequence update: July 25, 2003
    Last modified: October 1, 2014
    This is version 140 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3