Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P35377

- OPRX_MOUSE

UniProt

P35377 - OPRX_MOUSE

Protein

Nociceptin receptor

Gene

Oprl1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 132 (01 Oct 2014)
      Sequence version 1 (01 Jun 1994)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    G-protein coupled opioid receptor that functions as receptor for the endogenous neuropeptide nociceptin. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Signaling via G proteins mediates inhibition of adenylate cyclase activity and calcium channel activity. Arrestins modulate signaling via G proteins and mediate the activation of alternative signaling pathways that lead to the activation of MAP kinases. Plays a role in modulating nociception and the perception of pain. Plays a role in the regulation of locomotor activity by the neuropeptide nociceptin.5 Publications

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sitei107 – 1071Important for G protein-mediated signalingBy similarity
    Sitei127 – 1271Important for G protein-mediated signalingBy similarity

    GO - Molecular functioni

    1. G-protein coupled receptor activity Source: UniProtKB
    2. nociceptin receptor activity Source: UniProtKB

    GO - Biological processi

    1. adenylate cyclase-inhibiting G-protein coupled receptor signaling pathway Source: UniProtKB
    2. behavior Source: UniProtKB-KW
    3. opioid receptor signaling pathway Source: GOC
    4. positive regulation of cytosolic calcium ion concentration Source: Ensembl
    5. sensory perception of pain Source: UniProtKB

    Keywords - Molecular functioni

    G-protein coupled receptor, Receptor, Transducer

    Keywords - Biological processi

    Behavior

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Nociceptin receptor
    Alternative name(s):
    K3 opiate receptor
    Kappa-type 3 opioid receptor
    Short name:
    KOR-3
    ORGC
    Orphanin FQ receptor
    Gene namesi
    Name:Oprl1
    Synonyms:Oor, Oprl
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 2

    Organism-specific databases

    MGIiMGI:97440. Oprl1.

    Subcellular locationi

    Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle By similarity
    Note: Ligand binding leads to receptor internalization into cytoplasmic vesicles, decreasing the amount of available receptor at the cell surface. Internalization requires phosphorylation at Ser-360. Can recycle to the cell membrane By similarity.By similarity

    GO - Cellular componenti

    1. cytoplasmic membrane-bounded vesicle Source: UniProtKB-SubCell
    2. integral component of plasma membrane Source: UniProtKB

    Keywords - Cellular componenti

    Cell membrane, Cytoplasmic vesicle, Membrane

    Pathology & Biotechi

    Disruption phenotypei

    Mutant mice do not show altered basal nociception, but are no longer susceptible to modulation of nociception by the neuropeptide nociceptin. Contrary to wild-type, they do not show reduced locomotion in response to the neuropeptide nociceptin. In addition, mutant mice show subtle hearing defects.3 Publications

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 367367Nociceptin receptorPRO_0000069981Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi21 – 211N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi26 – 261N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi36 – 361N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi120 ↔ 197PROSITE-ProRule annotation
    Lipidationi331 – 3311S-palmitoyl cysteineSequence Analysis

    Post-translational modificationi

    Phosphorylation at Ser-360 requires ADRBK2.By similarity

    Keywords - PTMi

    Disulfide bond, Glycoprotein, Lipoprotein, Palmitate, Phosphoprotein

    Proteomic databases

    PRIDEiP35377.

    PTM databases

    PhosphoSiteiP35377.

    Expressioni

    Tissue specificityi

    In the brain, isoform KOR3 and isoform KOR3C are most abundant in hypothalamus and periaqueductal gray. Isoform KOR3A is highly expressed in cortex, striatum and brainstem. Isoform KOR3D is highly expressed in cerebellum, hypothalamus and brainstem. Detected in spleen lymphocytes.3 Publications

    Gene expression databases

    BgeeiP35377.
    CleanExiMM_OPRL1.
    GenevestigatoriP35377.

    Interactioni

    Structurei

    3D structure databases

    ProteinModelPortaliP35377.
    SMRiP35377. Positions 44-328.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 4545ExtracellularBy similarityAdd
    BLAST
    Topological domaini72 – 8413CytoplasmicBy similarityAdd
    BLAST
    Topological domaini107 – 12115ExtracellularBy similarityAdd
    BLAST
    Topological domaini144 – 16219CytoplasmicBy similarityAdd
    BLAST
    Topological domaini186 – 20823ExtracellularBy similarityAdd
    BLAST
    Topological domaini234 – 26128CytoplasmicBy similarityAdd
    BLAST
    Topological domaini283 – 29715ExtracellularBy similarityAdd
    BLAST
    Topological domaini320 – 36748CytoplasmicBy similarityAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei46 – 7126Helical; Name=1By similarityAdd
    BLAST
    Transmembranei85 – 10622Helical; Name=2By similarityAdd
    BLAST
    Transmembranei122 – 14322Helical; Name=3By similarityAdd
    BLAST
    Transmembranei163 – 18523Helical; Name=4By similarityAdd
    BLAST
    Transmembranei209 – 23325Helical; Name=5By similarityAdd
    BLAST
    Transmembranei262 – 28221Helical; Name=6By similarityAdd
    BLAST
    Transmembranei298 – 31922Helical; Name=7By similarityAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG299442.
    GeneTreeiENSGT00630000089574.
    HOVERGENiHBG106919.
    InParanoidiP35377.
    KOiK04216.
    OMAiVFAICIF.
    OrthoDBiEOG7BKCVQ.
    PhylomeDBiP35377.
    TreeFamiTF315737.

    Family and domain databases

    Gene3Di1.20.1070.10. 1 hit.
    InterProiIPR000276. GPCR_Rhodpsn.
    IPR017452. GPCR_Rhodpsn_7TM.
    IPR001418. Opioid_rcpt.
    IPR001420. X_opioid_rcpt.
    [Graphical view]
    PfamiPF00001. 7tm_1. 1 hit.
    [Graphical view]
    PRINTSiPR00237. GPCRRHODOPSN.
    PR00384. OPIOIDR.
    PR00547. XOPIOIDR.
    PROSITEiPS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
    PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
    [Graphical view]

    Sequences (6)i

    Sequence statusi: Complete.

    This entry describes 6 isoformsi produced by alternative splicing. Align

    Isoform KOR3 (identifier: P35377-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MESLFPAPFW EVLYGSHFQG NLSLLNETVP HHLLLNASHS AFLPLGLKVT    50
    IVGLYLAVCI GGLLGNCLVM YVILRHTKMK TATNIYIFNL ALADTLVLLT 100
    LPFQGTDILL GFWPFGNALC KTVIAIDYYN MFTSTFTLTA MSVDRYVAIC 150
    HPIRALDVRT SSKAQAVNVA IWALASVVGV PVAIMGSAQV EDEEIECLVE 200
    IPAPQDYWGP VFAICIFLFS FIIPVLIISV CYSLMIRRLR GVRLLSGSRE 250
    KDRNLRRITR LVLVVVAVFV GCWTPVQVFV LVQGLGVQPG SETAVAILRF 300
    CTALGYVNSC LNPILYAFLD ENFKACFRKF CCASALHREM QVSDRVRSIA 350
    KDVGLGCKTS ETVPRPA 367
    Length:367
    Mass (Da):40,491
    Last modified:June 1, 1994 - v1
    Checksum:iE498CA9FE5276026
    GO
    Isoform KOR3A (identifier: P35377-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         75-99: RHTKMKTATNIYIFNLALADTLVLL → SWEGIEGNWRQQAHQDEDCYQHLHI
         100-367: Missing.

    Show »
    Length:99
    Mass (Da):11,129
    Checksum:i9165BB34BB5CFC80
    GO
    Isoform KOR3B (identifier: P35377-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         76-111: HTKMKTATNIYIFNLALADTLVLLTLPFQGTDILLG → QCPENPLRGVLRETEERRQHLSLLIPSTNSHSGTPR
         112-367: Missing.

    Show »
    Length:111
    Mass (Da):12,314
    Checksum:i3901CF41856A774F
    GO
    Isoform KOR3C (identifier: P35377-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         76-95: HTKMKTATNIYIFNLALADT → QHCALGRSLMNFTGSALKTL
         96-367: Missing.

    Show »
    Length:95
    Mass (Da):10,353
    Checksum:i0E495CD1381489CC
    GO
    Isoform KOR3D (identifier: P35377-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         71-75: Missing.

    Show »
    Length:362
    Mass (Da):39,846
    Checksum:i8B9A7C66E35E3A3D
    GO
    Isoform KOR3E (identifier: P35377-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         194-213: EIECLVEIPAPQDYWGPVFA → GQWAVLLPDQSVPHGSCRPL
         214-367: Missing.

    Show »
    Length:213
    Mass (Da):23,205
    Checksum:i0444B4CFD7DB4751
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti348 – 3492SI → TV in AAA81333. (PubMed:7802669)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei71 – 755Missing in isoform KOR3D. 1 PublicationVSP_001898
    Alternative sequencei75 – 9925RHTKM…TLVLL → SWEGIEGNWRQQAHQDEDCY QHLHI in isoform KOR3A. 1 PublicationVSP_001899Add
    BLAST
    Alternative sequencei76 – 11136HTKMK…DILLG → QCPENPLRGVLRETEERRQH LSLLIPSTNSHSGTPR in isoform KOR3B. 1 PublicationVSP_001903Add
    BLAST
    Alternative sequencei76 – 9520HTKMK…ALADT → QHCALGRSLMNFTGSALKTL in isoform KOR3C. 1 PublicationVSP_001901Add
    BLAST
    Alternative sequencei96 – 367272Missing in isoform KOR3C. 1 PublicationVSP_001902Add
    BLAST
    Alternative sequencei100 – 367268Missing in isoform KOR3A. 1 PublicationVSP_001900Add
    BLAST
    Alternative sequencei112 – 367256Missing in isoform KOR3B. 1 PublicationVSP_001904Add
    BLAST
    Alternative sequencei194 – 21320EIECL…GPVFA → GQWAVLLPDQSVPHGSCRPL in isoform KOR3E. 1 PublicationVSP_001905Add
    BLAST
    Alternative sequencei214 – 367154Missing in isoform KOR3E. 1 PublicationVSP_001906Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U04952 mRNA. Translation: AAA03730.1.
    D31667 Genomic DNA. Translation: BAA06509.1.
    X91813 mRNA. Translation: CAA62922.1.
    U32932, U32928, U32930 Genomic DNA. Translation: AAC52669.1.
    U09421 mRNA. Translation: AAA81333.1.
    AF043276 mRNA. Translation: AAC64507.1.
    AF043277 mRNA. Translation: AAC64508.1.
    AF043278 mRNA. Translation: AAC64509.1.
    AF062381 mRNA. Translation: AAF21258.1.
    AF075605 mRNA. Translation: AAF21781.1.
    AF126469 mRNA. Translation: AAL54889.1.
    BC050885 mRNA. Translation: AAH50885.1.
    U14165 mRNA. Translation: AAA87899.1.
    CCDSiCCDS17222.1. [P35377-1]
    PIRiI49022.
    JC2421.
    RefSeqiNP_001239494.1. NM_001252565.1. [P35377-1]
    NP_035142.1. NM_011012.5. [P35377-1]
    XP_006500645.1. XM_006500582.1. [P35377-5]
    UniGeneiMm.285075.

    Genome annotation databases

    EnsembliENSMUST00000071585; ENSMUSP00000071513; ENSMUSG00000027584. [P35377-1]
    ENSMUST00000108766; ENSMUSP00000104397; ENSMUSG00000027584. [P35377-6]
    ENSMUST00000108767; ENSMUSP00000104398; ENSMUSG00000027584. [P35377-1]
    ENSMUST00000108768; ENSMUSP00000104399; ENSMUSG00000027584. [P35377-1]
    ENSMUST00000183693; ENSMUSP00000138810; ENSMUSG00000027584. [P35377-4]
    ENSMUST00000184127; ENSMUSP00000139119; ENSMUSG00000027584. [P35377-3]
    GeneIDi18389.
    KEGGimmu:18389.
    UCSCiuc008onj.2. mouse. [P35377-1]
    uc008ono.1. mouse. [P35377-5]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U04952 mRNA. Translation: AAA03730.1 .
    D31667 Genomic DNA. Translation: BAA06509.1 .
    X91813 mRNA. Translation: CAA62922.1 .
    U32932 , U32928 , U32930 Genomic DNA. Translation: AAC52669.1 .
    U09421 mRNA. Translation: AAA81333.1 .
    AF043276 mRNA. Translation: AAC64507.1 .
    AF043277 mRNA. Translation: AAC64508.1 .
    AF043278 mRNA. Translation: AAC64509.1 .
    AF062381 mRNA. Translation: AAF21258.1 .
    AF075605 mRNA. Translation: AAF21781.1 .
    AF126469 mRNA. Translation: AAL54889.1 .
    BC050885 mRNA. Translation: AAH50885.1 .
    U14165 mRNA. Translation: AAA87899.1 .
    CCDSi CCDS17222.1. [P35377-1 ]
    PIRi I49022.
    JC2421.
    RefSeqi NP_001239494.1. NM_001252565.1. [P35377-1 ]
    NP_035142.1. NM_011012.5. [P35377-1 ]
    XP_006500645.1. XM_006500582.1. [P35377-5 ]
    UniGenei Mm.285075.

    3D structure databases

    ProteinModelPortali P35377.
    SMRi P35377. Positions 44-328.
    ModBasei Search...
    MobiDBi Search...

    Chemistry

    BindingDBi P35377.
    ChEMBLi CHEMBL3621.
    GuidetoPHARMACOLOGYi 320.

    Protein family/group databases

    GPCRDBi Search...

    PTM databases

    PhosphoSitei P35377.

    Proteomic databases

    PRIDEi P35377.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000071585 ; ENSMUSP00000071513 ; ENSMUSG00000027584 . [P35377-1 ]
    ENSMUST00000108766 ; ENSMUSP00000104397 ; ENSMUSG00000027584 . [P35377-6 ]
    ENSMUST00000108767 ; ENSMUSP00000104398 ; ENSMUSG00000027584 . [P35377-1 ]
    ENSMUST00000108768 ; ENSMUSP00000104399 ; ENSMUSG00000027584 . [P35377-1 ]
    ENSMUST00000183693 ; ENSMUSP00000138810 ; ENSMUSG00000027584 . [P35377-4 ]
    ENSMUST00000184127 ; ENSMUSP00000139119 ; ENSMUSG00000027584 . [P35377-3 ]
    GeneIDi 18389.
    KEGGi mmu:18389.
    UCSCi uc008onj.2. mouse. [P35377-1 ]
    uc008ono.1. mouse. [P35377-5 ]

    Organism-specific databases

    CTDi 4987.
    MGIi MGI:97440. Oprl1.

    Phylogenomic databases

    eggNOGi NOG299442.
    GeneTreei ENSGT00630000089574.
    HOVERGENi HBG106919.
    InParanoidi P35377.
    KOi K04216.
    OMAi VFAICIF.
    OrthoDBi EOG7BKCVQ.
    PhylomeDBi P35377.
    TreeFami TF315737.

    Miscellaneous databases

    ChiTaRSi OPRL1. mouse.
    NextBioi 293984.
    PROi P35377.
    SOURCEi Search...

    Gene expression databases

    Bgeei P35377.
    CleanExi MM_OPRL1.
    Genevestigatori P35377.

    Family and domain databases

    Gene3Di 1.20.1070.10. 1 hit.
    InterProi IPR000276. GPCR_Rhodpsn.
    IPR017452. GPCR_Rhodpsn_7TM.
    IPR001418. Opioid_rcpt.
    IPR001420. X_opioid_rcpt.
    [Graphical view ]
    Pfami PF00001. 7tm_1. 1 hit.
    [Graphical view ]
    PRINTSi PR00237. GPCRRHODOPSN.
    PR00384. OPIOIDR.
    PR00547. XOPIOIDR.
    PROSITEi PS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
    PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Yasuda K., Jones E., Reisine T., Bell G.I.
      Submitted (JAN-1994) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE (ISOFORM KOR3).
      Strain: C57BL/6N.
      Tissue: Brain.
    2. "Structure and chromosomal mapping of genes for the mouse kappa-opioid receptor and an opioid receptor homologue (MOR-C)."
      Nishi M., Takeshima H., Mori M., Nakagawara K., Takeuchi T.
      Biochem. Biophys. Res. Commun. 205:1353-1357(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM KOR3).
    3. "Functional selectivity of orphanin FQ for its receptor coexpressed with potassium channel subunits in Xenopus laevis oocytes."
      Matthes H.W.D., Seward E.P., Kieffer B., North R.A.
      Mol. Pharmacol. 50:447-450(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM KOR3), FUNCTION, SUBCELLULAR LOCATION.
      Tissue: Brain.
    4. Pan Y.-X., Xu J., Pasternak G.W.
      Submitted (JUL-1996) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE (ISOFORM KOR3).
    5. "Cloning and functional characterization through antisense mapping of a kappa 3-related opioid receptor."
      Pan Y.-X., Cheng J., Xu J., Rossi G., Jacobson E., Ryan-Moro J., Brooks A.I., Dean G.E., Standifer K.M., Pasternak G.W.
      Mol. Pharmacol. 47:1180-1188(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM KOR3), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    6. "Identification and differential regional expression of KOR-3/ORL-1 gene splice variants in mouse brain."
      Pan Y.-X., Xu J., Wan B.-L., Zuckerman A., Pasternak G.W.
      FEBS Lett. 435:65-68(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS KOR3A; KOR3B; KOR3C; KOR3D AND KOR3E), TISSUE SPECIFICITY.
      Strain: C57BL/6.
      Tissue: Brain.
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM KOR3).
      Strain: C57BL/6.
      Tissue: Brain.
    8. "Functional role and sequence analysis of a lymphocyte orphan opioid receptor."
      Halford W.P., Gebhardt B.M., Carr D.J.J.
      J. Neuroimmunol. 59:91-101(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-357 (ISOFORM KOR3), TISSUE SPECIFICITY.
      Strain: BALB/c.
      Tissue: Spleen.
    9. "Unrestrained nociceptive response and disregulation of hearing ability in mice lacking the nociceptin/orphaninFQ receptor."
      Nishi M., Houtani T., Noda Y., Mamiya T., Sato K., Doi T., Kuno J., Takeshima H., Nukada T., Nabeshima T., Yamashita T., Noda T., Sugimoto T.
      EMBO J. 16:1858-1864(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: DISRUPTION PHENOTYPE.
    10. "Lack of the nociceptin receptor does not affect acute or chronic nociception in mice."
      Bertorelli R., Bastia E., Citterio F., Corradini L., Forlani A., Ongini E.
      Peptides 23:1589-1596(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: DISRUPTION PHENOTYPE, FUNCTION.
    11. "Normal sensitivity to acute pain, but increased inflammatory hyperalgesia in mice lacking the nociceptin precursor polypeptide or the nociceptin receptor."
      Depner U.B., Reinscheid R.K., Takeshima H., Brune K., Zeilhofer H.U.
      Eur. J. Neurosci. 17:2381-2387(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: DISRUPTION PHENOTYPE, FUNCTION.
    12. "Effects of spinally administered bifunctional nociceptin/orphanin FQ peptide receptor/mu-opioid receptor ligands in mouse models of neuropathic and inflammatory pain."
      Sukhtankar D.D., Zaveri N.T., Husbands S.M., Ko M.C.
      J. Pharmacol. Exp. Ther. 346:11-22(2013) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.

    Entry informationi

    Entry nameiOPRX_MOUSE
    AccessioniPrimary (citable) accession number: P35377
    Secondary accession number(s): Q60645
    , Q8VI74, Q9QUT5, Q9Z2M8, Q9Z2M9, Q9Z2N0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 1, 1994
    Last sequence update: June 1, 1994
    Last modified: October 1, 2014
    This is version 132 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. 7-transmembrane G-linked receptors
      List of 7-transmembrane G-linked receptor entries
    2. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3