P35546 (RET_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 128.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Proto-oncogene tyrosine-protein kinase receptor Ret EC=2.7.10.1 Alternative name(s): Proto-oncogene c-Ret Cleaved into the following 2 chains: | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 1115 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Receptor tyrosine-protein kinase involved in numerous cellular mechanisms including cell proliferation, neuronal navigation, cell migration, and cell differentiation upon binding with glial cell derived neurotrophic factor family ligands. Phosphorylates PTK2/FAK1. Regulates both cell death/survival balance and positional information. Required for the molecular mechanisms orchestration during intestine organogenesis; involved in the development of enteric nervous system and renal organogenesis during embryonic life, and promotes the formation of Peyer's patch-like structures, a major component of the gut-associated lymphoid tissue. Modulates cell adhesion via its cleavage by caspase in sympathetic neurons and mediates cell migration in an integrin (e.g. ITGB1 and ITGB3)-dependent manner. Involved in the development of the neural crest. Active in the absence of ligand, triggering apoptosis through a mechanism that requires receptor intracellular caspase cleavage. Acts as a dependence receptor; in the presence of the ligand GDNF in somatotrophs (within pituitary), promotes survival and down regulates growth hormone (GH) production, but triggers apoptosis in absence of GDNF. Regulates nociceptor survival and size. Triggers the differentiation of rapidly adapting (RA) mechanoreceptors. Mediator of several diseases such as neuroendocrine cancers; these diseases are characterized by aberrant integrins-regulated cell migration. Ref.8 Ref.9 |
| Catalytic activity | ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate. |
| Enzyme regulation | Repressed by withaferin A (WA). Ref.10 |
| Subunit structure | Interacts (not phosphorylated) with CC PTK2/FAK1 (via FERM domain). Extracellular cell-membrane anchored RET cadherin fragments form complex in neurons with reduced trophic status, preferentially at the contact sites between somas. Interacts with AIP in the pituitary gland; this interaction prevents the formation of the AIP-survivin complex By similarity. Phosphorylated form interacts with the PBT domain of DOK2, DOK4 and DOK5. The phosphorylated form interacts with PLCG1 and GRB7. Binds to ARTN. Ref.6 Ref.7 Ref.8 |
| Subcellular location | Cell membrane; Single-pass type I membrane protein. Endosome membrane; Single-pass type I membrane protein By similarity. |
| Tissue specificity | Expressed in peripheral nerve cells and hematopoietic cells. |
| Post-translational modification | Autophosphorylated on C-terminal tyrosine residues upon ligand stimulation. Dephosphorylated by PTPRJ on Tyr-906, Tyr-1016 and Tyr-1063 By similarity. Ref.7 Ref.11 Proteolytically cleaved by caspase-3. The soluble RET kinase fragment is able to induce cell death. The extracellular cell-membrane anchored RET cadherin fragment accelerates cell adhesion in sympathetic neurons By similarity. |
| Disruption phenotype | Exclusive loss in nociceptors results in a reduction in nociceptor number and size with a reduced epidermal innervation, but increased sensitivity to cold and increased formalin-induced pain. Ref.9 |
| Miscellaneous | Treatment with withaferin A (WA) leads tumor regression in medullary thyroid carcinomas (MTC). |
| Sequence similarities | Belongs to the protein kinase superfamily. Tyr protein kinase family. Contains 1 cadherin domain. Contains 1 protein kinase domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| Epha5 | Q60629 | 5 | EBI-5548911,EBI-1267609 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P35546-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P35546-2) Also known as: Ret9; The sequence of this isoform differs from the canonical sequence as follows: 1065-1115: MSDPNWPGESPVPLTRADGTSTGFPRYANDSVYANWMVSPSAAKLMDTFDS → RISHAFTRF |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||
Molecule processing | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 28 | 28 | Potential | ||||||||||
| Chain | 29 – 1115 | 1087 | Proto-oncogene tyrosine-protein kinase receptor Ret | PRO_0000024451 | |||||||||
| Chain | 29 – 708 | 680 | Extracellular cell-membrane anchored RET cadherin 120 kDa fragment By similarity | PRO_0000415294 | |||||||||
| Chain | 709 – 1018 | 310 | Soluble RET kinase fragment By similarity | PRO_0000415295 | |||||||||
Regions | |||||||||||||
| Topological domain | 29 – 637 | 609 | Extracellular Potential | ||||||||||
| Transmembrane | 638 – 659 | 22 | Helical; Potential | ||||||||||
| Topological domain | 660 – 1115 | 456 | Cytoplasmic Potential | ||||||||||
| Domain | 168 – 273 | 106 | Cadherin | ||||||||||
| Domain | 725 – 1017 | 293 | Protein kinase | ||||||||||
| Nucleotide binding | 731 – 739 | 9 | ATP By similarity | ||||||||||
| Region | 806 – 808 | 3 | Inhibitors binding By similarity | ||||||||||
Sites | |||||||||||||
| Active site | 875 | 1 | Proton acceptor By similarity | ||||||||||
| Binding site | 759 | 1 | ATP By similarity | ||||||||||
| Binding site | 893 | 1 | Inhibitors By similarity | ||||||||||
| Site | 708 – 709 | 2 | Cleavage; by caspase-3 By similarity | ||||||||||
| Site | 1018 – 1019 | 2 | Cleavage; by caspase-3 By similarity | ||||||||||
Amino acid modifications | |||||||||||||
| Modified residue | 697 | 1 | Phosphoserine By similarity | ||||||||||
| Modified residue | 807 | 1 | Phosphotyrosine; by autocatalysis By similarity | ||||||||||
| Modified residue | 810 | 1 | Phosphotyrosine; by autocatalysis By similarity | ||||||||||
| Modified residue | 901 | 1 | Phosphotyrosine; by autocatalysis By similarity | ||||||||||
| Modified residue | 906 | 1 | Phosphotyrosine; by autocatalysis By similarity | ||||||||||
| Modified residue | 982 | 1 | Phosphotyrosine; by autocatalysis By similarity | ||||||||||
| Modified residue | 1016 | 1 | Phosphotyrosine; by autocatalysis By similarity | ||||||||||
| Modified residue | 1063 | 1 | Phosphotyrosine; by autocatalysis Ref.11 | ||||||||||
| Modified residue | 1091 | 1 | Phosphotyrosine; by autocatalysis By similarity | ||||||||||
| Modified residue | 1097 | 1 | Phosphotyrosine; by autocatalysis By similarity | ||||||||||
| Glycosylation | 89 | 1 | N-linked (GlcNAc...) Potential | ||||||||||
| Glycosylation | 98 | 1 | N-linked (GlcNAc...) Potential | ||||||||||
| Glycosylation | 151 | 1 | N-linked (GlcNAc...) By similarity | ||||||||||
| Glycosylation | 156 | 1 | N-linked (GlcNAc...) Potential | ||||||||||
| Glycosylation | 199 | 1 | N-linked (GlcNAc...) Potential | ||||||||||
| Glycosylation | 345 | 1 | N-linked (GlcNAc...) Potential | ||||||||||
| Glycosylation | 360 | 1 | N-linked (GlcNAc...) Potential | ||||||||||
| Glycosylation | 378 | 1 | N-linked (GlcNAc...) Potential | ||||||||||
| Glycosylation | 396 | 1 | N-linked (GlcNAc...) Potential | ||||||||||
| Glycosylation | 450 | 1 | N-linked (GlcNAc...) Potential | ||||||||||
| Glycosylation | 470 | 1 | N-linked (GlcNAc...) Potential | ||||||||||
| Glycosylation | 556 | 1 | N-linked (GlcNAc...) Potential | ||||||||||
| Disulfide bond | 137 ↔ 142 | By similarity | |||||||||||
Natural variations | |||||||||||||
| Alternative sequence | 1065 – 1115 | 51 | MSDPN…DTFDS → RISHAFTRF in isoform 2. | VSP_011304 | |||||||||
Experimental info | |||||||||||||
| Mutagenesis | 1063 | 1 | Y → F: Abolishes interaction with DOK proteins. Ref.7 | ||||||||||
| Sequence conflict | 174 | 1 | F → S in CAA48013. Ref.1 | ||||||||||
Secondary structure | |||||||||||||
Helix Strand Turn | |||||||||||||
| Beta strand | 1057 – 1059 | 3 | |||||||||||
| Turn | 1061 – 1064 | 4 | |||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "cDNA cloning of mouse ret proto-oncogene and its sequence similarity to the cadherin superfamily." Iwamoto T., Taniguchi M., Asai N., Ohkusu K., Nakashima I., Takahashi M. Oncogene 8:1087-1091(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Molecular characterization of mouse neuro-2a c-ret proto-oncogene." Phua C.Y.D., Too H.P. Submitted (NOV-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Strain: A. |
| [3] | Wang Y.-Z., Yoong L.-F., Too H.-P. Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Strain: BALB/c. |
| [4] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Strain: C57BL/6J. Tissue: Spinal ganglion. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Strain: C57BL/6. Tissue: Brain. |
| [6] | "Direct association between the Ret receptor tyrosine kinase and the Src homology 2-containing adapter protein Grb7." Pandey A., Liu X., Dixon J.E., Di Fiore P.P., Dixit V.M. J. Biol. Chem. 271:10607-10610(1996) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH GRB7 AND PLCG1. |
| [7] | "Novel p62dok family members, dok-4 and dok-5, are substrates of the c-Ret receptor tyrosine kinase and mediate neuronal differentiation." Grimm J., Sachs M., Britsch S., Di Cesare S., Schwarz-Romond T., Alitalo K., Birchmeier W. J. Cell Biol. 154:345-354(2001) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH DOK2; DOK4 AND DOK5, PHOSPHORYLATION, MUTAGENESIS OF TYR-1063. |
| [8] | "Tyrosine kinase receptor RET is a key regulator of Peyer's patch organogenesis." Veiga-Fernandes H., Coles M.C., Foster K.E., Patel A., Williams A., Natarajan D., Barlow A., Pachnis V., Kioussis D. Nature 446:547-551(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN PEYER'S PATCH ORGANOGENESIS, INTERACTION WITH ARTN. |
| [9] | "RET signaling is required for survival and normal function of nonpeptidergic nociceptors." Golden J.P., Hoshi M., Nassar M.A., Enomoto H., Wood J.N., Milbrandt J., Gereau R.W. IV, Johnson E.M. Jr., Jain S. J. Neurosci. 30:3983-3994(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN NOCICEPTORS REGULATION, DISRUPTION PHENOTYPE. |
| [10] | "A novel RET inhibitor with potent efficacy against medullary thyroid cancer in vivo." Samadi A.K., Mukerji R., Shah A., Timmermann B.N., Cohen M.S. Surgery 148:1228-1236(2010) [PubMed] [Europe PMC] [Abstract] Cited for: ENZYME REGULATION. |
| [11] | "Structural basis for the specific recognition of RET by the Dok1 phosphotyrosine binding domain." Shi N., Ye S., Bartlam M., Yang M., Wu J., Liu Y., Sun F., Han X., Peng X., Qiang B., Yuan J., Rao Z. J. Biol. Chem. 279:4962-4969(2004) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.50 ANGSTROMS) OF 1055-1067, PHOSPHORYLATION AT TYR-1063. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | X67812 mRNA. Translation: CAA48013.1. AF209436 mRNA. Translation: AAF21033.1. AY326397 mRNA. Translation: AAP88379.1. AK051633 mRNA. Translation: BAC34699.1. BC059012 mRNA. Translation: AAH59012.1. | ||||||||||||
| IPI | IPI00463765. IPI00463766. | ||||||||||||
| PIR | S29926. I48735. | ||||||||||||
| RefSeq | NP_001074249.1. NM_001080780.1. NP_033076.2. NM_009050.2. | ||||||||||||
| UniGene | Mm.57199. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | P35546. | ||||||||||||
| SMR | P35546. Positions 29-273, 714-1055. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | P35546. 7 interactions. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | P35546. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | P35546. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENSMUST00000032201; ENSMUSP00000032201; ENSMUSG00000030110. ENSMUST00000088790; ENSMUSP00000086169; ENSMUSG00000030110. | ||||||||||||
| GeneID | 19713. | ||||||||||||
| KEGG | mmu:19713. | ||||||||||||
| UCSC | uc009dlm.1. mouse. uc009dln.1. mouse. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 5979. | ||||||||||||
| MGI | MGI:97902. Ret. | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | COG0515. | ||||||||||||
| GeneTree | ENSGT00670000097694. | ||||||||||||
| HOGENOM | HOG000010301. | ||||||||||||
| HOVERGEN | HBG002609. | ||||||||||||
| InParanoid | P35546. | ||||||||||||
| KO | K05126. | ||||||||||||
| OMA | TVHDYRL. | ||||||||||||
| OrthoDB | EOG4P2Q1H. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| BRENDA | 2.7.10.1. 3474. | ||||||||||||
Gene expression databases | |||||||||||||
| Bgee | P35546. | ||||||||||||
| CleanEx | MM_RET. | ||||||||||||
| Genevestigator | P35546. | ||||||||||||
| GermOnline | ENSMUSG00000030110. Mus musculus. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 2.60.40.60. 1 hit. | ||||||||||||
| InterPro | IPR002126. Cadherin. IPR015919. Cadherin-like. IPR011009. Kinase-like_dom. IPR000719. Prot_kinase_cat_dom. IPR017441. Protein_kinase_ATP_BS. IPR001245. Ser-Thr/Tyr_kinase_cat_dom. IPR008266. Tyr_kinase_AS. IPR020635. Tyr_kinase_cat_dom. IPR016249. Tyr_kinase_Ret_rcpt. [Graphical view] | ||||||||||||
| Pfam | PF00028. Cadherin. 1 hit. PF07714. Pkinase_Tyr. 1 hit. [Graphical view] | ||||||||||||
| PIRSF | PIRSF000631. TyrPK_receptor_Ret. 1 hit. | ||||||||||||
| PRINTS | PR00109. TYRKINASE. | ||||||||||||
| SMART | SM00112. CA. 1 hit. SM00219. TyrKc. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF49313. Cadherin. 1 hit. SSF56112. Kinase_like. 1 hit. | ||||||||||||
| PROSITE | PS50268. CADHERIN_2. 1 hit. PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00109. PROTEIN_KINASE_TYR. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| EvolutionaryTrace | P35546. | ||||||||||||
| NextBio | 297098. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | RET_MOUSE | ||||||||
| Accession | Primary (citable) accession number: P35546 Secondary accession number(s): Q8BQ34, Q9QXH9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
