Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sterol O-acyltransferase 1

Gene

SOAT1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Catalyzes the formation of fatty acid-cholesterol esters, which are less soluble in membranes than cholesterol. Plays a role in lipoprotein assembly and dietary cholesterol absorption. In addition to its acyltransferase activity, it may act as a ligase.

Catalytic activityi

Acyl-CoA + cholesterol = CoA + cholesterol ester.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei4601 Publication1

GO - Molecular functioni

  • cholesterol binding Source: BHF-UCL
  • cholesterol O-acyltransferase activity Source: BHF-UCL
  • fatty-acyl-CoA binding Source: BHF-UCL
  • sterol O-acyltransferase activity Source: BHF-UCL

GO - Biological processi

  • cholesterol efflux Source: BHF-UCL
  • cholesterol esterification Source: BHF-UCL
  • cholesterol homeostasis Source: BHF-UCL
  • cholesterol metabolic process Source: BHF-UCL
  • cholesterol storage Source: BHF-UCL
  • macrophage derived foam cell differentiation Source: BHF-UCL
  • positive regulation of amyloid precursor protein biosynthetic process Source: BHF-UCL
  • very-low-density lipoprotein particle assembly Source: BHF-UCL
Complete GO annotation...

Keywords - Molecular functioni

Acyltransferase, Transferase

Keywords - Biological processi

Cholesterol metabolism, Lipid metabolism, Steroid metabolism, Sterol metabolism

Enzyme and pathway databases

BioCyciZFISH:HS00706-MONOMER.
BRENDAi2.3.1.26. 2681.
SIGNORiP35610.

Chemistry databases

SwissLipidsiSLP:000000702.

Names & Taxonomyi

Protein namesi
Recommended name:
Sterol O-acyltransferase 1 (EC:2.3.1.261 Publication)
Alternative name(s):
Acyl-coenzyme A:cholesterol acyltransferase 1
Short name:
ACAT-1
Cholesterol acyltransferase 1
Gene namesi
Name:SOAT1
Synonyms:ACACT, ACACT1, ACAT, ACAT1, SOAT, STAT
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:11177. SOAT1.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 140CytoplasmicSequence analysisAdd BLAST140
Transmembranei141 – 159HelicalSequence analysisAdd BLAST19
Topological domaini160 – 181LumenalSequence analysisAdd BLAST22
Transmembranei182 – 201HelicalSequence analysisAdd BLAST20
Topological domaini202 – 224CytoplasmicSequence analysisAdd BLAST23
Transmembranei225 – 243HelicalSequence analysisAdd BLAST19
Topological domaini244 – 246LumenalSequence analysis3
Transmembranei247 – 264HelicalSequence analysisAdd BLAST18
Topological domaini265 – 501CytoplasmicSequence analysisAdd BLAST237
Transmembranei502 – 517HelicalSequence analysisAdd BLAST16
Topological domaini518 – 550LumenalSequence analysisAdd BLAST33

GO - Cellular componenti

  • endoplasmic reticulum Source: BHF-UCL
  • endoplasmic reticulum membrane Source: BHF-UCL
  • integral component of membrane Source: UniProtKB-KW
  • membrane Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi269S → A or T: Nearly normal expression and enzyme activity. 1 Publication1
Mutagenesisi269S → L: No expression nor activity. 1 Publication1
Mutagenesisi400D → N: Low expression, loss of enzymatic activity. 1 Publication1
Mutagenesisi456S → A: Loss of enzymatic activity. 1 Publication1
Mutagenesisi460H → A, C or N: Loss of enzymatic activity. 1 Publication1
Mutagenesisi518Y → F: Loss of enzymatic activity. 1 Publication1

Organism-specific databases

DisGeNETi6646.
OpenTargetsiENSG00000057252.
PharmGKBiPA36015.

Chemistry databases

ChEMBLiCHEMBL2782.
DrugBankiDB00973. Ezetimibe.
DB01094. Hesperetin.

Polymorphism and mutation databases

BioMutaiSOAT1.
DMDMi33302623.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002076401 – 550Sterol O-acyltransferase 1Add BLAST550

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1
Modified residuei8PhosphoserineCombined sources1
Disulfide bondi528 ↔ 5461 Publication

Keywords - PTMi

Acetylation, Disulfide bond, Phosphoprotein

Proteomic databases

EPDiP35610.
MaxQBiP35610.
PaxDbiP35610.
PeptideAtlasiP35610.
PRIDEiP35610.

PTM databases

iPTMnetiP35610.
PhosphoSitePlusiP35610.
SwissPalmiP35610.

Expressioni

Inductioni

Highly activated by the presence of cholesterol.

Gene expression databases

BgeeiENSG00000057252.
CleanExiHS_ACAT1.
HS_SOAT1.
ExpressionAtlasiP35610. baseline and differential.
GenevisibleiP35610. HS.

Organism-specific databases

HPAiCAB009533.
HPA047171.

Interactioni

Subunit structurei

May form homo- or heterodimers. Interacts with UBIAD1.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
TERF1P542742EBI-6621955,EBI-710997
UBIAD1Q9Y5Z93EBI-6621997,EBI-2819725

Protein-protein interaction databases

BioGridi112529. 54 interactors.
IntActiP35610. 34 interactors.
STRINGi9606.ENSP00000356591.

Chemistry databases

BindingDBiP35610.

Structurei

3D structure databases

ProteinModelPortaliP35610.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0380. Eukaryota.
COG5056. LUCA.
GeneTreeiENSGT00530000063122.
HOGENOMiHOG000020782.
HOVERGENiHBG058198.
InParanoidiP35610.
KOiK00637.
OMAiWLNFTSE.
OrthoDBiEOG091G0991.
PhylomeDBiP35610.
TreeFamiTF105767.

Family and domain databases

InterProiIPR004299. MBOAT_fam.
IPR014371. Oat_ACAT_DAG_ARE.
IPR030687. Sterol_acyltranf_meta.
[Graphical view]
PANTHERiPTHR10408. PTHR10408. 1 hit.
PfamiPF03062. MBOAT. 1 hit.
[Graphical view]
PIRSFiPIRSF000439. Oat_ACAT_DAG_ARE. 1 hit.
PIRSF500230. Sterol_acyltranf_ACAT. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P35610-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVGEEKMSLR NRLSKSRENP EEDEDQRNPA KESLETPSNG RIDIKQLIAK
60 70 80 90 100
KIKLTAEAEE LKPFFMKEVG SHFDDFVTNL IEKSASLDNG GCALTTFSVL
110 120 130 140 150
EGEKNNHRAK DLRAPPEQGK IFIARRSLLD ELLEVDHIRT IYHMFIALLI
160 170 180 190 200
LFILSTLVVD YIDEGRLVLE FSLLSYAFGK FPTVVWTWWI MFLSTFSVPY
210 220 230 240 250
FLFQHWATGY SKSSHPLIRS LFHGFLFMIF QIGVLGFGPT YVVLAYTLPP
260 270 280 290 300
ASRFIIIFEQ IRFVMKAHSF VRENVPRVLN SAKEKSSTVP IPTVNQYLYF
310 320 330 340 350
LFAPTLIYRD SYPRNPTVRW GYVAMKFAQV FGCFFYVYYI FERLCAPLFR
360 370 380 390 400
NIKQEPFSAR VLVLCVFNSI LPGVLILFLT FFAFLHCWLN AFAEMLRFGD
410 420 430 440 450
RMFYKDWWNS TSYSNYYRTW NVVVHDWLYY YAYKDFLWFF SKRFKSAAML
460 470 480 490 500
AVFAVSAVVH EYALAVCLSF FYPVLFVLFM FFGMAFNFIV NDSRKKPIWN
510 520 530 540 550
VLMWTSLFLG NGVLLCFYSQ EWYARQHCPL KNPTFLDYVR PRSWTCRYVF
Length:550
Mass (Da):64,735
Last modified:July 25, 2003 - v3
Checksum:i5F5ACD525D541DEE
GO
Isoform 2 (identifier: P35610-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-59: MVGEEKMSLRNRLSKSRENPEEDEDQRNPAKESLETPSNGRIDIKQLIAKKIKLTAEAE → M

Show »
Length:492
Mass (Da):58,131
Checksum:i285EF79CC80BF5E8
GO
Isoform 3 (identifier: P35610-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-65: Missing.

Show »
Length:485
Mass (Da):57,238
Checksum:i9C0D0F331D69376A
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_052031526Q → R.1 PublicationCorresponds to variant rs13306731dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0453301 – 65Missing in isoform 3. 1 PublicationAdd BLAST65
Alternative sequenceiVSP_0453311 – 59MVGEE…TAEAE → M in isoform 2. 1 PublicationAdd BLAST59

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L21934 mRNA. Translation: AAC37532.2.
AK290659 mRNA. Translation: BAF83348.1.
AK300551 mRNA. Translation: BAG62257.1.
AL451075, AL512326 Genomic DNA. Translation: CAI12676.1.
AL512326, AL451075 Genomic DNA. Translation: CAI13574.1.
CH471067 Genomic DNA. Translation: EAW91043.1.
CH471067 Genomic DNA. Translation: EAW91044.1.
BC028940 mRNA. Translation: AAH28940.1.
CCDSiCCDS1330.1. [P35610-1]
CCDS58047.1. [P35610-2]
CCDS58048.1. [P35610-3]
PIRiA59038. A48026.
RefSeqiNP_001239440.1. NM_001252511.1. [P35610-2]
NP_001239441.1. NM_001252512.1. [P35610-3]
NP_003092.4. NM_003101.5. [P35610-1]
XP_011508213.1. XM_011509911.1. [P35610-1]
UniGeneiHs.445588.

Genome annotation databases

EnsembliENST00000367619; ENSP00000356591; ENSG00000057252. [P35610-1]
ENST00000539888; ENSP00000441356; ENSG00000057252. [P35610-3]
ENST00000540564; ENSP00000445315; ENSG00000057252. [P35610-2]
GeneIDi6646.
KEGGihsa:6646.
UCSCiuc001gml.4. human. [P35610-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L21934 mRNA. Translation: AAC37532.2.
AK290659 mRNA. Translation: BAF83348.1.
AK300551 mRNA. Translation: BAG62257.1.
AL451075, AL512326 Genomic DNA. Translation: CAI12676.1.
AL512326, AL451075 Genomic DNA. Translation: CAI13574.1.
CH471067 Genomic DNA. Translation: EAW91043.1.
CH471067 Genomic DNA. Translation: EAW91044.1.
BC028940 mRNA. Translation: AAH28940.1.
CCDSiCCDS1330.1. [P35610-1]
CCDS58047.1. [P35610-2]
CCDS58048.1. [P35610-3]
PIRiA59038. A48026.
RefSeqiNP_001239440.1. NM_001252511.1. [P35610-2]
NP_001239441.1. NM_001252512.1. [P35610-3]
NP_003092.4. NM_003101.5. [P35610-1]
XP_011508213.1. XM_011509911.1. [P35610-1]
UniGeneiHs.445588.

3D structure databases

ProteinModelPortaliP35610.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112529. 54 interactors.
IntActiP35610. 34 interactors.
STRINGi9606.ENSP00000356591.

Chemistry databases

BindingDBiP35610.
ChEMBLiCHEMBL2782.
DrugBankiDB00973. Ezetimibe.
DB01094. Hesperetin.
SwissLipidsiSLP:000000702.

PTM databases

iPTMnetiP35610.
PhosphoSitePlusiP35610.
SwissPalmiP35610.

Polymorphism and mutation databases

BioMutaiSOAT1.
DMDMi33302623.

Proteomic databases

EPDiP35610.
MaxQBiP35610.
PaxDbiP35610.
PeptideAtlasiP35610.
PRIDEiP35610.

Protocols and materials databases

DNASUi6646.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000367619; ENSP00000356591; ENSG00000057252. [P35610-1]
ENST00000539888; ENSP00000441356; ENSG00000057252. [P35610-3]
ENST00000540564; ENSP00000445315; ENSG00000057252. [P35610-2]
GeneIDi6646.
KEGGihsa:6646.
UCSCiuc001gml.4. human. [P35610-1]

Organism-specific databases

CTDi6646.
DisGeNETi6646.
GeneCardsiSOAT1.
HGNCiHGNC:11177. SOAT1.
HPAiCAB009533.
HPA047171.
MIMi102642. gene.
neXtProtiNX_P35610.
OpenTargetsiENSG00000057252.
PharmGKBiPA36015.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0380. Eukaryota.
COG5056. LUCA.
GeneTreeiENSGT00530000063122.
HOGENOMiHOG000020782.
HOVERGENiHBG058198.
InParanoidiP35610.
KOiK00637.
OMAiWLNFTSE.
OrthoDBiEOG091G0991.
PhylomeDBiP35610.
TreeFamiTF105767.

Enzyme and pathway databases

BioCyciZFISH:HS00706-MONOMER.
BRENDAi2.3.1.26. 2681.
SIGNORiP35610.

Miscellaneous databases

ChiTaRSiSOAT1. human.
GeneWikiiSOAT1.
GenomeRNAii6646.
PROiP35610.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000057252.
CleanExiHS_ACAT1.
HS_SOAT1.
ExpressionAtlasiP35610. baseline and differential.
GenevisibleiP35610. HS.

Family and domain databases

InterProiIPR004299. MBOAT_fam.
IPR014371. Oat_ACAT_DAG_ARE.
IPR030687. Sterol_acyltranf_meta.
[Graphical view]
PANTHERiPTHR10408. PTHR10408. 1 hit.
PfamiPF03062. MBOAT. 1 hit.
[Graphical view]
PIRSFiPIRSF000439. Oat_ACAT_DAG_ARE. 1 hit.
PIRSF500230. Sterol_acyltranf_ACAT. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiSOAT1_HUMAN
AccessioniPrimary (citable) accession number: P35610
Secondary accession number(s): A6NC40
, A8K3P4, A9Z1V7, B4DU95, Q5T0X4, Q8N1E4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 1, 1994
Last sequence update: July 25, 2003
Last modified: November 30, 2016
This is version 160 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.