Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P35590

- TIE1_HUMAN

UniProt

P35590 - TIE1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Tyrosine-protein kinase receptor Tie-1

Gene

TIE1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Transmembrane tyrosine-protein kinase that may modulate TEK/TIE2 activity and contribute to the regulation of angiogenesis.1 Publication

Catalytic activityi

ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.PROSITE-ProRule annotation

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei870 – 8701ATPPROSITE-ProRule annotation
Active sitei979 – 9791Proton acceptorPROSITE-ProRule annotation

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi845 – 8539ATPPROSITE-ProRule annotation

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. transmembrane receptor protein tyrosine kinase activity Source: ProtInc

GO - Biological processi

  1. angiogenesis Source: UniProtKB-KW
  2. in utero embryonic development Source: Ensembl
  3. mesoderm development Source: ProtInc
  4. negative regulation of angiogenesis Source: Ensembl
  5. negative regulation of cell migration Source: Ensembl
  6. peptidyl-tyrosine phosphorylation Source: GOC
  7. plasma membrane fusion Source: Ensembl
  8. response to retinoic acid Source: Ensembl
  9. signal transduction Source: ProtInc
  10. vasculogenesis Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Receptor, Transferase, Tyrosine-protein kinase

Keywords - Biological processi

Angiogenesis

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDAi2.7.10.1. 2681.
SignaLinkiP35590.

Names & Taxonomyi

Protein namesi
Recommended name:
Tyrosine-protein kinase receptor Tie-1 (EC:2.7.10.1)
Gene namesi
Name:TIE1
Synonyms:TIE
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:11809. TIE1.

Subcellular locationi

Cell membrane 2 Publications; Single-pass type I membrane protein 2 Publications

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini22 – 759738ExtracellularSequence AnalysisAdd
BLAST
Transmembranei760 – 78425HelicalSequence AnalysisAdd
BLAST
Topological domaini785 – 1138354CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. integral component of plasma membrane Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA36516.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 21211 PublicationAdd
BLAST
Chaini22 – 11381117Tyrosine-protein kinase receptor Tie-1PRO_0000024471Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi83 – 831N-linked (GlcNAc...)Sequence Analysis
Glycosylationi161 – 1611N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi228 ↔ 237PROSITE-ProRule annotation
Disulfide bondi231 ↔ 244PROSITE-ProRule annotation
Disulfide bondi246 ↔ 255PROSITE-ProRule annotation
Disulfide bondi315 ↔ 327PROSITE-ProRule annotation
Disulfide bondi321 ↔ 333PROSITE-ProRule annotation
Disulfide bondi335 ↔ 344PROSITE-ProRule annotation
Glycosylationi503 – 5031N-linked (GlcNAc...)Sequence Analysis
Glycosylationi596 – 5961N-linked (GlcNAc...)Sequence Analysis
Glycosylationi709 – 7091N-linked (GlcNAc...)Sequence Analysis
Modified residuei1007 – 10071Phosphotyrosine; by autocatalysisBy similarity

Post-translational modificationi

Phosphorylated on tyrosine residues in response to ANGPT1, most likely by TEK/TIE2.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiP35590.
PRIDEiP35590.

PTM databases

PhosphoSiteiP35590.

Expressioni

Tissue specificityi

Specifically expressed in developing vascular endothelial cells.

Gene expression databases

BgeeiP35590.
CleanExiHS_TIE1.
ExpressionAtlasiP35590. baseline and differential.
GenevestigatoriP35590.

Interactioni

Subunit structurei

Heterodimer with TEK/TIE2.

Binary interactionsi

WithEntry#Exp.IntActNotes
PSG5Q152383EBI-2256865,EBI-4314891

Protein-protein interaction databases

BioGridi112931. 8 interactions.
IntActiP35590. 8 interactions.
MINTiMINT-6773015.
STRINGi9606.ENSP00000361554.

Structurei

3D structure databases

ProteinModelPortaliP35590.
SMRiP35590. Positions 22-523, 549-736, 772-1136.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini43 – 10563Ig-like C2-type 1Add
BLAST
Domaini214 – 25643EGF-like 1PROSITE-ProRule annotationAdd
BLAST
Domaini258 – 30346EGF-like 2PROSITE-ProRule annotationAdd
BLAST
Domaini305 – 34541EGF-like 3PROSITE-ProRule annotationAdd
BLAST
Domaini372 – 42655Ig-like C2-type 2Add
BLAST
Domaini446 – 545100Fibronectin type-III 1PROSITE-ProRule annotationAdd
BLAST
Domaini548 – 64295Fibronectin type-III 2PROSITE-ProRule annotationAdd
BLAST
Domaini646 – 73994Fibronectin type-III 3PROSITE-ProRule annotationAdd
BLAST
Domaini839 – 1118280Protein kinasePROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the protein kinase superfamily. Tyr protein kinase family. Tie subfamily.PROSITE-ProRule annotation
Contains 3 EGF-like domains.PROSITE-ProRule annotation
Contains 3 fibronectin type-III domains.PROSITE-ProRule annotation
Contains 1 protein kinase domain.PROSITE-ProRule annotation

Keywords - Domaini

EGF-like domain, Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG0515.
GeneTreeiENSGT00770000120533.
HOGENOMiHOG000049232.
HOVERGENiHBG007316.
InParanoidiP35590.
KOiK05120.
OMAiSDRIPQI.
PhylomeDBiP35590.
TreeFamiTF317568.

Family and domain databases

Gene3Di2.60.40.10. 5 hits.
InterProiIPR000742. EG-like_dom.
IPR013032. EGF-like_CS.
IPR003961. Fibronectin_type3.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
IPR008266. Tyr_kinase_AS.
IPR020635. Tyr_kinase_cat_dom.
[Graphical view]
PfamiPF00041. fn3. 3 hits.
PF12661. hEGF. 1 hit.
PF07714. Pkinase_Tyr. 1 hit.
[Graphical view]
PRINTSiPR00109. TYRKINASE.
SMARTiSM00181. EGF. 2 hits.
SM00060. FN3. 3 hits.
SM00409. IG. 1 hit.
SM00219. TyrKc. 1 hit.
[Graphical view]
SUPFAMiSSF49265. SSF49265. 2 hits.
SSF56112. SSF56112. 1 hit.
PROSITEiPS00022. EGF_1. 3 hits.
PS01186. EGF_2. 3 hits.
PS50026. EGF_3. 2 hits.
PS50853. FN3. 3 hits.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00109. PROTEIN_KINASE_TYR. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P35590-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVWRVPPFLL PILFLASHVG AAVDLTLLAN LRLTDPQRFF LTCVSGEAGA
60 70 80 90 100
GRGSDAWGPP LLLEKDDRIV RTPPGPPLRL ARNGSHQVTL RGFSKPSDLV
110 120 130 140 150
GVFSCVGGAG ARRTRVIYVH NSPGAHLLPD KVTHTVNKGD TAVLSARVHK
160 170 180 190 200
EKQTDVIWKS NGSYFYTLDW HEAQDGRFLL QLPNVQPPSS GIYSATYLEA
210 220 230 240 250
SPLGSAFFRL IVRGCGAGRW GPGCTKECPG CLHGGVCHDH DGECVCPPGF
260 270 280 290 300
TGTRCEQACR EGRFGQSCQE QCPGISGCRG LTFCLPDPYG CSCGSGWRGS
310 320 330 340 350
QCQEACAPGH FGADCRLQCQ CQNGGTCDRF SGCVCPSGWH GVHCEKSDRI
360 370 380 390 400
PQILNMASEL EFNLETMPRI NCAAAGNPFP VRGSIELRKP DGTVLLSTKA
410 420 430 440 450
IVEPEKTTAE FEVPRLVLAD SGFWECRVST SGGQDSRRFK VNVKVPPVPL
460 470 480 490 500
AAPRLLTKQS RQLVVSPLVS FSGDGPISTV RLHYRPQDST MDWSTIVVDP
510 520 530 540 550
SENVTLMNLR PKTGYSVRVQ LSRPGEGGEG AWGPPTLMTT DCPEPLLQPW
560 570 580 590 600
LEGWHVEGTD RLRVSWSLPL VPGPLVGDGF LLRLWDGTRG QERRENVSSP
610 620 630 640 650
QARTALLTGL TPGTHYQLDV QLYHCTLLGP ASPPAHVLLP PSGPPAPRHL
660 670 680 690 700
HAQALSDSEI QLTWKHPEAL PGPISKYVVE VQVAGGAGDP LWIDVDRPEE
710 720 730 740 750
TSTIIRGLNA STRYLFRMRA SIQGLGDWSN TVEESTLGNG LQAEGPVQES
760 770 780 790 800
RAAEEGLDQQ LILAVVGSVS ATCLTILAAL LTLVCIRRSC LHRRRTFTYQ
810 820 830 840 850
SGSGEETILQ FSSGTLTLTR RPKLQPEPLS YPVLEWEDIT FEDLIGEGNF
860 870 880 890 900
GQVIRAMIKK DGLKMNAAIK MLKEYASEND HRDFAGELEV LCKLGHHPNI
910 920 930 940 950
INLLGACKNR GYLYIAIEYA PYGNLLDFLR KSRVLETDPA FAREHGTAST
960 970 980 990 1000
LSSRQLLRFA SDAANGMQYL SEKQFIHRDL AARNVLVGEN LASKIADFGL
1010 1020 1030 1040 1050
SRGEEVYVKK TMGRLPVRWM AIESLNYSVY TTKSDVWSFG VLLWEIVSLG
1060 1070 1080 1090 1100
GTPYCGMTCA ELYEKLPQGY RMEQPRNCDD EVYELMRQCW RDRPYERPPF
1110 1120 1130
AQIALQLGRM LEARKAYVNM SLFENFTYAG IDATAEEA
Length:1,138
Mass (Da):125,090
Last modified:June 1, 1994 - v1
Checksum:i3B42BE33678C58A1
GO
Isoform 2 (identifier: P35590-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     348-379: DRIPQILNMASELEFNLETMPRINCAAAGNPF → GWRDWVDTSTEKQNTDEGRFGGHVSAPVGAPG
     380-1138: Missing.

Show »
Length:379
Mass (Da):40,616
Checksum:i8EACCD600795FF09
GO
Isoform 3 (identifier: P35590-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     305-317: ACAPGHFGADCRL → VHQGHCGAREDHS
     318-1138: Missing.

Show »
Length:317
Mass (Da):34,138
Checksum:i456907881A613CE4
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti448 – 4481V → M.1 Publication
Corresponds to variant rs56302794 [ dbSNP | Ensembl ].
VAR_041852
Natural varianti1104 – 11041A → V.1 Publication
Corresponds to variant rs35573981 [ dbSNP | Ensembl ].
VAR_041853
Natural varianti1109 – 11091R → H.1 Publication
Corresponds to variant rs34993202 [ dbSNP | Ensembl ].
VAR_041854

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei305 – 31713ACAPG…ADCRL → VHQGHCGAREDHS in isoform 3. 1 PublicationVSP_047607Add
BLAST
Alternative sequencei318 – 1138821Missing in isoform 3. 1 PublicationVSP_047608Add
BLAST
Alternative sequencei348 – 37932DRIPQ…AGNPF → GWRDWVDTSTEKQNTDEGRF GGHVSAPVGAPG in isoform 2. 1 PublicationVSP_047609Add
BLAST
Alternative sequencei380 – 1138759Missing in isoform 2. 1 PublicationVSP_047610Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X60957 mRNA. Translation: CAA43290.1.
EU826587 mRNA. Translation: ACF47623.1.
EU826588 mRNA. Translation: ACF47624.1.
AC093420 Genomic DNA. No translation available.
AL139289 Genomic DNA. No translation available.
BC038239 mRNA. Translation: AAH38239.1.
CCDSiCCDS482.1. [P35590-1]
RefSeqiNP_005415.1. NM_005424.4. [P35590-1]
UniGeneiHs.78824.

Genome annotation databases

EnsembliENST00000372476; ENSP00000361554; ENSG00000066056. [P35590-1]
ENST00000538015; ENSP00000440063; ENSG00000066056. [P35590-2]
GeneIDi7075.
KEGGihsa:7075.
UCSCiuc001ciu.3. human. [P35590-1]
uc010okc.2. human.

Polymorphism databases

DMDMi549081.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X60957 mRNA. Translation: CAA43290.1 .
EU826587 mRNA. Translation: ACF47623.1 .
EU826588 mRNA. Translation: ACF47624.1 .
AC093420 Genomic DNA. No translation available.
AL139289 Genomic DNA. No translation available.
BC038239 mRNA. Translation: AAH38239.1 .
CCDSi CCDS482.1. [P35590-1 ]
RefSeqi NP_005415.1. NM_005424.4. [P35590-1 ]
UniGenei Hs.78824.

3D structure databases

ProteinModelPortali P35590.
SMRi P35590. Positions 22-523, 549-736, 772-1136.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 112931. 8 interactions.
IntActi P35590. 8 interactions.
MINTi MINT-6773015.
STRINGi 9606.ENSP00000361554.

Chemistry

BindingDBi P35590.
ChEMBLi CHEMBL5274.
GuidetoPHARMACOLOGYi 1841.

PTM databases

PhosphoSitei P35590.

Polymorphism databases

DMDMi 549081.

Proteomic databases

PaxDbi P35590.
PRIDEi P35590.

Protocols and materials databases

DNASUi 7075.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000372476 ; ENSP00000361554 ; ENSG00000066056 . [P35590-1 ]
ENST00000538015 ; ENSP00000440063 ; ENSG00000066056 . [P35590-2 ]
GeneIDi 7075.
KEGGi hsa:7075.
UCSCi uc001ciu.3. human. [P35590-1 ]
uc010okc.2. human.

Organism-specific databases

CTDi 7075.
GeneCardsi GC01P043766.
HGNCi HGNC:11809. TIE1.
MIMi 600222. gene.
neXtProti NX_P35590.
PharmGKBi PA36516.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0515.
GeneTreei ENSGT00770000120533.
HOGENOMi HOG000049232.
HOVERGENi HBG007316.
InParanoidi P35590.
KOi K05120.
OMAi SDRIPQI.
PhylomeDBi P35590.
TreeFami TF317568.

Enzyme and pathway databases

BRENDAi 2.7.10.1. 2681.
SignaLinki P35590.

Miscellaneous databases

ChiTaRSi TIE1. human.
GenomeRNAii 7075.
NextBioi 27671.
PROi P35590.
SOURCEi Search...

Gene expression databases

Bgeei P35590.
CleanExi HS_TIE1.
ExpressionAtlasi P35590. baseline and differential.
Genevestigatori P35590.

Family and domain databases

Gene3Di 2.60.40.10. 5 hits.
InterProi IPR000742. EG-like_dom.
IPR013032. EGF-like_CS.
IPR003961. Fibronectin_type3.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
IPR008266. Tyr_kinase_AS.
IPR020635. Tyr_kinase_cat_dom.
[Graphical view ]
Pfami PF00041. fn3. 3 hits.
PF12661. hEGF. 1 hit.
PF07714. Pkinase_Tyr. 1 hit.
[Graphical view ]
PRINTSi PR00109. TYRKINASE.
SMARTi SM00181. EGF. 2 hits.
SM00060. FN3. 3 hits.
SM00409. IG. 1 hit.
SM00219. TyrKc. 1 hit.
[Graphical view ]
SUPFAMi SSF49265. SSF49265. 2 hits.
SSF56112. SSF56112. 1 hit.
PROSITEi PS00022. EGF_1. 3 hits.
PS01186. EGF_2. 3 hits.
PS50026. EGF_3. 2 hits.
PS50853. FN3. 3 hits.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00109. PROTEIN_KINASE_TYR. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "A novel endothelial cell surface receptor tyrosine kinase with extracellular epidermal growth factor homology domains."
    Partanen J., Armstrong E., Maekelae T.P., Korhonen J., Sandberg M., Renkonen R., Knuutila S., Huebner K., Alitalo K.
    Mol. Cell. Biol. 12:1698-1707(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. Partanen J.M.
    Submitted (JUL-1993) to the EMBL/GenBank/DDBJ databases
    Cited for: SEQUENCE REVISION.
  3. "Novel splice variants derived from the receptor tyrosine kinase superfamily are potential therapeutics for rheumatoid arthritis."
    Jin P., Zhang J., Sumariwalla P.F., Ni I., Jorgensen B., Crawford D., Phillips S., Feldmann M., Shepard H.M., Paleolog E.M.
    Arthritis Res. Ther. 10:R73-R73(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), ALTERNATIVE SPLICING.
  4. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Lung.
  6. "Signal peptide prediction based on analysis of experimentally verified cleavage sites."
    Zhang Z., Henzel W.J.
    Protein Sci. 13:2819-2824(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 22-36.
  7. "Multiple angiopoietin recombinant proteins activate the Tie1 receptor tyrosine kinase and promote its interaction with Tie2."
    Saharinen P., Kerkela K., Ekman N., Marron M., Brindle N., Lee G.M., Augustin H., Koh G.Y., Alitalo K.
    J. Cell Biol. 169:239-243(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH TEK/TIE2, SUBCELLULAR LOCATION, PHOSPHORYLATION.
  8. "Tie1-Tie2 interactions mediate functional differences between angiopoietin ligands."
    Seegar T.C., Eller B., Tzvetkova-Robev D., Kolev M.V., Henderson S.C., Nikolov D.B., Barton W.A.
    Mol. Cell 37:643-655(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH TEK/TIE2, SUBCELLULAR LOCATION, FUNCTION.
  9. "Patterns of somatic mutation in human cancer genomes."
    Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G.
    , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.
    Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS [LARGE SCALE ANALYSIS] MET-448; VAL-1104 AND HIS-1109.

Entry informationi

Entry nameiTIE1_HUMAN
AccessioniPrimary (citable) accession number: P35590
Secondary accession number(s): B5A949, B5A950
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 1, 1994
Last sequence update: June 1, 1994
Last modified: November 26, 2014
This is version 152 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3