P35610 (SOAT1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 126.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Sterol O-acyltransferase 1 EC=2.3.1.26 Alternative name(s): Acyl-coenzyme A:cholesterol acyltransferase 1 Short name=ACAT-1 Cholesterol acyltransferase 1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 550 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Catalyzes the formation of fatty acid-cholesterol esters. Plays a role in lipoprotein assembly and dietary cholesterol absorption. In addition to its acyltransferase activity, it may act as a ligase. |
| Catalytic activity | Acyl-CoA + cholesterol = CoA + cholesterol ester. |
| Subunit structure | May form homo- or heterodimers. |
| Subcellular location | Endoplasmic reticulum membrane; Multi-pass membrane protein. |
| Induction | Highly activated by the presence of cholesterol. |
| Sequence similarities | Belongs to the membrane-bound acyltransferase family. Sterol o-acyltransferase subfamily. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P35610-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P35610-2) The sequence of this isoform differs from the canonical sequence as follows: 1-59: MVGEEKMSLRNRLSKSRENPEEDEDQRNPAKESLETPSNGRIDIKQLIAKKIKLTAEAE → M | ||||||
| Isoform 3 (identifier: P35610-3) The sequence of this isoform differs from the canonical sequence as follows: 1-65: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 550 | 550 | Sterol O-acyltransferase 1 | PRO_0000207640 | |||||
Regions | |||||||||
| Transmembrane | 141 – 159 | 19 | Helical; Potential | ||||||
| Transmembrane | 320 – 341 | 22 | Helical; Potential | ||||||
| Transmembrane | 361 – 382 | 22 | Helical; Potential | ||||||
| Transmembrane | 470 – 490 | 21 | Helical; Potential | ||||||
| Transmembrane | 498 – 518 | 21 | Helical; Potential | ||||||
Sites | |||||||||
| Active site | 460 | 1 | Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 65 | 65 | Missing in isoform 3. | VSP_045330 | |||||
| Alternative sequence | 1 – 59 | 59 | MVGEE…TAEAE → M in isoform 2. | VSP_045331 | |||||
| Natural variant | 526 | 1 | Q → R. Ref.1 Corresponds to variant rs13306731 [ dbSNP | Ensembl ]. | VAR_052031 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning and functional expression of human acyl-coenzyme A:cholesterol acyltransferase cDNA in mutant Chinese hamster ovary cells." Chang C.C.Y., Huh H.Y., Cadigan K.M., Chang T.-Y. J. Biol. Chem. 268:20747-20755(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ARG-526. Tissue: Macrophage. |
| [2] | Chang C.C.Y., Chang T.-Y. Submitted (MAY-1999) to UniProtKB Cited for: SEQUENCE REVISION TO 207. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3). |
| [4] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Placenta. |
| [7] | "Human acyl-CoA:cholesterol acyltransferase-1 in the endoplasmic reticulum contains seven transmembrane domains." Lin S., Cheng D., Liu M.S., Chen J., Chang T.-Y. J. Biol. Chem. 274:23276-23285(1999) [PubMed] [Europe PMC] [Abstract] Cited for: TOPOLOGY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | L21934 mRNA. Translation: AAC37532.2. AK290659 mRNA. Translation: BAF83348.1. AK300551 mRNA. Translation: BAG62257.1. AL451075, AL512326 Genomic DNA. Translation: CAI12676.1. AL512326, AL451075 Genomic DNA. Translation: CAI13574.1. CH471067 Genomic DNA. Translation: EAW91043.1. CH471067 Genomic DNA. Translation: EAW91044.1. BC028940 mRNA. Translation: AAH28940.1. |
| IPI | IPI00745125. |
| PIR | A48026. A59038. |
| RefSeq | NP_001239440.1. NM_001252511.1. NP_001239441.1. NM_001252512.1. NP_003092.4. NM_003101.5. |
| UniGene | Hs.445588. |
3D structure databases | |
| ProteinModelPortal | P35610. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000356591. |
PTM databases | |
| PhosphoSite | P35610. |
Polymorphism databases | |
| DMDM | 33302623. |
Proteomic databases | |
| PaxDb | P35610. |
| PRIDE | P35610. |
Protocols and materials databases | |
| DNASU | 6646. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000367619; ENSP00000356591; ENSG00000057252. ENST00000539888; ENSP00000441356; ENSG00000057252. ENST00000540564; ENSP00000445315; ENSG00000057252. |
| GeneID | 6646. |
| KEGG | hsa:6646. |
| UCSC | uc001gml.3. human. |
Organism-specific databases | |
| CTD | 6646. |
| GeneCards | GC01P179262. |
| HGNC | HGNC:11177. SOAT1. |
| HPA | CAB009533. |
| MIM | 102642. gene. |
| neXtProt | NX_P35610. |
| PharmGKB | PA36015. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG5056. |
| HOGENOM | HOG000020782. |
| HOVERGEN | HBG058198. |
| InParanoid | P35610. |
| KO | K00637. |
| OMA | FNFILHD. |
| OrthoDB | EOG4M65H6. |
| PhylomeDB | P35610. |
Enzyme and pathway databases | |
| BRENDA | 2.3.1.26. 2681. |
Gene expression databases | |
| ArrayExpress | P35610. |
| Bgee | P35610. |
| CleanEx | HS_ACAT1. HS_SOAT1. |
| Genevestigator | P35610. |
| GermOnline | ENSG00000057252. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR004299. MBOAT_fam. IPR014371. Oat_ACAT_DAG_ARE. [Graphical view] |
| PANTHER | PTHR10408. PTHR10408. 1 hit. |
| Pfam | PF03062. MBOAT. 1 hit. [Graphical view] |
| PIRSF | PIRSF000439. Oat_ACAT_DAG_ARE. 1 hit. |
| ProtoNet | Search... |
Other | |
| BindingDB | P35610. |
| ChEMBL | CHEMBL2782. |
| ChiTaRS | SOAT1. human. |
| DrugBank | DB00973. Ezetimibe. DB01094. Hesperetin. |
| GenomeRNAi | 6646. |
| NextBio | 25899. |
| SOURCE | Search... |
Entry information
| Entry name | SOAT1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P35610 Secondary accession number(s): A6NC40 Q8N1E4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
