SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P35590

- TIE1_HUMAN

UniProt

P35590 - TIE1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Tyrosine-protein kinase receptor Tie-1
Gene
TIE1, TIE
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Transmembrane tyrosine-protein kinase that may modulate TEK/TIE2 activity and contribute to the regulation of angiogenesis.1 Publication

Catalytic activityi

ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei870 – 8701ATP By similarity
Active sitei979 – 9791Proton acceptor By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi845 – 8539ATP By similarity

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. protein binding Source: IntAct
  3. transmembrane receptor protein tyrosine kinase activity Source: ProtInc

GO - Biological processi

  1. angiogenesis Source: UniProtKB-KW
  2. in utero embryonic development Source: Ensembl
  3. mesoderm development Source: ProtInc
  4. negative regulation of angiogenesis Source: Ensembl
  5. negative regulation of cell migration Source: Ensembl
  6. peptidyl-tyrosine phosphorylation Source: GOC
  7. plasma membrane fusion Source: Ensembl
  8. response to retinoic acid Source: Ensembl
  9. signal transduction Source: ProtInc
  10. vasculogenesis Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Receptor, Transferase, Tyrosine-protein kinase

Keywords - Biological processi

Angiogenesis

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDAi2.7.10.1. 2681.
SignaLinkiP35590.

Names & Taxonomyi

Protein namesi
Recommended name:
Tyrosine-protein kinase receptor Tie-1 (EC:2.7.10.1)
Gene namesi
Name:TIE1
Synonyms:TIE
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:11809. TIE1.

Subcellular locationi

Cell membrane; Single-pass type I membrane protein 2 Publications

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini22 – 759738Extracellular Reviewed prediction
Add
BLAST
Transmembranei760 – 78425Helical; Reviewed prediction
Add
BLAST
Topological domaini785 – 1138354Cytoplasmic Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. integral component of plasma membrane Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA36516.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 21211 Publication
Add
BLAST
Chaini22 – 11381117Tyrosine-protein kinase receptor Tie-1
PRO_0000024471Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi83 – 831N-linked (GlcNAc...) Reviewed prediction
Glycosylationi161 – 1611N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi228 ↔ 237 By similarity
Disulfide bondi231 ↔ 244 By similarity
Disulfide bondi246 ↔ 255 By similarity
Disulfide bondi315 ↔ 327 By similarity
Disulfide bondi321 ↔ 333 By similarity
Disulfide bondi335 ↔ 344 By similarity
Glycosylationi503 – 5031N-linked (GlcNAc...) Reviewed prediction
Glycosylationi596 – 5961N-linked (GlcNAc...) Reviewed prediction
Glycosylationi709 – 7091N-linked (GlcNAc...) Reviewed prediction
Modified residuei1007 – 10071Phosphotyrosine; by autocatalysis By similarity

Post-translational modificationi

Phosphorylated on tyrosine residues in response to ANGPT1, most likely by TEK/TIE2.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiP35590.
PRIDEiP35590.

PTM databases

PhosphoSiteiP35590.

Expressioni

Tissue specificityi

Specifically expressed in developing vascular endothelial cells.

Gene expression databases

ArrayExpressiP35590.
BgeeiP35590.
CleanExiHS_TIE1.
GenevestigatoriP35590.

Interactioni

Subunit structurei

Heterodimer with TEK/TIE2.

Binary interactionsi

WithEntry#Exp.IntActNotes
PSG5Q152383EBI-2256865,EBI-4314891

Protein-protein interaction databases

BioGridi112931. 8 interactions.
IntActiP35590. 7 interactions.
MINTiMINT-6773015.
STRINGi9606.ENSP00000361554.

Structurei

3D structure databases

ProteinModelPortaliP35590.
SMRiP35590. Positions 22-523, 549-736, 772-1136.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini43 – 10563Ig-like C2-type 1
Add
BLAST
Domaini214 – 25643EGF-like 1
Add
BLAST
Domaini258 – 30346EGF-like 2
Add
BLAST
Domaini305 – 34541EGF-like 3
Add
BLAST
Domaini372 – 42655Ig-like C2-type 2
Add
BLAST
Domaini446 – 545100Fibronectin type-III 1
Add
BLAST
Domaini548 – 64295Fibronectin type-III 2
Add
BLAST
Domaini646 – 73994Fibronectin type-III 3
Add
BLAST
Domaini839 – 1118280Protein kinase
Add
BLAST

Sequence similaritiesi

Contains 3 EGF-like domains.

Keywords - Domaini

EGF-like domain, Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG0515.
HOGENOMiHOG000049232.
HOVERGENiHBG007316.
InParanoidiP35590.
KOiK05120.
OMAiSDRIPQI.
PhylomeDBiP35590.
TreeFamiTF317568.

Family and domain databases

Gene3Di2.60.40.10. 5 hits.
InterProiIPR000742. EG-like_dom.
IPR013032. EGF-like_CS.
IPR003961. Fibronectin_type3.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
IPR008266. Tyr_kinase_AS.
IPR020635. Tyr_kinase_cat_dom.
[Graphical view]
PfamiPF00041. fn3. 3 hits.
PF12661. hEGF. 1 hit.
PF07714. Pkinase_Tyr. 1 hit.
[Graphical view]
PRINTSiPR00109. TYRKINASE.
SMARTiSM00181. EGF. 2 hits.
SM00060. FN3. 3 hits.
SM00409. IG. 1 hit.
SM00219. TyrKc. 1 hit.
[Graphical view]
SUPFAMiSSF49265. SSF49265. 2 hits.
SSF56112. SSF56112. 1 hit.
PROSITEiPS00022. EGF_1. 3 hits.
PS01186. EGF_2. 3 hits.
PS50026. EGF_3. 2 hits.
PS50853. FN3. 3 hits.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00109. PROTEIN_KINASE_TYR. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P35590-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MVWRVPPFLL PILFLASHVG AAVDLTLLAN LRLTDPQRFF LTCVSGEAGA     50
GRGSDAWGPP LLLEKDDRIV RTPPGPPLRL ARNGSHQVTL RGFSKPSDLV 100
GVFSCVGGAG ARRTRVIYVH NSPGAHLLPD KVTHTVNKGD TAVLSARVHK 150
EKQTDVIWKS NGSYFYTLDW HEAQDGRFLL QLPNVQPPSS GIYSATYLEA 200
SPLGSAFFRL IVRGCGAGRW GPGCTKECPG CLHGGVCHDH DGECVCPPGF 250
TGTRCEQACR EGRFGQSCQE QCPGISGCRG LTFCLPDPYG CSCGSGWRGS 300
QCQEACAPGH FGADCRLQCQ CQNGGTCDRF SGCVCPSGWH GVHCEKSDRI 350
PQILNMASEL EFNLETMPRI NCAAAGNPFP VRGSIELRKP DGTVLLSTKA 400
IVEPEKTTAE FEVPRLVLAD SGFWECRVST SGGQDSRRFK VNVKVPPVPL 450
AAPRLLTKQS RQLVVSPLVS FSGDGPISTV RLHYRPQDST MDWSTIVVDP 500
SENVTLMNLR PKTGYSVRVQ LSRPGEGGEG AWGPPTLMTT DCPEPLLQPW 550
LEGWHVEGTD RLRVSWSLPL VPGPLVGDGF LLRLWDGTRG QERRENVSSP 600
QARTALLTGL TPGTHYQLDV QLYHCTLLGP ASPPAHVLLP PSGPPAPRHL 650
HAQALSDSEI QLTWKHPEAL PGPISKYVVE VQVAGGAGDP LWIDVDRPEE 700
TSTIIRGLNA STRYLFRMRA SIQGLGDWSN TVEESTLGNG LQAEGPVQES 750
RAAEEGLDQQ LILAVVGSVS ATCLTILAAL LTLVCIRRSC LHRRRTFTYQ 800
SGSGEETILQ FSSGTLTLTR RPKLQPEPLS YPVLEWEDIT FEDLIGEGNF 850
GQVIRAMIKK DGLKMNAAIK MLKEYASEND HRDFAGELEV LCKLGHHPNI 900
INLLGACKNR GYLYIAIEYA PYGNLLDFLR KSRVLETDPA FAREHGTAST 950
LSSRQLLRFA SDAANGMQYL SEKQFIHRDL AARNVLVGEN LASKIADFGL 1000
SRGEEVYVKK TMGRLPVRWM AIESLNYSVY TTKSDVWSFG VLLWEIVSLG 1050
GTPYCGMTCA ELYEKLPQGY RMEQPRNCDD EVYELMRQCW RDRPYERPPF 1100
AQIALQLGRM LEARKAYVNM SLFENFTYAG IDATAEEA 1138
Length:1,138
Mass (Da):125,090
Last modified:June 1, 1994 - v1
Checksum:i3B42BE33678C58A1
GO
Isoform 2 (identifier: P35590-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     348-379: DRIPQILNMASELEFNLETMPRINCAAAGNPF → GWRDWVDTSTEKQNTDEGRFGGHVSAPVGAPG
     380-1138: Missing.

Show »
Length:379
Mass (Da):40,616
Checksum:i8EACCD600795FF09
GO
Isoform 3 (identifier: P35590-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     305-317: ACAPGHFGADCRL → VHQGHCGAREDHS
     318-1138: Missing.

Show »
Length:317
Mass (Da):34,138
Checksum:i456907881A613CE4
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti448 – 4481V → M.1 Publication
Corresponds to variant rs56302794 [ dbSNP | Ensembl ].
VAR_041852
Natural varianti1104 – 11041A → V.1 Publication
Corresponds to variant rs35573981 [ dbSNP | Ensembl ].
VAR_041853
Natural varianti1109 – 11091R → H.1 Publication
Corresponds to variant rs34993202 [ dbSNP | Ensembl ].
VAR_041854

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei305 – 31713ACAPG…ADCRL → VHQGHCGAREDHS in isoform 3.
VSP_047607Add
BLAST
Alternative sequencei318 – 1138821Missing in isoform 3.
VSP_047608Add
BLAST
Alternative sequencei348 – 37932DRIPQ…AGNPF → GWRDWVDTSTEKQNTDEGRF GGHVSAPVGAPG in isoform 2.
VSP_047609Add
BLAST
Alternative sequencei380 – 1138759Missing in isoform 2.
VSP_047610Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X60957 mRNA. Translation: CAA43290.1.
EU826587 mRNA. Translation: ACF47623.1.
EU826588 mRNA. Translation: ACF47624.1.
AC093420 Genomic DNA. No translation available.
AL139289 Genomic DNA. No translation available.
BC038239 mRNA. Translation: AAH38239.1.
CCDSiCCDS482.1. [P35590-1]
RefSeqiNP_005415.1. NM_005424.4. [P35590-1]
UniGeneiHs.78824.

Genome annotation databases

EnsembliENST00000372476; ENSP00000361554; ENSG00000066056. [P35590-1]
ENST00000441333; ENSP00000401903; ENSG00000066056. [P35590-3]
ENST00000538015; ENSP00000440063; ENSG00000066056. [P35590-2]
GeneIDi7075.
KEGGihsa:7075.
UCSCiuc001ciu.3. human. [P35590-1]

Polymorphism databases

DMDMi549081.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X60957 mRNA. Translation: CAA43290.1 .
EU826587 mRNA. Translation: ACF47623.1 .
EU826588 mRNA. Translation: ACF47624.1 .
AC093420 Genomic DNA. No translation available.
AL139289 Genomic DNA. No translation available.
BC038239 mRNA. Translation: AAH38239.1 .
CCDSi CCDS482.1. [P35590-1 ]
RefSeqi NP_005415.1. NM_005424.4. [P35590-1 ]
UniGenei Hs.78824.

3D structure databases

ProteinModelPortali P35590.
SMRi P35590. Positions 22-523, 549-736, 772-1136.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 112931. 8 interactions.
IntActi P35590. 7 interactions.
MINTi MINT-6773015.
STRINGi 9606.ENSP00000361554.

Chemistry

BindingDBi P35590.
ChEMBLi CHEMBL5274.
GuidetoPHARMACOLOGYi 1841.

PTM databases

PhosphoSitei P35590.

Polymorphism databases

DMDMi 549081.

Proteomic databases

PaxDbi P35590.
PRIDEi P35590.

Protocols and materials databases

DNASUi 7075.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000372476 ; ENSP00000361554 ; ENSG00000066056 . [P35590-1 ]
ENST00000441333 ; ENSP00000401903 ; ENSG00000066056 . [P35590-3 ]
ENST00000538015 ; ENSP00000440063 ; ENSG00000066056 . [P35590-2 ]
GeneIDi 7075.
KEGGi hsa:7075.
UCSCi uc001ciu.3. human. [P35590-1 ]

Organism-specific databases

CTDi 7075.
GeneCardsi GC01P043766.
HGNCi HGNC:11809. TIE1.
MIMi 600222. gene.
neXtProti NX_P35590.
PharmGKBi PA36516.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0515.
HOGENOMi HOG000049232.
HOVERGENi HBG007316.
InParanoidi P35590.
KOi K05120.
OMAi SDRIPQI.
PhylomeDBi P35590.
TreeFami TF317568.

Enzyme and pathway databases

BRENDAi 2.7.10.1. 2681.
SignaLinki P35590.

Miscellaneous databases

GenomeRNAii 7075.
NextBioi 27671.
PROi P35590.
SOURCEi Search...

Gene expression databases

ArrayExpressi P35590.
Bgeei P35590.
CleanExi HS_TIE1.
Genevestigatori P35590.

Family and domain databases

Gene3Di 2.60.40.10. 5 hits.
InterProi IPR000742. EG-like_dom.
IPR013032. EGF-like_CS.
IPR003961. Fibronectin_type3.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
IPR008266. Tyr_kinase_AS.
IPR020635. Tyr_kinase_cat_dom.
[Graphical view ]
Pfami PF00041. fn3. 3 hits.
PF12661. hEGF. 1 hit.
PF07714. Pkinase_Tyr. 1 hit.
[Graphical view ]
PRINTSi PR00109. TYRKINASE.
SMARTi SM00181. EGF. 2 hits.
SM00060. FN3. 3 hits.
SM00409. IG. 1 hit.
SM00219. TyrKc. 1 hit.
[Graphical view ]
SUPFAMi SSF49265. SSF49265. 2 hits.
SSF56112. SSF56112. 1 hit.
PROSITEi PS00022. EGF_1. 3 hits.
PS01186. EGF_2. 3 hits.
PS50026. EGF_3. 2 hits.
PS50853. FN3. 3 hits.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00109. PROTEIN_KINASE_TYR. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "A novel endothelial cell surface receptor tyrosine kinase with extracellular epidermal growth factor homology domains."
    Partanen J., Armstrong E., Maekelae T.P., Korhonen J., Sandberg M., Renkonen R., Knuutila S., Huebner K., Alitalo K.
    Mol. Cell. Biol. 12:1698-1707(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. Partanen J.M.
    Submitted (JUL-1993) to the EMBL/GenBank/DDBJ databases
    Cited for: SEQUENCE REVISION.
  3. "Novel splice variants derived from the receptor tyrosine kinase superfamily are potential therapeutics for rheumatoid arthritis."
    Jin P., Zhang J., Sumariwalla P.F., Ni I., Jorgensen B., Crawford D., Phillips S., Feldmann M., Shepard H.M., Paleolog E.M.
    Arthritis Res. Ther. 10:R73-R73(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), ALTERNATIVE SPLICING.
  4. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Lung.
  6. "Signal peptide prediction based on analysis of experimentally verified cleavage sites."
    Zhang Z., Henzel W.J.
    Protein Sci. 13:2819-2824(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 22-36.
  7. "Multiple angiopoietin recombinant proteins activate the Tie1 receptor tyrosine kinase and promote its interaction with Tie2."
    Saharinen P., Kerkela K., Ekman N., Marron M., Brindle N., Lee G.M., Augustin H., Koh G.Y., Alitalo K.
    J. Cell Biol. 169:239-243(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH TEK/TIE2, SUBCELLULAR LOCATION, PHOSPHORYLATION.
  8. "Tie1-Tie2 interactions mediate functional differences between angiopoietin ligands."
    Seegar T.C., Eller B., Tzvetkova-Robev D., Kolev M.V., Henderson S.C., Nikolov D.B., Barton W.A.
    Mol. Cell 37:643-655(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH TEK/TIE2, SUBCELLULAR LOCATION, FUNCTION.
  9. "Patterns of somatic mutation in human cancer genomes."
    Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G.
    , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.
    Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS [LARGE SCALE ANALYSIS] MET-448; VAL-1104 AND HIS-1109.

Entry informationi

Entry nameiTIE1_HUMAN
AccessioniPrimary (citable) accession number: P35590
Secondary accession number(s): B5A949, B5A950
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 1, 1994
Last sequence update: June 1, 1994
Last modified: July 9, 2014
This is version 149 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi