Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P35590

- TIE1_HUMAN

UniProt

P35590 - TIE1_HUMAN

Protein

Tyrosine-protein kinase receptor Tie-1

Gene

TIE1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 150 (01 Oct 2014)
      Sequence version 1 (01 Jun 1994)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Transmembrane tyrosine-protein kinase that may modulate TEK/TIE2 activity and contribute to the regulation of angiogenesis.1 Publication

    Catalytic activityi

    ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.PROSITE-ProRule annotation

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei870 – 8701ATPPROSITE-ProRule annotation
    Active sitei979 – 9791Proton acceptorPROSITE-ProRule annotation

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi845 – 8539ATPPROSITE-ProRule annotation

    GO - Molecular functioni

    1. ATP binding Source: UniProtKB-KW
    2. protein binding Source: IntAct
    3. transmembrane receptor protein tyrosine kinase activity Source: ProtInc

    GO - Biological processi

    1. angiogenesis Source: UniProtKB-KW
    2. in utero embryonic development Source: Ensembl
    3. mesoderm development Source: ProtInc
    4. negative regulation of angiogenesis Source: Ensembl
    5. negative regulation of cell migration Source: Ensembl
    6. peptidyl-tyrosine phosphorylation Source: GOC
    7. plasma membrane fusion Source: Ensembl
    8. response to retinoic acid Source: Ensembl
    9. signal transduction Source: ProtInc
    10. vasculogenesis Source: Ensembl

    Keywords - Molecular functioni

    Kinase, Receptor, Transferase, Tyrosine-protein kinase

    Keywords - Biological processi

    Angiogenesis

    Keywords - Ligandi

    ATP-binding, Nucleotide-binding

    Enzyme and pathway databases

    BRENDAi2.7.10.1. 2681.
    SignaLinkiP35590.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Tyrosine-protein kinase receptor Tie-1 (EC:2.7.10.1)
    Gene namesi
    Name:TIE1
    Synonyms:TIE
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:11809. TIE1.

    Subcellular locationi

    Cell membrane 2 Publications; Single-pass type I membrane protein 2 Publications

    GO - Cellular componenti

    1. integral component of plasma membrane Source: ProtInc

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA36516.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 21211 PublicationAdd
    BLAST
    Chaini22 – 11381117Tyrosine-protein kinase receptor Tie-1PRO_0000024471Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi83 – 831N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi161 – 1611N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi228 ↔ 237PROSITE-ProRule annotation
    Disulfide bondi231 ↔ 244PROSITE-ProRule annotation
    Disulfide bondi246 ↔ 255PROSITE-ProRule annotation
    Disulfide bondi315 ↔ 327PROSITE-ProRule annotation
    Disulfide bondi321 ↔ 333PROSITE-ProRule annotation
    Disulfide bondi335 ↔ 344PROSITE-ProRule annotation
    Glycosylationi503 – 5031N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi596 – 5961N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi709 – 7091N-linked (GlcNAc...)Sequence Analysis
    Modified residuei1007 – 10071Phosphotyrosine; by autocatalysisBy similarity

    Post-translational modificationi

    Phosphorylated on tyrosine residues in response to ANGPT1, most likely by TEK/TIE2.1 Publication

    Keywords - PTMi

    Disulfide bond, Glycoprotein, Phosphoprotein

    Proteomic databases

    PaxDbiP35590.
    PRIDEiP35590.

    PTM databases

    PhosphoSiteiP35590.

    Expressioni

    Tissue specificityi

    Specifically expressed in developing vascular endothelial cells.

    Gene expression databases

    ArrayExpressiP35590.
    BgeeiP35590.
    CleanExiHS_TIE1.
    GenevestigatoriP35590.

    Interactioni

    Subunit structurei

    Heterodimer with TEK/TIE2.

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    PSG5Q152383EBI-2256865,EBI-4314891

    Protein-protein interaction databases

    BioGridi112931. 8 interactions.
    IntActiP35590. 8 interactions.
    MINTiMINT-6773015.
    STRINGi9606.ENSP00000361554.

    Structurei

    3D structure databases

    ProteinModelPortaliP35590.
    SMRiP35590. Positions 22-523, 549-736, 772-1136.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini22 – 759738ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini785 – 1138354CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei760 – 78425HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini43 – 10563Ig-like C2-type 1Add
    BLAST
    Domaini214 – 25643EGF-like 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini258 – 30346EGF-like 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini305 – 34541EGF-like 3PROSITE-ProRule annotationAdd
    BLAST
    Domaini372 – 42655Ig-like C2-type 2Add
    BLAST
    Domaini446 – 545100Fibronectin type-III 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini548 – 64295Fibronectin type-III 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini646 – 73994Fibronectin type-III 3PROSITE-ProRule annotationAdd
    BLAST
    Domaini839 – 1118280Protein kinasePROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Belongs to the protein kinase superfamily. Tyr protein kinase family. Tie subfamily.PROSITE-ProRule annotation
    Contains 3 EGF-like domains.PROSITE-ProRule annotation
    Contains 3 fibronectin type-III domains.PROSITE-ProRule annotation
    Contains 1 protein kinase domain.PROSITE-ProRule annotation

    Keywords - Domaini

    EGF-like domain, Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG0515.
    HOGENOMiHOG000049232.
    HOVERGENiHBG007316.
    InParanoidiP35590.
    KOiK05120.
    OMAiSDRIPQI.
    PhylomeDBiP35590.
    TreeFamiTF317568.

    Family and domain databases

    Gene3Di2.60.40.10. 5 hits.
    InterProiIPR000742. EG-like_dom.
    IPR013032. EGF-like_CS.
    IPR003961. Fibronectin_type3.
    IPR013783. Ig-like_fold.
    IPR003599. Ig_sub.
    IPR011009. Kinase-like_dom.
    IPR000719. Prot_kinase_dom.
    IPR017441. Protein_kinase_ATP_BS.
    IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
    IPR008266. Tyr_kinase_AS.
    IPR020635. Tyr_kinase_cat_dom.
    [Graphical view]
    PfamiPF00041. fn3. 3 hits.
    PF12661. hEGF. 1 hit.
    PF07714. Pkinase_Tyr. 1 hit.
    [Graphical view]
    PRINTSiPR00109. TYRKINASE.
    SMARTiSM00181. EGF. 2 hits.
    SM00060. FN3. 3 hits.
    SM00409. IG. 1 hit.
    SM00219. TyrKc. 1 hit.
    [Graphical view]
    SUPFAMiSSF49265. SSF49265. 2 hits.
    SSF56112. SSF56112. 1 hit.
    PROSITEiPS00022. EGF_1. 3 hits.
    PS01186. EGF_2. 3 hits.
    PS50026. EGF_3. 2 hits.
    PS50853. FN3. 3 hits.
    PS00107. PROTEIN_KINASE_ATP. 1 hit.
    PS50011. PROTEIN_KINASE_DOM. 1 hit.
    PS00109. PROTEIN_KINASE_TYR. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P35590-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MVWRVPPFLL PILFLASHVG AAVDLTLLAN LRLTDPQRFF LTCVSGEAGA     50
    GRGSDAWGPP LLLEKDDRIV RTPPGPPLRL ARNGSHQVTL RGFSKPSDLV 100
    GVFSCVGGAG ARRTRVIYVH NSPGAHLLPD KVTHTVNKGD TAVLSARVHK 150
    EKQTDVIWKS NGSYFYTLDW HEAQDGRFLL QLPNVQPPSS GIYSATYLEA 200
    SPLGSAFFRL IVRGCGAGRW GPGCTKECPG CLHGGVCHDH DGECVCPPGF 250
    TGTRCEQACR EGRFGQSCQE QCPGISGCRG LTFCLPDPYG CSCGSGWRGS 300
    QCQEACAPGH FGADCRLQCQ CQNGGTCDRF SGCVCPSGWH GVHCEKSDRI 350
    PQILNMASEL EFNLETMPRI NCAAAGNPFP VRGSIELRKP DGTVLLSTKA 400
    IVEPEKTTAE FEVPRLVLAD SGFWECRVST SGGQDSRRFK VNVKVPPVPL 450
    AAPRLLTKQS RQLVVSPLVS FSGDGPISTV RLHYRPQDST MDWSTIVVDP 500
    SENVTLMNLR PKTGYSVRVQ LSRPGEGGEG AWGPPTLMTT DCPEPLLQPW 550
    LEGWHVEGTD RLRVSWSLPL VPGPLVGDGF LLRLWDGTRG QERRENVSSP 600
    QARTALLTGL TPGTHYQLDV QLYHCTLLGP ASPPAHVLLP PSGPPAPRHL 650
    HAQALSDSEI QLTWKHPEAL PGPISKYVVE VQVAGGAGDP LWIDVDRPEE 700
    TSTIIRGLNA STRYLFRMRA SIQGLGDWSN TVEESTLGNG LQAEGPVQES 750
    RAAEEGLDQQ LILAVVGSVS ATCLTILAAL LTLVCIRRSC LHRRRTFTYQ 800
    SGSGEETILQ FSSGTLTLTR RPKLQPEPLS YPVLEWEDIT FEDLIGEGNF 850
    GQVIRAMIKK DGLKMNAAIK MLKEYASEND HRDFAGELEV LCKLGHHPNI 900
    INLLGACKNR GYLYIAIEYA PYGNLLDFLR KSRVLETDPA FAREHGTAST 950
    LSSRQLLRFA SDAANGMQYL SEKQFIHRDL AARNVLVGEN LASKIADFGL 1000
    SRGEEVYVKK TMGRLPVRWM AIESLNYSVY TTKSDVWSFG VLLWEIVSLG 1050
    GTPYCGMTCA ELYEKLPQGY RMEQPRNCDD EVYELMRQCW RDRPYERPPF 1100
    AQIALQLGRM LEARKAYVNM SLFENFTYAG IDATAEEA 1138
    Length:1,138
    Mass (Da):125,090
    Last modified:June 1, 1994 - v1
    Checksum:i3B42BE33678C58A1
    GO
    Isoform 2 (identifier: P35590-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         348-379: DRIPQILNMASELEFNLETMPRINCAAAGNPF → GWRDWVDTSTEKQNTDEGRFGGHVSAPVGAPG
         380-1138: Missing.

    Show »
    Length:379
    Mass (Da):40,616
    Checksum:i8EACCD600795FF09
    GO
    Isoform 3 (identifier: P35590-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         305-317: ACAPGHFGADCRL → VHQGHCGAREDHS
         318-1138: Missing.

    Show »
    Length:317
    Mass (Da):34,138
    Checksum:i456907881A613CE4
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti448 – 4481V → M.1 Publication
    Corresponds to variant rs56302794 [ dbSNP | Ensembl ].
    VAR_041852
    Natural varianti1104 – 11041A → V.1 Publication
    Corresponds to variant rs35573981 [ dbSNP | Ensembl ].
    VAR_041853
    Natural varianti1109 – 11091R → H.1 Publication
    Corresponds to variant rs34993202 [ dbSNP | Ensembl ].
    VAR_041854

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei305 – 31713ACAPG…ADCRL → VHQGHCGAREDHS in isoform 3. 1 PublicationVSP_047607Add
    BLAST
    Alternative sequencei318 – 1138821Missing in isoform 3. 1 PublicationVSP_047608Add
    BLAST
    Alternative sequencei348 – 37932DRIPQ…AGNPF → GWRDWVDTSTEKQNTDEGRF GGHVSAPVGAPG in isoform 2. 1 PublicationVSP_047609Add
    BLAST
    Alternative sequencei380 – 1138759Missing in isoform 2. 1 PublicationVSP_047610Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X60957 mRNA. Translation: CAA43290.1.
    EU826587 mRNA. Translation: ACF47623.1.
    EU826588 mRNA. Translation: ACF47624.1.
    AC093420 Genomic DNA. No translation available.
    AL139289 Genomic DNA. No translation available.
    BC038239 mRNA. Translation: AAH38239.1.
    CCDSiCCDS482.1. [P35590-1]
    RefSeqiNP_005415.1. NM_005424.4. [P35590-1]
    UniGeneiHs.78824.

    Genome annotation databases

    EnsembliENST00000372476; ENSP00000361554; ENSG00000066056. [P35590-1]
    ENST00000538015; ENSP00000440063; ENSG00000066056. [P35590-2]
    GeneIDi7075.
    KEGGihsa:7075.
    UCSCiuc001ciu.3. human. [P35590-1]

    Polymorphism databases

    DMDMi549081.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    Atlas of Genetics and Cytogenetics in Oncology and Haematology

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X60957 mRNA. Translation: CAA43290.1 .
    EU826587 mRNA. Translation: ACF47623.1 .
    EU826588 mRNA. Translation: ACF47624.1 .
    AC093420 Genomic DNA. No translation available.
    AL139289 Genomic DNA. No translation available.
    BC038239 mRNA. Translation: AAH38239.1 .
    CCDSi CCDS482.1. [P35590-1 ]
    RefSeqi NP_005415.1. NM_005424.4. [P35590-1 ]
    UniGenei Hs.78824.

    3D structure databases

    ProteinModelPortali P35590.
    SMRi P35590. Positions 22-523, 549-736, 772-1136.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 112931. 8 interactions.
    IntActi P35590. 8 interactions.
    MINTi MINT-6773015.
    STRINGi 9606.ENSP00000361554.

    Chemistry

    BindingDBi P35590.
    ChEMBLi CHEMBL5274.
    GuidetoPHARMACOLOGYi 1841.

    PTM databases

    PhosphoSitei P35590.

    Polymorphism databases

    DMDMi 549081.

    Proteomic databases

    PaxDbi P35590.
    PRIDEi P35590.

    Protocols and materials databases

    DNASUi 7075.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000372476 ; ENSP00000361554 ; ENSG00000066056 . [P35590-1 ]
    ENST00000538015 ; ENSP00000440063 ; ENSG00000066056 . [P35590-2 ]
    GeneIDi 7075.
    KEGGi hsa:7075.
    UCSCi uc001ciu.3. human. [P35590-1 ]

    Organism-specific databases

    CTDi 7075.
    GeneCardsi GC01P043766.
    HGNCi HGNC:11809. TIE1.
    MIMi 600222. gene.
    neXtProti NX_P35590.
    PharmGKBi PA36516.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0515.
    HOGENOMi HOG000049232.
    HOVERGENi HBG007316.
    InParanoidi P35590.
    KOi K05120.
    OMAi SDRIPQI.
    PhylomeDBi P35590.
    TreeFami TF317568.

    Enzyme and pathway databases

    BRENDAi 2.7.10.1. 2681.
    SignaLinki P35590.

    Miscellaneous databases

    GenomeRNAii 7075.
    NextBioi 27671.
    PROi P35590.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P35590.
    Bgeei P35590.
    CleanExi HS_TIE1.
    Genevestigatori P35590.

    Family and domain databases

    Gene3Di 2.60.40.10. 5 hits.
    InterProi IPR000742. EG-like_dom.
    IPR013032. EGF-like_CS.
    IPR003961. Fibronectin_type3.
    IPR013783. Ig-like_fold.
    IPR003599. Ig_sub.
    IPR011009. Kinase-like_dom.
    IPR000719. Prot_kinase_dom.
    IPR017441. Protein_kinase_ATP_BS.
    IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
    IPR008266. Tyr_kinase_AS.
    IPR020635. Tyr_kinase_cat_dom.
    [Graphical view ]
    Pfami PF00041. fn3. 3 hits.
    PF12661. hEGF. 1 hit.
    PF07714. Pkinase_Tyr. 1 hit.
    [Graphical view ]
    PRINTSi PR00109. TYRKINASE.
    SMARTi SM00181. EGF. 2 hits.
    SM00060. FN3. 3 hits.
    SM00409. IG. 1 hit.
    SM00219. TyrKc. 1 hit.
    [Graphical view ]
    SUPFAMi SSF49265. SSF49265. 2 hits.
    SSF56112. SSF56112. 1 hit.
    PROSITEi PS00022. EGF_1. 3 hits.
    PS01186. EGF_2. 3 hits.
    PS50026. EGF_3. 2 hits.
    PS50853. FN3. 3 hits.
    PS00107. PROTEIN_KINASE_ATP. 1 hit.
    PS50011. PROTEIN_KINASE_DOM. 1 hit.
    PS00109. PROTEIN_KINASE_TYR. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "A novel endothelial cell surface receptor tyrosine kinase with extracellular epidermal growth factor homology domains."
      Partanen J., Armstrong E., Maekelae T.P., Korhonen J., Sandberg M., Renkonen R., Knuutila S., Huebner K., Alitalo K.
      Mol. Cell. Biol. 12:1698-1707(1992) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. Partanen J.M.
      Submitted (JUL-1993) to the EMBL/GenBank/DDBJ databases
      Cited for: SEQUENCE REVISION.
    3. "Novel splice variants derived from the receptor tyrosine kinase superfamily are potential therapeutics for rheumatoid arthritis."
      Jin P., Zhang J., Sumariwalla P.F., Ni I., Jorgensen B., Crawford D., Phillips S., Feldmann M., Shepard H.M., Paleolog E.M.
      Arthritis Res. Ther. 10:R73-R73(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), ALTERNATIVE SPLICING.
    4. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Lung.
    6. "Signal peptide prediction based on analysis of experimentally verified cleavage sites."
      Zhang Z., Henzel W.J.
      Protein Sci. 13:2819-2824(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: PROTEIN SEQUENCE OF 22-36.
    7. "Multiple angiopoietin recombinant proteins activate the Tie1 receptor tyrosine kinase and promote its interaction with Tie2."
      Saharinen P., Kerkela K., Ekman N., Marron M., Brindle N., Lee G.M., Augustin H., Koh G.Y., Alitalo K.
      J. Cell Biol. 169:239-243(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH TEK/TIE2, SUBCELLULAR LOCATION, PHOSPHORYLATION.
    8. "Tie1-Tie2 interactions mediate functional differences between angiopoietin ligands."
      Seegar T.C., Eller B., Tzvetkova-Robev D., Kolev M.V., Henderson S.C., Nikolov D.B., Barton W.A.
      Mol. Cell 37:643-655(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH TEK/TIE2, SUBCELLULAR LOCATION, FUNCTION.
    9. "Patterns of somatic mutation in human cancer genomes."
      Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G.
      , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.
      Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANTS [LARGE SCALE ANALYSIS] MET-448; VAL-1104 AND HIS-1109.

    Entry informationi

    Entry nameiTIE1_HUMAN
    AccessioniPrimary (citable) accession number: P35590
    Secondary accession number(s): B5A949, B5A950
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 1, 1994
    Last sequence update: June 1, 1994
    Last modified: October 1, 2014
    This is version 150 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. Human and mouse protein kinases
      Human and mouse protein kinases: classification and index
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3