Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Mu-type opioid receptor

Gene

OPRM1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Receptor for endogenous opioids such as beta-endorphin and endomorphin. Receptor for natural and synthetic opioids including morphine, heroin, DAMGO, fentanyl, etorphine, buprenorphin and methadone. Agonist binding to the receptor induces coupling to an inactive GDP-bound heterotrimeric G-protein complex and subsequent exchange of GDP for GTP in the G-protein alpha subunit leading to dissociation of the G-protein complex with the free GTP-bound G-protein alpha and the G-protein beta-gamma dimer activating downstream cellular effectors. The agonist- and cell type-specific activity is predominantly coupled to pertussis toxin-sensitive G(i) and G(o) G alpha proteins, GNAI1, GNAI2, GNAI3 and GNAO1 isoforms Alpha-1 and Alpha-2, and to a lesser extent to pertussis toxin-insensitive G alpha proteins GNAZ and GNA15. They mediate an array of downstream cellular responses, including inhibition of adenylate cyclase activity and both N-type and L-type calcium channels, activation of inward rectifying potassium channels, mitogen-activated protein kinase (MAPK), phospholipase C (PLC), phosphoinositide/protein kinase (PKC), phosphoinositide 3-kinase (PI3K) and regulation of NF-kappa-B. Also couples to adenylate cyclase stimulatory G alpha proteins. The selective temporal coupling to G-proteins and subsequent signaling can be regulated by RGSZ proteins, such as RGS9, RGS17 and RGS4. Phosphorylation by members of the GPRK subfamily of Ser/Thr protein kinases and association with beta-arrestins is involved in short-term receptor desensitization. Beta-arrestins associate with the GPRK-phosphorylated receptor and uncouple it from the G-protein thus terminating signal transduction. The phosphorylated receptor is internalized through endocytosis via clathrin-coated pits which involves beta-arrestins. The activation of the ERK pathway occurs either in a G-protein-dependent or a beta-arrestin-dependent manner and is regulated by agonist-specific receptor phosphorylation. Acts as a class A G-protein coupled receptor (GPCR) which dissociates from beta-arrestin at or near the plasma membrane and undergoes rapid recycling. Receptor down-regulation pathways are varying with the agonist and occur dependent or independent of G-protein coupling. Endogenous ligands induce rapid desensitization, endocytosis and recycling whereas morphine induces only low desensitization and endocytosis. Heterooligomerization with other GPCRs can modulate agonist binding, signaling and trafficking properties. Involved in neurogenesis. Isoform 12 couples to GNAS and is proposed to be involved in excitatory effects. Isoform 16 and isoform 17 do not bind agonists but may act through oligomerization with binding-competent OPRM1 isoforms and reduce their ligand binding activity.

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

BioCyciZFISH:ENSG00000112038-MONOMER.
ReactomeiR-HSA-111885. Opioid Signalling.
R-HSA-202040. G-protein activation.
R-HSA-375276. Peptide ligand-binding receptors.
R-HSA-418594. G alpha (i) signalling events.
SIGNORiP35372.

Protein family/group databases

TCDBi9.A.14.13.18. the g-protein-coupled receptor (gpcr) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Mu-type opioid receptor
Short name:
M-OR-1
Short name:
MOR-1
Alternative name(s):
Mu opiate receptor
Mu opioid receptor
Short name:
MOP
Short name:
hMOP
Gene namesi
Name:OPRM1
Synonyms:MOR1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:8156. OPRM1.

Subcellular locationi

Isoform 12 :

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 68ExtracellularBy similarityAdd BLAST68
Transmembranei69 – 93Helical; Name=1By similarityAdd BLAST25
Topological domaini94 – 106CytoplasmicBy similarityAdd BLAST13
Transmembranei107 – 131Helical; Name=2By similarityAdd BLAST25
Topological domaini132 – 142ExtracellularBy similarityAdd BLAST11
Transmembranei143 – 165Helical; Name=3By similarityAdd BLAST23
Topological domaini166 – 185CytoplasmicBy similarityAdd BLAST20
Transmembranei186 – 207Helical; Name=4By similarityAdd BLAST22
Topological domaini208 – 230ExtracellularBy similarityAdd BLAST23
Transmembranei231 – 255Helical; Name=5By similarityAdd BLAST25
Topological domaini256 – 283CytoplasmicBy similarityAdd BLAST28
Transmembranei284 – 307Helical; Name=6By similarityAdd BLAST24
Topological domaini308 – 314ExtracellularBy similarity7
Transmembranei315 – 338Helical; Name=7By similarityAdd BLAST24
Topological domaini339 – 400CytoplasmicBy similarityAdd BLAST62

GO - Cellular componenti

  • cell Source: GOC
  • dendrite cytoplasm Source: Ensembl
  • dendrite membrane Source: Ensembl
  • endoplasmic reticulum Source: ProtInc
  • focal adhesion Source: Ensembl
  • Golgi apparatus Source: ProtInc
  • integral component of plasma membrane Source: ProtInc
  • membrane raft Source: Ensembl
  • neuron projection Source: GO_Central
  • perikaryon Source: Ensembl
  • plasma membrane Source: Reactome
  • postsynapse Source: GOC
  • sarcolemma Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi142C → A or S: Abolishes ligand binding; when associated with A-219 or S-219. 1 Publication1
Mutagenesisi219C → A or S: Abolishes ligand binding; when associated with A-142 or S-142. 1 Publication1
Mutagenesisi273K → A: Impairs interaction with calmodulin. 2 Publications1
Mutagenesisi275R → A: Impairs interaction with calmodulin. 1 Publication1

Organism-specific databases

DisGeNETi4988.
OpenTargetsiENSG00000112038.
PharmGKBiPA31945.

Chemistry databases

ChEMBLiCHEMBL233.
DrugBankiDB00802. Alfentanil.
DB06274. Alvimopan.
DB00321. Amitriptyline.
DB00913. Anileridine.
DB00921. Buprenorphine.
DB00611. Butorphanol.
DB00318. Codeine.
DB00514. Dextromethorphan.
DB00647. Dextropropoxyphene.
DB01209. Dezocine.
DB01081. Diphenoxylate.
DB09272. Eluxadoline.
DB01466. Ethylmorphine.
DB00813. Fentanyl.
DB01452. Heroin.
DB00956. Hydrocodone.
DB00327. Hydromorphone.
DB01221. Ketamine.
DB06738. Ketobemidone.
DB00504. Levallorphan.
DB01227. Levomethadyl Acetate.
DB00854. Levorphanol.
DB00836. Loperamide.
DB00333. Methadone.
DB01433. Methadyl Acetate.
DB06800. Methylnaltrexone.
DB00295. Morphine.
DB00844. Nalbuphine.
DB09049. Naloxegol.
DB01183. Naloxone.
DB00704. Naltrexone.
DB00904. Ondansetron.
DB00497. Oxycodone.
DB01192. Oxymorphone.
DB00652. Pentazocine.
DB00454. Pethidine.
DB00899. Remifentanil.
DB00708. Sufentanil.
DB06204. Tapentadol.
DB00193. Tramadol.
GuidetoPHARMACOLOGYi319.

Polymorphism and mutation databases

BioMutaiOPRM1.
DMDMi2851402.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000699721 – 400Mu-type opioid receptorAdd BLAST400

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi9N-linked (GlcNAc...)Sequence analysis1
Glycosylationi12N-linked (GlcNAc...)Sequence analysis1
Glycosylationi33N-linked (GlcNAc...)Sequence analysis1
Glycosylationi40N-linked (GlcNAc...)Sequence analysis1
Glycosylationi48N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi142 ↔ 219PROSITE-ProRule annotation
Modified residuei168PhosphotyrosineBy similarity1
Lipidationi353S-palmitoyl cysteineSequence analysis1
Modified residuei365PhosphoserineBy similarity1
Modified residuei372PhosphothreonineBy similarity1
Modified residuei377PhosphoserineBy similarity1

Post-translational modificationi

Phosphorylated. Differentially phosphorylated in basal and agonist-induced conditions. Agonist-mediated phosphorylation modulates receptor internalization. Phosphorylated by GRK2 in a agonist-dependent manner. Phosphorylation at Tyr-168 requires receptor activation, is dependent on non-receptor protein tyrosine kinase Src and results in a decrease in agonist efficacy by reducing G-protein coupling efficiency. Phosphorylated on tyrosine residues; the phosphorylation is involved in agonist-induced G-protein-independent receptor down-regulation. Phosphorylation at Ser-377 is involved in G-protein-dependent but not beta-arrestin-dependent activation of the ERK pathway (By similarity).By similarity
Ubiquitinated. A basal ubiquitination seems not to be related to degradation. Ubiquitination is increased upon formation of OPRM1:OPRD1 oligomers leading to proteasomal degradation; the ubiquitination is diminished by RTP4 (By similarity).By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Lipoprotein, Palmitate, Phosphoprotein, Ubl conjugation

Proteomic databases

PaxDbiP35372.
PeptideAtlasiP35372.
PRIDEiP35372.

PTM databases

iPTMnetiP35372.
PhosphoSitePlusiP35372.
SwissPalmiP35372.

Expressioni

Tissue specificityi

Expressed in brain. Isoform 16 and isoform 17 are detected in brain.1 Publication

Gene expression databases

BgeeiENSG00000112038.
CleanExiHS_OPRM1.
ExpressionAtlasiP35372. baseline and differential.
GenevisibleiP35372. HS.

Organism-specific databases

HPAiHPA014509.
HPA067435.

Interactioni

Subunit structurei

Forms homooligomers and heterooligomers with other GPCRs, such as OPRD1, OPRK1, OPRL1, NPFFR2, ADRA2A, SSTR2, CNR1 and CCR5 (probably in dimeric forms). Interacts with PPL; the interaction disrupts agonist-mediated G-protein activation. Interacts (via C-terminus) with DNAJB4 (via C-terminus). Interacts with calmodulin; the interaction inhibits the constitutive activity of OPRM1; it abolishes basal and attenuates agonist-stimulated G-protein coupling. Interacts with FLNA, PLD2, RANBP9 and WLS. Interacts with GPM6A, RTP4, SYP, GNAS, RGS9, RGS17, RGS20, RGS4, PPP1R9B and HINT1 (By similarity).By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
AUP1Q9Y6794EBI-2624570,EBI-1058701
COPS5Q929055EBI-2624570,EBI-594661
DOK4Q8TEW64EBI-2624570,EBI-6918542
FLNAP213335EBI-2624570,EBI-350432
GJA4P352122EBI-2624570,EBI-6918707
PENKP012103EBI-2624570,EBI-6656055
RANBP9Q96S595EBI-2624570,EBI-636085
SIAH1Q8IUQ44EBI-2624570,EBI-747107
SIAH2O432553EBI-2624570,EBI-948141
VAPAQ9P0L03EBI-2624570,EBI-1059156
WLSQ5T9L310EBI-2624570,EBI-2868748
ZYXQ159422EBI-2624570,EBI-444225

GO - Molecular functioni

  • G-protein alpha-subunit binding Source: UniProtKB
  • G-protein beta-subunit binding Source: GO_Central

Protein-protein interaction databases

BioGridi111033. 73 interactors.
IntActiP35372. 15 interactors.
MINTiMINT-100121.
STRINGi9606.ENSP00000394624.

Chemistry databases

BindingDBiP35372.

Structurei

3D structure databases

DisProtiDP00272.
ProteinModelPortaliP35372.
SMRiP35372.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3656. Eukaryota.
ENOG410XRW9. LUCA.
GeneTreeiENSGT00760000118797.
HOGENOMiHOG000230486.
HOVERGENiHBG106919.
InParanoidiP35372.
KOiK04215.
OMAiNSTRVRQ.
OrthoDBiEOG091G0HEN.
PhylomeDBiP35372.
TreeFamiTF315737.

Family and domain databases

InterProiIPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
IPR000105. Mu_opioid_rcpt.
IPR001418. Opioid_rcpt.
[Graphical view]
PfamiPF00001. 7tm_1. 1 hit.
[Graphical view]
PRINTSiPR00237. GPCRRHODOPSN.
PR00537. MUOPIOIDR.
PR00384. OPIOIDR.
PROSITEiPS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]

Sequences (18)i

Sequence statusi: Complete.

This entry describes 18 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.
Isoform 1 (identifier: P35372-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDSSAAPTNA SNCTDALAYS SCSPAPSPGS WVNLSHLDGN LSDPCGPNRT
60 70 80 90 100
DLGGRDSLCP PTGSPSMITA ITIMALYSIV CVVGLFGNFL VMYVIVRYTK
110 120 130 140 150
MKTATNIYIF NLALADALAT STLPFQSVNY LMGTWPFGTI LCKIVISIDY
160 170 180 190 200
YNMFTSIFTL CTMSVDRYIA VCHPVKALDF RTPRNAKIIN VCNWILSSAI
210 220 230 240 250
GLPVMFMATT KYRQGSIDCT LTFSHPTWYW ENLLKICVFI FAFIMPVLII
260 270 280 290 300
TVCYGLMILR LKSVRMLSGS KEKDRNLRRI TRMVLVVVAV FIVCWTPIHI
310 320 330 340 350
YVIIKALVTI PETTFQTVSW HFCIALGYTN SCLNPVLYAF LDENFKRCFR
360 370 380 390 400
EFCIPTSSNI EQQNSTRIRQ NTRDHPSTAN TVDRTNHQLE NLEAETAPLP
Length:400
Mass (Da):44,779
Last modified:July 15, 1998 - v2
Checksum:i1DABEBEC9AFF6F66
GO
Isoform 2 (identifier: P35372-2) [UniParc]FASTAAdd to basket
Also known as: MOR1A, MOR-1A

The sequence of this isoform differs from the canonical sequence as follows:
     389-400: LENLEAETAPLP → VRSL

Show »
Length:392
Mass (Da):43,957
Checksum:i14184C69F06AFCBE
GO
Isoform 3 (identifier: P35372-3) [UniParc]FASTAAdd to basket
Also known as: MOR-1R, MOR-1X

The sequence of this isoform differs from the canonical sequence as follows:
     389-400: LENLEAETAPLP → CLPIPSLSCWALEQGCLVVYPGPLQGPLVRYDLPAILHSSCLRGNTAPSPSGGAFLLS

Show »
Length:446
Mass (Da):49,520
Checksum:i42DC76968E6352A8
GO
Isoform 4 (identifier: P35372-4) [UniParc]FASTAAdd to basket
Also known as: MOR-1B3

The sequence of this isoform differs from the canonical sequence as follows:
     389-400: LENLEAETAPLP → GPPAKFVADQLAGSS

Show »
Length:403
Mass (Da):44,928
Checksum:iB3FFA10F7B1C5311
GO
Isoform 5 (identifier: P35372-5) [UniParc]FASTAAdd to basket
Also known as: MOR-1C, MOR-1O

The sequence of this isoform differs from the canonical sequence as follows:
     389-400: LENLEAETAPLP → PPLAVSMAQIFTRYPPPTHREKTCNDYMKR

Show »
Length:418
Mass (Da):47,032
Checksum:i51B9E7B131122196
GO
Isoform 6 (identifier: P35372-6) [UniParc]FASTAAdd to basket
Also known as: MOR-1V, MOR-1Y, MOR-1Y2, MOR-1Y3

The sequence of this isoform differs from the canonical sequence as follows:
     389-400: LENLEAETAPLP → IRDPISNLPRVSVF

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:402
Mass (Da):45,096
Checksum:i5BC8380AB8196D70
GO
Isoform 7 (identifier: P35372-7) [UniParc]FASTAAdd to basket
Also known as: MOR-1B1

The sequence of this isoform differs from the canonical sequence as follows:
     389-400: LENLEAETAPLP → KIDLFQKSSLLNCEHTKG

Show »
Length:406
Mass (Da):45,544
Checksum:i1A0330578A82B183
GO
Isoform 8 (identifier: P35372-8) [UniParc]FASTAAdd to basket
Also known as: MOR-1B2

The sequence of this isoform differs from the canonical sequence as follows:
     389-400: LENLEAETAPLP → RERRQKSDW

Show »
Length:397
Mass (Da):44,743
Checksum:i3BC7E1C19B9739E3
GO
Isoform 9 (identifier: P35372-9) [UniParc]FASTAAdd to basket
Also known as: MOR-1B5

The sequence of this isoform differs from the canonical sequence as follows:
     389-400: LENLEAETAPLP → VELNLDCHCENAKPWPLSYNAGQSPFPFPGRV

Show »
Length:420
Mass (Da):47,070
Checksum:i63301322222198DE
GO
Isoform 10 (identifier: P35372-10) [UniParc]FASTAAdd to basket
Also known as: MOR-1i

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MCLHRRVPSE...SGARPAVSTM

Show »
Length:493
Mass (Da):55,045
Checksum:i14A90F782A013067
GO
Isoform 11 (identifier: P35372-11) [UniParc]FASTAAdd to basket
Also known as: MOR-1B4

The sequence of this isoform differs from the canonical sequence as follows:
     389-400: LENLEAETAPLP → S

Show »
Length:389
Mass (Da):43,588
Checksum:i7E806AFCBE572CD5
GO
Isoform 12 (identifier: P35372-12) [UniParc]FASTAAdd to basket
Also known as: MOR-1G1, MOR-1K

The sequence of this isoform differs from the canonical sequence as follows:
     1-100: Missing.

Show »
Length:300
Mass (Da):34,393
Checksum:i03FE8402349A629C
GO
Isoform 13 (identifier: P35372-13) [UniParc]FASTAAdd to basket
Also known as: MOR-1G2

The sequence of this isoform differs from the canonical sequence as follows:
     1-96: MDSSAAPTNA...GNFLVMYVIV → MMRAKSISTKAGKPS

Show »
Length:319
Mass (Da):36,516
Checksum:i6373C1D800FF5E53
GO
Isoform 14 (identifier: P35372-14) [UniParc]FASTAAdd to basket
Also known as: Mu3

The sequence of this isoform differs from the canonical sequence as follows:
     1-100: Missing.
     389-400: LENLEAETAPLP → NYYIIHRCCCNTPLISQKPVLLWFCD

Show »
Length:314
Mass (Da):36,240
Checksum:i7346DB61E594896E
GO
Isoform 15 (identifier: P35372-15) [UniParc]FASTAAdd to basket
Also known as: MOR-1W

The sequence of this isoform differs from the canonical sequence as follows:
     1-100: Missing.
     389-400: LENLEAETAPLP → VRSL

Show »
Length:292
Mass (Da):33,570
Checksum:i62A80E8005705E4C
GO
Isoform 16 (identifier: P35372-16) [UniParc]FASTAAdd to basket
Also known as: SV1

The sequence of this isoform differs from the canonical sequence as follows:
     98-400: YTKMKTATNI...NLEAETAPLP → YSWFVIGGPEGRRKQRRLGEDKRARGCGEKG

Show »
Length:128
Mass (Da):13,544
Checksum:i1E780EE294726795
GO
Isoform 17 (identifier: P35372-17) [UniParc]FASTAAdd to basket
Also known as: SV2

The sequence of this isoform differs from the canonical sequence as follows:
     97-400: RYTKMKTATN...NLEAETAPLP → SSSWF

Show »
Length:101
Mass (Da):10,451
Checksum:iE6590D98EDF64171
GO
Isoform 18 (identifier: P35372-18) [UniParc]FASTAAdd to basket
Also known as: hMOR-1Z

The sequence of this isoform differs from the canonical sequence as follows:
     98-186: YTKMKTATNI...ALDFRTPRNA → FHRLYTNILS...LDSHSHLRHH
     187-400: Missing.

Show »
Length:186
Mass (Da):20,188
Checksum:i2A80DD5FADA6B83B
GO

Sequence cautioni

Isoform 9 : The sequence AAQ77392 differs from that shown. a polymorphism leading to premature termination of translation (position: 411:Q->Stop)Curated
The sequence CAI20458 differs from that shown. Reason: Erroneous initiation.Curated
The sequence EAW47705 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti26P → L in BAG36624 (PubMed:14702039).Curated1
Sequence conflicti51D → N in AAA20580 (PubMed:7905839).Curated1
Sequence conflicti109I → V in AAQ77391 (PubMed:15893644).Curated1
Sequence conflicti207M → I in AAB60354 (PubMed:7957926).Curated1
Sequence conflicti234L → V in AAA20580 (PubMed:7905839).Curated1
Isoform 3 (identifier: P35372-3)
Sequence conflicti402Q → H in AAK74189 (PubMed:12589820).Curated1

Polymorphismi

Variant Asp-40 does not show altered binding affinities for most opioid peptides and alkaloids tested, but it binds beta-endorphin, an endogenous opioid that activates the mu opioid receptor, approximately 3 times more tightly than the most common allelic form.

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0095256A → V.4 PublicationsCorresponds to variant rs1799972dbSNPEnsembl.1
Natural variantiVAR_00952440N → D in 10% of the population. 4 PublicationsCorresponds to variant rs1799971dbSNPEnsembl.1
Natural variantiVAR_04942663G → V.Corresponds to variant rs9282817dbSNPEnsembl.1
Natural variantiVAR_04942766S → F.Corresponds to variant rs9282819dbSNPEnsembl.1
Natural variantiVAR_009526147S → C Rare polymorphism. 2 PublicationsCorresponds to variant rs17174794dbSNPEnsembl.1
Natural variantiVAR_019252152N → D.1 PublicationCorresponds to variant rs17174801dbSNPEnsembl.1
Natural variantiVAR_009527260R → H Rare polymorphism. 1 PublicationCorresponds to variant rs1799974dbSNPEnsembl.1
Natural variantiVAR_019253265R → C.1 PublicationCorresponds to variant rs17174822dbSNPEnsembl.1
Natural variantiVAR_019254274D → N.1 PublicationCorresponds to variant rs17174829dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0423271 – 100Missing in isoform 12, isoform 14 and isoform 15. 4 PublicationsAdd BLAST100
Alternative sequenceiVSP_0423281 – 96MDSSA…MYVIV → MMRAKSISTKAGKPS in isoform 13. 1 PublicationAdd BLAST96
Alternative sequenceiVSP_0376931M → MCLHRRVPSEETYSLDRFAQ NPPLFPPPSLPASESRMAHA PLLQRCGAARTGFCKKQQEL WQRRKEAAEALGTRKVSVLL ATSHSGARPAVSTM in isoform 10. 2 Publications1
Alternative sequenceiVSP_04232997 – 400RYTKM…TAPLP → SSSWF in isoform 17. CuratedAdd BLAST304
Alternative sequenceiVSP_04233098 – 400YTKMK…TAPLP → YSWFVIGGPEGRRKQRRLGE DKRARGCGEKG in isoform 16. CuratedAdd BLAST303
Alternative sequenceiVSP_04757798 – 186YTKMK…TPRNA → FHRLYTNILSSNLVLGKPAE DLCFHLRLHYASAHHYRVLW TDDLAPQECPHALWLQRKGQ ESSKDHQDGAGGGGCVHRLL DSHSHLRHH in isoform 18. 1 PublicationAdd BLAST89
Alternative sequenceiVSP_047578187 – 400Missing in isoform 18. 1 PublicationAdd BLAST214
Alternative sequenceiVSP_037694389 – 400LENLE…TAPLP → S in isoform 11. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_042331389 – 400LENLE…TAPLP → NYYIIHRCCCNTPLISQKPV LLWFCD in isoform 14. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_001896389 – 400LENLE…TAPLP → VRSL in isoform 2 and isoform 15. 3 PublicationsAdd BLAST12
Alternative sequenceiVSP_037695389 – 400LENLE…TAPLP → CLPIPSLSCWALEQGCLVVY PGPLQGPLVRYDLPAILHSS CLRGNTAPSPSGGAFLLS in isoform 3. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_037696389 – 400LENLE…TAPLP → GPPAKFVADQLAGSS in isoform 4. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_037697389 – 400LENLE…TAPLP → PPLAVSMAQIFTRYPPPTHR EKTCNDYMKR in isoform 5. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_037698389 – 400LENLE…TAPLP → IRDPISNLPRVSVF in isoform 6. 3 PublicationsAdd BLAST12
Alternative sequenceiVSP_037699389 – 400LENLE…TAPLP → KIDLFQKSSLLNCEHTKG in isoform 7. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_037700389 – 400LENLE…TAPLP → RERRQKSDW in isoform 8. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_037701389 – 400LENLE…TAPLP → VELNLDCHCENAKPWPLSYN AGQSPFPFPGRV in isoform 9. 1 PublicationAdd BLAST12

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L25119 mRNA. Translation: AAA20580.1.
U12569 mRNA. Translation: AAB60354.1.
L29301 mRNA. Translation: AAA73958.1.
AY036622 mRNA. Translation: AAK74189.1.
AY036623 mRNA. Translation: AAK74190.1.
AY195733 mRNA. Translation: AAO21305.1.
AY225404 mRNA. Translation: AAP44727.1.
AY309001 mRNA. Translation: AAQ77385.1.
AY309005 mRNA. Translation: AAQ77389.1.
AY309006 mRNA. Translation: AAQ77390.1.
AY309007 mRNA. Translation: AAQ77391.1.
AY309008 mRNA. Translation: AAQ77392.1.
AY309009 mRNA. Translation: AAQ77393.1.
EU340241 mRNA. Translation: ACA49726.1.
EU340242 mRNA. Translation: ACA49727.1.
EU340243 mRNA. Translation: ACA49728.1.
AY364230 mRNA. Translation: AAR12887.1.
AY364890 mRNA. Translation: AAR11568.1.
HQ699462 mRNA. Translation: AET97615.1.
EU360599 mRNA. Translation: ABY61366.1.
EU362990 mRNA. Translation: ABY66530.1.
AK313901 mRNA. Translation: BAG36624.1.
AY521028 mRNA. Translation: AAS00462.1.
AY587764 Genomic DNA. Translation: AAS83107.1.
FJ041292 mRNA. Translation: ACM90350.1.
FJ041293 mRNA. Translation: ACM90351.1.
FJ041294 mRNA. Translation: ACM90352.1.
AL132774, AL136444 Genomic DNA. Translation: CAI20458.1. Different initiation.
AL445220 Genomic DNA. No translation available.
CH471051 Genomic DNA. Translation: EAW47705.1. Different initiation.
BC074927 mRNA. Translation: AAH74927.1.
AY292290 Genomic DNA. Translation: AAP44409.1.
AY292291 Genomic DNA. Translation: AAP44410.1.
AF153500 Genomic DNA. Translation: AAD44318.1.
CCDSiCCDS43517.1. [P35372-5]
CCDS43518.1. [P35372-3]
CCDS47503.1. [P35372-10]
CCDS47504.1. [P35372-7]
CCDS47505.1. [P35372-8]
CCDS47506.1. [P35372-4]
CCDS47507.1. [P35372-9]
CCDS47508.1. [P35372-2]
CCDS55068.1. [P35372-13]
CCDS55069.1. [P35372-11]
CCDS55070.1. [P35372-1]
CCDS55071.1. [P35372-12]
PIRiI56553.
S65693.
RefSeqiNP_000905.3. NM_000914.4. [P35372-1]
NP_001008503.2. NM_001008503.2. [P35372-5]
NP_001008504.2. NM_001008504.3. [P35372-2]
NP_001008505.2. NM_001008505.2. [P35372-3]
NP_001138751.1. NM_001145279.3. [P35372-10]
NP_001138752.1. NM_001145280.3. [P35372-12]
NP_001138753.1. NM_001145281.2. [P35372-13]
NP_001138754.1. NM_001145282.2. [P35372-7]
NP_001138755.1. NM_001145283.2. [P35372-8]
NP_001138756.1. NM_001145284.3. [P35372-4]
NP_001138757.1. NM_001145285.2. [P35372-11]
NP_001138758.1. NM_001145286.2. [P35372-9]
NP_001138759.1. NM_001145287.2. [P35372-12]
NP_001272452.1. NM_001285523.1.
NP_001272453.1. NM_001285524.1. [P35372-10]
NP_001272455.1. NM_001285526.1. [P35372-12]
NP_001272456.1. NM_001285527.1. [P35372-15]
NP_001272457.1. NM_001285528.1. [P35372-14]
XP_016866395.1. XM_017010906.1. [P35372-12]
UniGeneiHs.2353.

Genome annotation databases

EnsembliENST00000229768; ENSP00000229768; ENSG00000112038. [P35372-3]
ENST00000330432; ENSP00000328264; ENSG00000112038. [P35372-1]
ENST00000337049; ENSP00000338381; ENSG00000112038. [P35372-5]
ENST00000414028; ENSP00000399359; ENSG00000112038. [P35372-4]
ENST00000419506; ENSP00000403549; ENSG00000112038. [P35372-9]
ENST00000428397; ENSP00000411903; ENSG00000112038. [P35372-2]
ENST00000434900; ENSP00000394624; ENSG00000112038. [P35372-10]
ENST00000435918; ENSP00000413752; ENSG00000112038. [P35372-8]
ENST00000452687; ENSP00000410497; ENSG00000112038. [P35372-7]
ENST00000518759; ENSP00000430260; ENSG00000112038. [P35372-13]
ENST00000519083; ENSP00000431048; ENSG00000112038. [P35372-6]
ENST00000520708; ENSP00000430876; ENSG00000112038. [P35372-12]
ENST00000522236; ENSP00000429373; ENSG00000112038. [P35372-12]
ENST00000522555; ENSP00000429719; ENSG00000112038. [P35372-12]
ENST00000522739; ENSP00000428018; ENSG00000112038. [P35372-6]
ENST00000524150; ENSP00000430575; ENSG00000112038. [P35372-18]
ENST00000524163; ENSP00000430097; ENSG00000112038. [P35372-11]
GeneIDi4988.
KEGGihsa:4988.
UCSCiuc003qpn.4. human. [P35372-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Wikipedia

Mu opioid receptor entry

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L25119 mRNA. Translation: AAA20580.1.
U12569 mRNA. Translation: AAB60354.1.
L29301 mRNA. Translation: AAA73958.1.
AY036622 mRNA. Translation: AAK74189.1.
AY036623 mRNA. Translation: AAK74190.1.
AY195733 mRNA. Translation: AAO21305.1.
AY225404 mRNA. Translation: AAP44727.1.
AY309001 mRNA. Translation: AAQ77385.1.
AY309005 mRNA. Translation: AAQ77389.1.
AY309006 mRNA. Translation: AAQ77390.1.
AY309007 mRNA. Translation: AAQ77391.1.
AY309008 mRNA. Translation: AAQ77392.1.
AY309009 mRNA. Translation: AAQ77393.1.
EU340241 mRNA. Translation: ACA49726.1.
EU340242 mRNA. Translation: ACA49727.1.
EU340243 mRNA. Translation: ACA49728.1.
AY364230 mRNA. Translation: AAR12887.1.
AY364890 mRNA. Translation: AAR11568.1.
HQ699462 mRNA. Translation: AET97615.1.
EU360599 mRNA. Translation: ABY61366.1.
EU362990 mRNA. Translation: ABY66530.1.
AK313901 mRNA. Translation: BAG36624.1.
AY521028 mRNA. Translation: AAS00462.1.
AY587764 Genomic DNA. Translation: AAS83107.1.
FJ041292 mRNA. Translation: ACM90350.1.
FJ041293 mRNA. Translation: ACM90351.1.
FJ041294 mRNA. Translation: ACM90352.1.
AL132774, AL136444 Genomic DNA. Translation: CAI20458.1. Different initiation.
AL445220 Genomic DNA. No translation available.
CH471051 Genomic DNA. Translation: EAW47705.1. Different initiation.
BC074927 mRNA. Translation: AAH74927.1.
AY292290 Genomic DNA. Translation: AAP44409.1.
AY292291 Genomic DNA. Translation: AAP44410.1.
AF153500 Genomic DNA. Translation: AAD44318.1.
CCDSiCCDS43517.1. [P35372-5]
CCDS43518.1. [P35372-3]
CCDS47503.1. [P35372-10]
CCDS47504.1. [P35372-7]
CCDS47505.1. [P35372-8]
CCDS47506.1. [P35372-4]
CCDS47507.1. [P35372-9]
CCDS47508.1. [P35372-2]
CCDS55068.1. [P35372-13]
CCDS55069.1. [P35372-11]
CCDS55070.1. [P35372-1]
CCDS55071.1. [P35372-12]
PIRiI56553.
S65693.
RefSeqiNP_000905.3. NM_000914.4. [P35372-1]
NP_001008503.2. NM_001008503.2. [P35372-5]
NP_001008504.2. NM_001008504.3. [P35372-2]
NP_001008505.2. NM_001008505.2. [P35372-3]
NP_001138751.1. NM_001145279.3. [P35372-10]
NP_001138752.1. NM_001145280.3. [P35372-12]
NP_001138753.1. NM_001145281.2. [P35372-13]
NP_001138754.1. NM_001145282.2. [P35372-7]
NP_001138755.1. NM_001145283.2. [P35372-8]
NP_001138756.1. NM_001145284.3. [P35372-4]
NP_001138757.1. NM_001145285.2. [P35372-11]
NP_001138758.1. NM_001145286.2. [P35372-9]
NP_001138759.1. NM_001145287.2. [P35372-12]
NP_001272452.1. NM_001285523.1.
NP_001272453.1. NM_001285524.1. [P35372-10]
NP_001272455.1. NM_001285526.1. [P35372-12]
NP_001272456.1. NM_001285527.1. [P35372-15]
NP_001272457.1. NM_001285528.1. [P35372-14]
XP_016866395.1. XM_017010906.1. [P35372-12]
UniGeneiHs.2353.

3D structure databases

DisProtiDP00272.
ProteinModelPortaliP35372.
SMRiP35372.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111033. 73 interactors.
IntActiP35372. 15 interactors.
MINTiMINT-100121.
STRINGi9606.ENSP00000394624.

Chemistry databases

BindingDBiP35372.
ChEMBLiCHEMBL233.
DrugBankiDB00802. Alfentanil.
DB06274. Alvimopan.
DB00321. Amitriptyline.
DB00913. Anileridine.
DB00921. Buprenorphine.
DB00611. Butorphanol.
DB00318. Codeine.
DB00514. Dextromethorphan.
DB00647. Dextropropoxyphene.
DB01209. Dezocine.
DB01081. Diphenoxylate.
DB09272. Eluxadoline.
DB01466. Ethylmorphine.
DB00813. Fentanyl.
DB01452. Heroin.
DB00956. Hydrocodone.
DB00327. Hydromorphone.
DB01221. Ketamine.
DB06738. Ketobemidone.
DB00504. Levallorphan.
DB01227. Levomethadyl Acetate.
DB00854. Levorphanol.
DB00836. Loperamide.
DB00333. Methadone.
DB01433. Methadyl Acetate.
DB06800. Methylnaltrexone.
DB00295. Morphine.
DB00844. Nalbuphine.
DB09049. Naloxegol.
DB01183. Naloxone.
DB00704. Naltrexone.
DB00904. Ondansetron.
DB00497. Oxycodone.
DB01192. Oxymorphone.
DB00652. Pentazocine.
DB00454. Pethidine.
DB00899. Remifentanil.
DB00708. Sufentanil.
DB06204. Tapentadol.
DB00193. Tramadol.
GuidetoPHARMACOLOGYi319.

Protein family/group databases

TCDBi9.A.14.13.18. the g-protein-coupled receptor (gpcr) family.
GPCRDBiSearch...

PTM databases

iPTMnetiP35372.
PhosphoSitePlusiP35372.
SwissPalmiP35372.

Polymorphism and mutation databases

BioMutaiOPRM1.
DMDMi2851402.

Proteomic databases

PaxDbiP35372.
PeptideAtlasiP35372.
PRIDEiP35372.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000229768; ENSP00000229768; ENSG00000112038. [P35372-3]
ENST00000330432; ENSP00000328264; ENSG00000112038. [P35372-1]
ENST00000337049; ENSP00000338381; ENSG00000112038. [P35372-5]
ENST00000414028; ENSP00000399359; ENSG00000112038. [P35372-4]
ENST00000419506; ENSP00000403549; ENSG00000112038. [P35372-9]
ENST00000428397; ENSP00000411903; ENSG00000112038. [P35372-2]
ENST00000434900; ENSP00000394624; ENSG00000112038. [P35372-10]
ENST00000435918; ENSP00000413752; ENSG00000112038. [P35372-8]
ENST00000452687; ENSP00000410497; ENSG00000112038. [P35372-7]
ENST00000518759; ENSP00000430260; ENSG00000112038. [P35372-13]
ENST00000519083; ENSP00000431048; ENSG00000112038. [P35372-6]
ENST00000520708; ENSP00000430876; ENSG00000112038. [P35372-12]
ENST00000522236; ENSP00000429373; ENSG00000112038. [P35372-12]
ENST00000522555; ENSP00000429719; ENSG00000112038. [P35372-12]
ENST00000522739; ENSP00000428018; ENSG00000112038. [P35372-6]
ENST00000524150; ENSP00000430575; ENSG00000112038. [P35372-18]
ENST00000524163; ENSP00000430097; ENSG00000112038. [P35372-11]
GeneIDi4988.
KEGGihsa:4988.
UCSCiuc003qpn.4. human. [P35372-1]

Organism-specific databases

CTDi4988.
DisGeNETi4988.
GeneCardsiOPRM1.
HGNCiHGNC:8156. OPRM1.
HPAiHPA014509.
HPA067435.
MIMi600018. gene.
neXtProtiNX_P35372.
OpenTargetsiENSG00000112038.
PharmGKBiPA31945.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3656. Eukaryota.
ENOG410XRW9. LUCA.
GeneTreeiENSGT00760000118797.
HOGENOMiHOG000230486.
HOVERGENiHBG106919.
InParanoidiP35372.
KOiK04215.
OMAiNSTRVRQ.
OrthoDBiEOG091G0HEN.
PhylomeDBiP35372.
TreeFamiTF315737.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000112038-MONOMER.
ReactomeiR-HSA-111885. Opioid Signalling.
R-HSA-202040. G-protein activation.
R-HSA-375276. Peptide ligand-binding receptors.
R-HSA-418594. G alpha (i) signalling events.
SIGNORiP35372.

Miscellaneous databases

GeneWikii%CE%9C-opioid_receptor.
GenomeRNAii4988.
PROiP35372.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000112038.
CleanExiHS_OPRM1.
ExpressionAtlasiP35372. baseline and differential.
GenevisibleiP35372. HS.

Family and domain databases

InterProiIPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
IPR000105. Mu_opioid_rcpt.
IPR001418. Opioid_rcpt.
[Graphical view]
PfamiPF00001. 7tm_1. 1 hit.
[Graphical view]
PRINTSiPR00237. GPCRRHODOPSN.
PR00537. MUOPIOIDR.
PR00384. OPIOIDR.
PROSITEiPS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiOPRM_HUMAN
AccessioniPrimary (citable) accession number: P35372
Secondary accession number(s): B0FXJ1
, B2R9S7, B8Q1L7, B8Q1L8, B8Q1L9, E7EWZ3, G8XRH6, G8XRH8, Q12930, Q4VWM1, Q4VWM2, Q4VWM3, Q4VWM4, Q4VWM6, Q4VWX6, Q5TDA1, Q6UPP1, Q6UQ80, Q7Z2D8, Q86V80, Q8IWW3, Q8IWW4, Q9UCZ4, Q9UN57
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 1, 1994
Last sequence update: July 15, 1998
Last modified: November 30, 2016
This is version 170 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

OPRM1 is the main physiological target for most clinically important opioid analgesics. OPRM1-mediated inhibition of voltage-gated calcium channels on central presynaptic terminals of primary afferent nociceptors is thought to be one of the primary mechanisms mediating analgesia at the spinal level. Opioid-induced hyperalgesic responses are observed following both acute and chronic dosing associated with cellular excitation.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.