P35372 (OPRM_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 119.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Mu-type opioid receptor Short name=M-OR-1 Short name=MOR-1 Alternative name(s): Mu opiate receptor Mu opioid receptor Short name=MOP Short name=hMOP | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 400 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Inhibits neurotransmitter release by reducing calcium ion currents and increasing potassium ion conductance. Receptor for beta-endorphin. |
| Subunit structure | Forms a complex with G(alpha)z/i2 subunits and the RGSZ proteins, RGSZ17 and RGSZ20. The formation of this complex results in mu-opioid receptor desensitization. Interacts with RGSZ17 and RGSZ20 By similarity. The C-terminal tail interacts with the C-terminal section of DNAJB4. Ref.17 |
| Subcellular location | |
| Polymorphism | Variant Asp-40 does not show altered binding affinities for most opioid peptides and alkaloids tested, but it binds beta-endorphin, an endogenous opioid that activates the mu opioid receptor, approximately 3 times more tightly than the most common allelic form. |
| Sequence similarities | Belongs to the G-protein coupled receptor 1 family. |
| Sequence caution | The sequence CAI20458.1 differs from that shown. Reason: Erroneous initiation. The sequence EAW47705.1 differs from that shown. Reason: Erroneous initiation. Isoform 9: The sequence AAQ77392.1 differs from that shown. Reason: a polymorphism leading to premature termination of translation (position: 411:Q->Stop) |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transmembrane Transmembrane helix |
| Molecular function | G-protein coupled receptor Receptor Transducer |
| PTM | Disulfide bond Glycoprotein Lipoprotein Palmitate Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Uncategorized | mu-opioid receptor activity Traceable author statement. Source: ProtInc |
| Biological process | negative regulation of cell proliferation Traceable author statement. Source: ProtInc sensory perceptionTraceable author statement. Source: ProtInc |
| Cellular component | Golgi apparatus Traceable author statement. Source: ProtInc endoplasmic reticulumTraceable author statement. Source: ProtInc integral to plasma membraneTraceable author statement. Source: ProtInc |
| Molecular function | opioid receptor activity Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 11 isoforms produced by alternative splicing. [Align] [Select] | |||||||||
| Isoform 1 (identifier: P35372-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | |||||||||
| Isoform 2 (identifier: P35372-2) Also known as: MOR1A; MOR-1A; The sequence of this isoform differs from the canonical sequence as follows: 389-400: LENLEAETAPLP → VRSL | |||||||||
| Isoform 3 (identifier: P35372-3) Also known as: MOR-1R; The sequence of this isoform differs from the canonical sequence as follows: 389-400: LENLEAETAPLP → CLPIPSLSCWALEQGCLVVYPGPLQGPLVRYDLPAILHSSCLRGNTAPSPSGGAFLLS | |||||||||
Sequence annotation (Features) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
| Sequence conflict | 402 | 1 | Q → H in AAK74189. Ref.4 | ||||||
| Isoform 4 (identifier: P35372-4) Also known as: MOR-1B3; The sequence of this isoform differs from the canonical sequence as follows: 389-400: LENLEAETAPLP → GPPAKFVADQLAGSS | |||||||||
| Isoform 5 (identifier: P35372-5) Also known as: MOR-1C; The sequence of this isoform differs from the canonical sequence as follows: 389-400: LENLEAETAPLP → PPLAVSMAQIFTRYPPPTHREKTCNDYMKR | |||||||||
| Isoform 6 (identifier: P35372-6) Also known as: MOR-1V; MOR-1Y; The sequence of this isoform differs from the canonical sequence as follows: 389-400: LENLEAETAPLP → IRDPISNLPRVSVF | |||||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | |||||||||
| Isoform 7 (identifier: P35372-7) Also known as: MOR-1B1; The sequence of this isoform differs from the canonical sequence as follows: 389-400: LENLEAETAPLP → KIDLFQKSSLLNCEHTKG | |||||||||
| Isoform 8 (identifier: P35372-8) Also known as: MOR-1B2; The sequence of this isoform differs from the canonical sequence as follows: 389-400: LENLEAETAPLP → RERRQKSDW | |||||||||
| Isoform 9 (identifier: P35372-9) Also known as: MOR-1B5; The sequence of this isoform differs from the canonical sequence as follows: 389-400: LENLEAETAPLP → VELNLDCHCENAKPWPLSYNAGQSPFPFPGRV | |||||||||
| Isoform 10 (identifier: P35372-10) Also known as: MOR-1H; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MCLHRRVPSE...SGARPAVSTM | |||||||||
| Isoform 11 (identifier: P35372-11) Also known as: MOR-1B4; The sequence of this isoform differs from the canonical sequence as follows: 389-400: LENLEAETAPLP → S | |||||||||
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 400 | 400 | Mu-type opioid receptor | PRO_0000069972 | |||||||
Regions | |||||||||||
| Topological domain | 1 – 66 | 66 | Extracellular Potential | ||||||||
| Transmembrane | 67 – 96 | 30 | Helical; Name=1; Potential | ||||||||
| Topological domain | 97 – 105 | 9 | Cytoplasmic Potential | ||||||||
| Transmembrane | 106 – 123 | 18 | Helical; Name=2; Potential | ||||||||
| Topological domain | 124 – 145 | 22 | Extracellular Potential | ||||||||
| Transmembrane | 146 – 165 | 20 | Helical; Name=3; Potential | ||||||||
| Topological domain | 166 – 195 | 30 | Cytoplasmic Potential | ||||||||
| Transmembrane | 196 – 211 | 16 | Helical; Name=4; Potential | ||||||||
| Topological domain | 212 – 236 | 25 | Extracellular Potential | ||||||||
| Transmembrane | 237 – 259 | 23 | Helical; Name=5; Potential | ||||||||
| Topological domain | 260 – 282 | 23 | Cytoplasmic Potential | ||||||||
| Transmembrane | 283 – 305 | 23 | Helical; Name=6; Potential | ||||||||
| Topological domain | 306 – 313 | 8 | Extracellular Potential | ||||||||
| Transmembrane | 314 – 330 | 17 | Helical; Name=7; Potential | ||||||||
| Topological domain | 331 – 400 | 70 | Cytoplasmic Potential | ||||||||
Amino acid modifications | |||||||||||
| Lipidation | 353 | 1 | S-palmitoyl cysteine Potential | ||||||||
| Glycosylation | 9 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 12 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 33 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 40 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 48 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 142 ↔ 219 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 | 1 | M → MCLHRRVPSEETYSLDRFAQ NPPLFPPPSLPASESRMAHA PLLQRCGAARTGFCKKQQEL WQRRKEAAEALGTRKVSVLL ATSHSGARPAVSTM in isoform 10. | VSP_037693 | |||||||
| Alternative sequence | 389 – 400 | 12 | LENLE…TAPLP → S in isoform 11. | VSP_037694 | |||||||
| Alternative sequence | 389 – 400 | 12 | LENLE…TAPLP → VRSL in isoform 2. | VSP_001896 | |||||||
| Alternative sequence | 389 – 400 | 12 | LENLE…TAPLP → CLPIPSLSCWALEQGCLVVY PGPLQGPLVRYDLPAILHSS CLRGNTAPSPSGGAFLLS in isoform 3. | VSP_037695 | |||||||
| Alternative sequence | 389 – 400 | 12 | LENLE…TAPLP → GPPAKFVADQLAGSS in isoform 4. | VSP_037696 | |||||||
| Alternative sequence | 389 – 400 | 12 | LENLE…TAPLP → PPLAVSMAQIFTRYPPPTHR EKTCNDYMKR in isoform 5. | VSP_037697 | |||||||
| Alternative sequence | 389 – 400 | 12 | LENLE…TAPLP → IRDPISNLPRVSVF in isoform 6. | VSP_037698 | |||||||
| Alternative sequence | 389 – 400 | 12 | LENLE…TAPLP → KIDLFQKSSLLNCEHTKG in isoform 7. | VSP_037699 | |||||||
| Alternative sequence | 389 – 400 | 12 | LENLE…TAPLP → RERRQKSDW in isoform 8. | VSP_037700 | |||||||
| Alternative sequence | 389 – 400 | 12 | LENLE…TAPLP → VELNLDCHCENAKPWPLSYN AGQSPFPFPGRV in isoform 9. | VSP_037701 | |||||||
| Natural variant | 6 | 1 | A → V. Ref.10 Ref.14 Ref.18 Ref.19 Corresponds to variant rs1799972 [ dbSNP | Ensembl ]. | VAR_009525 | |||||||
| Natural variant | 40 | 1 | N → D in 10% of the population. Ref.2 Ref.10 Ref.18 Ref.19 Corresponds to variant rs1799971 [ dbSNP | Ensembl ]. | VAR_009524 | |||||||
| Natural variant | 63 | 1 | G → V. Corresponds to variant rs9282817 [ dbSNP | Ensembl ]. | VAR_049426 | |||||||
| Natural variant | 66 | 1 | S → F. Corresponds to variant rs9282819 [ dbSNP | Ensembl ]. | VAR_049427 | |||||||
| Natural variant | 147 | 1 | S → C Rare polymorphism. Ref.10 Ref.18 Corresponds to variant rs17174794 [ dbSNP | Ensembl ]. | VAR_009526 | |||||||
| Natural variant | 152 | 1 | N → D. Ref.10 Corresponds to variant rs17174801 [ dbSNP | Ensembl ]. | VAR_019252 | |||||||
| Natural variant | 260 | 1 | R → H Rare polymorphism. Ref.19 Corresponds to variant rs1799974 [ dbSNP | Ensembl ]. | VAR_009527 | |||||||
| Natural variant | 265 | 1 | R → C. Ref.10 Corresponds to variant rs17174822 [ dbSNP | Ensembl ]. | VAR_019253 | |||||||
| Natural variant | 274 | 1 | D → N. Ref.10 Corresponds to variant rs17174829 [ dbSNP | Ensembl ]. | VAR_019254 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 26 | 1 | P → L in BAG36624. Ref.8 | ||||||||
| Sequence conflict | 51 | 1 | D → N in AAA20580. Ref.1 | ||||||||
| Sequence conflict | 109 | 1 | I → V in AAQ77391. Ref.5 | ||||||||
| Sequence conflict | 207 | 1 | M → I in AAB60354. Ref.2 | ||||||||
| Sequence conflict | 234 | 1 | L → V in AAA20580. Ref.1 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Human mu opiate receptor. cDNA and genomic clones, pharmacologic characterization and chromosomal assignment." Wang J.-B., Johnson P.S., Persico A.M., Hawkins A.L., Griffin C.A., Uhl G.R. FEBS Lett. 338:217-222(1994) [PubMed: 7905839] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Brain. |
| [2] | "Expression of two variants of the human mu opioid receptor mRNA in SK-N-SH cells and human brain." Bare L.A., Mansson E., Yang D. FEBS Lett. 354:213-216(1994) [PubMed: 7957926] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), VARIANT ASP-40. Tissue: Brain. |
| [3] | "The human mu opioid receptor: modulation of functional desensitization by calcium/calmodulin-dependent protein kinase and protein kinase C." Mestek A. Jr., Hurley J.H., Bye L.S., Campbell A.D., Chen Y., Tian M., Liu J., Schulman H., Yu L. J. Neurosci. 15:2396-2406(1995) [PubMed: 7891175] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Brain. |
| [4] | "Identification and characterization of two new human mu opioid receptor splice variants, hMOR-1O and hMOR-1X." Pan Y.X., Xu J., Mahurter L., Xu M., Gilbert A.K., Pasternak G.W. Biochem. Biophys. Res. Commun. 301:1057-1061(2003) [PubMed: 12589820] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3 AND 5). |
| [5] | "Identification and characterization of six new alternatively spliced variants of the human mu opioid receptor gene, Oprm." Pan L., Xu J., Yu R., Xu M.-M., Pan Y.-X., Pasternak G.W. Neuroscience 133:209-220(2005) [PubMed: 15893644] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 4; 6; 7; 8; 9 AND 11). |
| [6] | "Isolation and characterization of new exon 11-associated N-terminal splice variants of the human mu opioid receptor gene." Xu J., Xu M., Hurd Y.L., Pasternak G.W., Pan Y.X. J. Neurochem. 108:962-972(2009) [PubMed: 19077058] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 10). |
| [7] | "Novel variants of the human mu opioid receptor are generated by alternative splicing and transcription from different positions in the OPRM1 gene." Baar C., Kvam T.-M., Rakvag T.T., Kaasa S., Skorpen F. Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 6). Tissue: Brain. |
| [8] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [9] | "cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org)." Kopatz S.A., Aronstam R.S., Sharma S.V. Submitted (JAN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [10] | NIEHS SNPs program Submitted (NOV-2006) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS VAL-6; ASP-40; CYS-147; ASP-152; CYS-265 AND ASN-274. |
| [11] | "The DNA sequence and analysis of human chromosome 6." Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. Beck S.Nature 425:805-811(2003) [PubMed: 14574404] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [12] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [13] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [14] | "An homozygous Ala 6 Val (GCC->GTC) mutation was detected on human mu opioid receptor gene of an African American individual with sickle cell anemia." Metha S., Glendenning M., Kutlar A., Kutlar F. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-20, VARIANT VAL-6. Tissue: Blood. |
| [15] | "The mu opiate receptor as a candidate gene for pain: polymorphisms, variations in expression, nociception, and opiate responses." Uhl G.R., Sora I., Wang Z. Proc. Natl. Acad. Sci. U.S.A. 96:7752-7755(1999) [PubMed: 10393893] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-47. |
| [16] | "Mu opioid receptor gene expression in immune cells." Chuang T.K., Killam K.F. Jr., Chuang L.F., Kung H.F., Sheng W.S., Chao C.C., Yu L., Chuang R.Y. Biochem. Biophys. Res. Commun. 216:922-930(1995) [PubMed: 7488213] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 229-374. |
| [17] | "A member of the heat shock protein 40 family, hlj1, binds to the carboxyl tail of the human mu opioid receptor." Ancevska-Taneva N., Onoprishvili I., Andria M.L., Hiller J.M., Simon E.J. Brain Res. 1081:28-33(2006) [PubMed: 16542645] [Abstract] Cited for: INTERACTION WITH DNAJB4. |
| [18] | "Mu opioid receptor gene variants: lack of association with alcohol dependence." Bergen A.W., Kokoszka J., Peterson R., Long J.C., Virkkunen M., Linnoila M., Goldman D. Mol. Psychiatry 2:490-494(1997) [PubMed: 9399694] [Abstract] Cited for: VARIANTS VAL-6; ASP-40 AND CYS-147. |
| [19] | "Single-nucleotide polymorphism in the human mu opioid receptor gene alters beta-endorphin binding and activity: possible implications for opiate addiction." Bond C., LaForge K.S., Tian M., Melia D., Zhang S., Borg L., Gong J., Schluger J., Strong J.A., Leal S.M., Tischfield J.A., Kreek M.J., Yu L. Proc. Natl. Acad. Sci. U.S.A. 95:9608-9613(1998) [PubMed: 9689128] [Abstract] Cited for: VARIANTS VAL-6; ASP-40 AND HIS-260. |
| + | Additional computationally mapped references. |
Web resources
| Wikipedia Mu opioid receptor entry |
| NIEHS-SNPs |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | L25119 mRNA. Translation: AAA20580.1. U12569 mRNA. Translation: AAB60354.1. L29301 mRNA. Translation: AAA73958.1. AY036622 mRNA. Translation: AAK74189.1. AY036623 mRNA. Translation: AAK74190.1. AY225404 mRNA. Translation: AAP44727.1. AY309001 mRNA. Translation: AAQ77385.1. AY309005 mRNA. Translation: AAQ77389.1. AY309006 mRNA. Translation: AAQ77390.1. AY309007 mRNA. Translation: AAQ77391.1. AY309008 mRNA. Translation: AAQ77392.1. AY309009 mRNA. Translation: AAQ77393.1. EU340241 mRNA. Translation: ACA49726.1. AY364230 mRNA. Translation: AAR12887.1. AK313901 mRNA. Translation: BAG36624.1. AY521028 mRNA. Translation: AAS00462.1. AY587764 Genomic DNA. Translation: AAS83107.1. AL132774, AL136444 Genomic DNA. Translation: CAI20458.1. Different initiation. CH471051 Genomic DNA. Translation: EAW47705.1. Different initiation. BC074927 mRNA. Translation: AAH74927.1. AY292290 Genomic DNA. Translation: AAP44409.1. AY292291 Genomic DNA. Translation: AAP44410.1. AF153500 Genomic DNA. Translation: AAD44318.1. |
| IPI | IPI00217416. IPI00514084. IPI00922493. IPI00922515. IPI00922551. IPI00922644. IPI00922913. IPI00942295. IPI00943201. IPI00967650. IPI00975883. |
| PIR | I56553. S65693. |
| RefSeq | NP_000905.3. NM_000914.3. NP_001008503.2. NM_001008503.1. NP_001008504.2. NM_001008504.2. NP_001008505.2. NM_001008505.1. NP_001138751.1. NM_001145279.2. NP_001138754.1. NM_001145282.1. NP_001138755.1. NM_001145283.1. NP_001138756.1. NM_001145284.2. NP_001138757.1. NM_001145285.1. NP_001138758.1. NM_001145286.1. NP_001138759.1. NM_001145287.1. |
| UniGene | Hs.2353. |
3D structure databases | |
| ProteinModelPortal | P35372. |
| SMR | P35372. Positions 71-355. |
| DisProt | DP00272. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P35372. 1 interaction. |
| STRING | P35372. |
Protein family/group databases | |
| GPCRDB | Search... |
PTM databases | |
| PhosphoSite | P35372. |
Polymorphism databases | |
| DMDM | 2851402. |
Proteomic databases | |
| PRIDE | P35372. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000330432; ENSP00000328264; ENSG00000112038. ENST00000434900; ENSP00000394624; ENSG00000112038. |
| GeneID | 4988. |
| KEGG | hsa:4988. |
| UCSC | uc003qpr.1. human. |
Organism-specific databases | |
| CTD | 4988. |
| GeneCards | GC06P154391. |
| H-InvDB | HIX0032850. |
| HGNC | HGNC:8156. OPRM1. |
| HPA | HPA014509. |
| MIM | 600018. gene. |
| neXtProt | NX_P35372. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | HBG106919. |
| InParanoid | P35372. |
| OMA | DRTNHQC. |
| OrthoDB | EOG4KD6MF. |
Enzyme and pathway databases | |
| Pathway_Interaction_DB | il4_2pathway. IL4-mediated signaling events. |
| Reactome | REACT_111102. Signal Transduction. |
Gene expression databases | |
| ArrayExpress | P35372. |
| Bgee | P35372. |
| CleanEx | HS_OPRM1. |
| Genevestigator | P35372. |
| GermOnline | ENSG00000112038. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR000276. 7TM_GPCR_Rhodpsn. IPR017452. GPCR_Rhodpsn_supfam. IPR000105. Mu_opioid_rcpt. IPR001418. Opioid_rcpt. [Graphical view] |
| KO | K04215. |
| Pfam | PF00001. 7tm_1. 1 hit. [Graphical view] |
| PRINTS | PR00237. GPCRRHODOPSN. PR00537. MUOPIOIDR. PR00384. OPIOIDR. |
| PROSITE | PS00237. G_PROTEIN_RECEP_F1_1. 1 hit. PS50262. G_PROTEIN_RECEP_F1_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| DrugBank | DB00802. Alfentanil. DB00913. Anileridine. DB00921. Buprenorphine. DB00611. Butorphanol. DB00318. Codeine. DB01209. Dezocine. DB01081. Diphenoxylate. DB00813. Fentanyl. DB00956. Hydrocodone. DB00327. Hydromorphone. DB00504. Levallorphan. DB01227. Levomethadyl Acetate. DB00854. Levorphanol. DB00836. Loperamide. DB00333. Methadone. DB01433. Methadyl Acetate. DB00295. Morphine. DB00844. Nalbuphine. DB01183. Naloxone. DB00704. Naltrexone. DB00497. Oxycodone. DB01192. Oxymorphone. DB00652. Pentazocine. DB00647. Propoxyphene. DB00899. Remifentanil. DB00708. Sufentanil. DB00193. Tramadol. |
| NextBio | 19206. |
| SOURCE | Search... |
Entry information
| Entry name | OPRM_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P35372 Secondary accession number(s): B2R9S7 Q9UN57 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| 7-transmembrane G-linked receptors List of 7-transmembrane G-linked receptor entries |
| Human chromosome 6 Human chromosome 6: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with