P35377 (OPRX_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 121.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Nociceptin receptor Alternative name(s): K3 opiate receptor Kappa-type 3 opioid receptor Short name=KOR-3 ORGC Orphanin FQ receptor | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 367 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Receptor for the neuropeptide nociceptin/orphanin FQ. Has a potential role in modulating a number of brain functions, including instinctive behaviors and emotions. The activity of this receptor is mediated by G proteins which inhibits adenylyl cyclase. |
| Subcellular location | |
| Tissue specificity | In the brain, isoform KOR3 and isoform KOR3C are most abundant in hypothalamus and periaqueductal gray. Isoform KOR3A is highly expressed in cortex, striatum and brainstem. Isoform KOR3D is highly expressed in cerebellum, hypothalamus and brainstem. Ref.6 |
| Sequence similarities | Belongs to the G-protein coupled receptor 1 family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Transmembrane Transmembrane helix |
| Molecular function | G-protein coupled receptor Receptor Transducer |
| PTM | Disulfide bond Glycoprotein Lipoprotein Palmitate |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | elevation of cytosolic calcium ion concentration Inferred from electronic annotation. Source: Compara opioid receptor signaling pathwayInferred from electronic annotation. Source: GOC |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW plasma membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | nociceptin receptor activity Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform KOR3 (identifier: P35377-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform KOR3A (identifier: P35377-2) The sequence of this isoform differs from the canonical sequence as follows: 75-99: RHTKMKTATNIYIFNLALADTLVLL → SWEGIEGNWRQQAHQDEDCYQHLHI 100-367: Missing. | ||||||
| Isoform KOR3B (identifier: P35377-3) The sequence of this isoform differs from the canonical sequence as follows: 76-111: HTKMKTATNIYIFNLALADTLVLLTLPFQGTDILLG → QCPENPLRGVLRETEERRQHLSLLIPSTNSHSGTPR 112-367: Missing. | ||||||
| Isoform KOR3C (identifier: P35377-4) The sequence of this isoform differs from the canonical sequence as follows: 76-95: HTKMKTATNIYIFNLALADT → QHCALGRSLMNFTGSALKTL 96-367: Missing. | ||||||
| Isoform KOR3D (identifier: P35377-5) The sequence of this isoform differs from the canonical sequence as follows: 71-75: Missing. | ||||||
| Isoform KOR3E (identifier: P35377-6) The sequence of this isoform differs from the canonical sequence as follows: 194-213: EIECLVEIPAPQDYWGPVFA → GQWAVLLPDQSVPHGSCRPL 214-367: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 367 | 367 | Nociceptin receptor | PRO_0000069981 | |||||||
Regions | |||||||||||
| Topological domain | 1 – 47 | 47 | Extracellular Potential | ||||||||
| Transmembrane | 48 – 74 | 27 | Helical; Name=1; Potential | ||||||||
| Topological domain | 75 – 84 | 10 | Cytoplasmic Potential | ||||||||
| Transmembrane | 85 – 106 | 22 | Helical; Name=2; Potential | ||||||||
| Topological domain | 107 – 121 | 15 | Extracellular Potential | ||||||||
| Transmembrane | 122 – 143 | 22 | Helical; Name=3; Potential | ||||||||
| Topological domain | 144 – 162 | 19 | Cytoplasmic Potential | ||||||||
| Transmembrane | 163 – 185 | 23 | Helical; Name=4; Potential | ||||||||
| Topological domain | 186 – 208 | 23 | Extracellular Potential | ||||||||
| Transmembrane | 209 – 233 | 25 | Helical; Name=5; Potential | ||||||||
| Topological domain | 234 – 261 | 28 | Cytoplasmic Potential | ||||||||
| Transmembrane | 262 – 285 | 24 | Helical; Name=6; Potential | ||||||||
| Topological domain | 286 – 297 | 12 | Extracellular Potential | ||||||||
| Transmembrane | 298 – 319 | 22 | Helical; Name=7; Potential | ||||||||
| Topological domain | 320 – 367 | 48 | Cytoplasmic Potential | ||||||||
Amino acid modifications | |||||||||||
| Lipidation | 331 | 1 | S-palmitoyl cysteine Potential | ||||||||
| Glycosylation | 21 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 26 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 36 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 120 ↔ 197 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 71 – 75 | 5 | Missing in isoform KOR3D. | VSP_001898 | |||||||
| Alternative sequence | 75 – 99 | 25 | RHTKM…TLVLL → SWEGIEGNWRQQAHQDEDCY QHLHI in isoform KOR3A. | VSP_001899 | |||||||
| Alternative sequence | 76 – 111 | 36 | HTKMK…DILLG → QCPENPLRGVLRETEERRQH LSLLIPSTNSHSGTPR in isoform KOR3B. | VSP_001903 | |||||||
| Alternative sequence | 76 – 95 | 20 | HTKMK…ALADT → QHCALGRSLMNFTGSALKTL in isoform KOR3C. | VSP_001901 | |||||||
| Alternative sequence | 96 – 367 | 272 | Missing in isoform KOR3C. | VSP_001902 | |||||||
| Alternative sequence | 100 – 367 | 268 | Missing in isoform KOR3A. | VSP_001900 | |||||||
| Alternative sequence | 112 – 367 | 256 | Missing in isoform KOR3B. | VSP_001904 | |||||||
| Alternative sequence | 194 – 213 | 20 | EIECL…GPVFA → GQWAVLLPDQSVPHGSCRPL in isoform KOR3E. | VSP_001905 | |||||||
| Alternative sequence | 214 – 367 | 154 | Missing in isoform KOR3E. | VSP_001906 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 348 – 349 | 2 | SI → TV in AAA81333. Ref.2 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | Yasuda K., Jones E., Reisine T., Bell G.I. Submitted (JAN-1994) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE (ISOFORM KOR3). Strain: C57BL/6N. Tissue: Brain. |
| [2] | "Structure and chromosomal mapping of genes for the mouse kappa-opioid receptor and an opioid receptor homologue (MOR-C)." Nishi M., Takeshima H., Mori M., Nakagawara K., Takeuchi T. Biochem. Biophys. Res. Commun. 205:1353-1357(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM KOR3). |
| [3] | "Functional selectivity of orphanin FQ for its receptor coexpressed with potassium channel subunits in Xenopus laevis oocytes." Matthes H.W.D., Seward E.P., Kieffer B., North R.A. Mol. Pharmacol. 50:447-450(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM KOR3). Tissue: Brain. |
| [4] | Pan Y.-X., Xu J., Pasternak G.W. Submitted (JUL-1996) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE (ISOFORM KOR3). |
| [5] | "Cloning and functional characterization through antisense mapping of a kappa 3-related opioid receptor." Pan Y.-X., Cheng J., Xu J., Rossi G., Jacobson E., Ryan-Moro J., Brooks A.I., Dean G.E., Standifer K.M., Pasternak G.W. Mol. Pharmacol. 47:1180-1188(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM KOR3). |
| [6] | "Identification and differential regional expression of KOR-3/ORL-1 gene splice variants in mouse brain." Pan Y.-X., Xu J., Wan B.-L., Zuckerman A., Pasternak G.W. FEBS Lett. 435:65-68(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS KOR3A; KOR3B; KOR3C; KOR3D AND KOR3E), TISSUE SPECIFICITY. Strain: C57BL/6. Tissue: Brain. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM KOR3). Strain: C57BL/6. Tissue: Brain. |
| [8] | "Functional role and sequence analysis of a lymphocyte orphan opioid receptor." Halford W.P., Gebhardt B.M., Carr D.J.J. J. Neuroimmunol. 59:91-101(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-357 (ISOFORM KOR3). Strain: BALB/c. Tissue: Spleen. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U04952 mRNA. Translation: AAA03730.1. D31667 Genomic DNA. Translation: BAA06509.1. X91813 mRNA. Translation: CAA62922.1. U32932, U32928, U32930 Genomic DNA. Translation: AAC52669.1. U09421 mRNA. Translation: AAA81333.1. AF043276 mRNA. Translation: AAC64507.1. AF043277 mRNA. Translation: AAC64508.1. AF043278 mRNA. Translation: AAC64509.1. AF062381 mRNA. Translation: AAF21258.1. AF075605 mRNA. Translation: AAF21781.1. AF126469 mRNA. Translation: AAL54889.1. BC050885 mRNA. Translation: AAH50885.1. U14165 mRNA. Translation: AAA87899.1. |
| IPI | IPI00117529. IPI00225779. IPI00225780. IPI00225781. IPI00225783. IPI00378023. |
| PIR | I49022. JC2421. |
| RefSeq | NP_001239494.1. NM_001252565.1. NP_035142.1. NM_011012.5. |
| UniGene | Mm.285075. |
3D structure databases | |
| ProteinModelPortal | P35377. |
| SMR | P35377. Positions 44-328. |
| ModBase | Search... |
Protein family/group databases | |
| GPCRDB | Search... |
PTM databases | |
| PhosphoSite | P35377. |
Proteomic databases | |
| PRIDE | P35377. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000071585; ENSMUSP00000071513; ENSMUSG00000027584. ENSMUST00000108766; ENSMUSP00000104397; ENSMUSG00000027584. ENSMUST00000108767; ENSMUSP00000104398; ENSMUSG00000027584. ENSMUST00000108768; ENSMUSP00000104399; ENSMUSG00000027584. |
| GeneID | 18389. |
| KEGG | mmu:18389. |
| UCSC | uc008onj.2. mouse. uc008ono.1. mouse. |
Organism-specific databases | |
| CTD | 4987. |
| MGI | MGI:97440. Oprl1. |
Phylogenomic databases | |
| eggNOG | NOG299442. |
| GeneTree | ENSGT00630000089574. |
| HOVERGEN | HBG106919. |
| InParanoid | P35377. |
| KO | K04216. |
| OMA | VFAICIF. |
| OrthoDB | EOG4Z62NR. |
Gene expression databases | |
| ArrayExpress | P35377. |
| Bgee | P35377. |
| CleanEx | MM_OPRL1. |
| Genevestigator | P35377. |
| GermOnline | ENSMUSG00000027584. Mus musculus. |
Family and domain databases | |
| InterPro | IPR000276. GPCR_Rhodpsn. IPR017452. GPCR_Rhodpsn_7TM. IPR001418. Opioid_rcpt. IPR001420. X_opioid_rcpt. [Graphical view] |
| Pfam | PF00001. 7tm_1. 1 hit. [Graphical view] |
| PRINTS | PR00237. GPCRRHODOPSN. PR00384. OPIOIDR. PR00547. XOPIOIDR. |
| PROSITE | PS00237. G_PROTEIN_RECEP_F1_1. 1 hit. PS50262. G_PROTEIN_RECEP_F1_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | P35377. |
| ChEMBL | CHEMBL3621. |
| ChiTaRS | OPRL1. mouse. |
| NextBio | 293984. |
| SOURCE | Search... |
Entry information
| Entry name | OPRX_MOUSE | ||||||||
| Accession | Primary (citable) accession number: P35377 Secondary accession number(s): Q60645 Q9Z2N0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| 7-transmembrane G-linked receptors List of 7-transmembrane G-linked receptor entries |
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
