P35372 (OPRM_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 133.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Mu-type opioid receptor Short name=M-OR-1 Short name=MOR-1 Alternative name(s): Mu opiate receptor Mu opioid receptor Short name=MOP Short name=hMOP | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 400 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Receptor for endogenous opioids such as beta-endorphin and endomorphin. Receptor for natural and synthetic opioids including morphine, heroin, DAMGO, fentanyl, etorphine, buprenorphin and methadone. Agonist binding to the receptor induces coupling to an inactive GDP-bound heterotrimeric G-protein complex and subsequent exchange of GDP for GTP in the G-protein alpha subunit leading to dissociation of the G-protein complex with the free GTP-bound G-protein alpha and the G-protein beta-gamma dimer activating downstream cellular effectors. The agonist- and cell type-specific activity is predominantly coupled to pertussis toxin-sensitive G(i) and G(o) G alpha proteins, GNAI1, GNAI2, GNAI3 and GNAO1 isoforms Alpha-1 and Alpha-2, and to a lesser extend to pertussis toxin-insensitive G alpha proteins GNAZ and GNA15. They mediate an array of downstream cellular responses, including inhibition of adenylate cyclase activity and both N-type and L-type calcium channels, activation of inward rectifying potassium channels, mitogen-activated protein kinase (MAPK), phospholipase C (PLC), phosphoinositide/protein kinase (PKC), phosphoinositide 3-kinase (PI3K) and regulation of NF-kappa-B. Also couples to adenylate cyclase stimulatory G alpha proteins. The selective temporal coupling to G-proteins and subsequent signaling can be regulated by RGSZ proteins, such as RGS9, RGS17 and RGS4. Phosphorylation by members of the GPRK subfamily of Ser/Thr protein kinases and association with beta-arrestins is involved in short-term receptor desensitization. Beta-arrestins associate with the GPRK-phosphorylated receptor and uncouple it from the G-protein thus terminating signal transduction. The phosphorylated receptor is internalized through endocytosis via clathrin-coated pits which involves beta-arrestins. The activation of the ERK pathway occurs either in a G-protein-dependent or a beta-arrestin-dependent manner and is regulated by agonist-specific receptor phosphorylation. Acts as a class A G-protein coupled receptor (GPCR) which dissociates from beta-arrestin at or near the plasma membrane and undergoes rapid recycling. Receptor down-regulation pathways are varying with the agonist and occur dependent or independent of G-protein coupling. Endogenous ligands induce rapid desensitization, endocytosis and recycling whereas morphine induces only low desensitization and endocytosis. Heterooligomerization with other GPCRs can modulate agonist binding, signaling and trafficking properties. Involved in neurogenesis. Isoform 12 couples to GNAS and is proposed to be involved in excitatory effects. Isoform 16 and isoform 17 do not bind agonists but may act through oligomerization with binding-competent OPRM1 isoforms and reduce their ligand binding activity. Ref.31 Ref.37 |
| Subunit structure | Forms homooligomers and heterooligomers with other GPCRs, such as OPRD1, OPRK1, OPRL1, NPFFR2, ADRA2A, SSTR2, CNR1 and CCR5 (probably in dimeric forms). Interacts with PPL; the interaction disrupts agonist-mediated G-protein activation. Interacts (via C-terminus) with DNAJB4 (via C-terminus). Interacts with calmodulin; the interaction inhibits the constitutive activity of OPRM1; it abolishes basal and attenuates agonist-stimulated G-protein coupling. Interacts with FLNA, PLD2, RANBP9 and WLS. Interacts with GPM6A, RTP4, SYP, GNAS, RGS9, RGS17, RGS20, RGS4, PPP1R9B and HINT1 By similarity. Ref.20 Ref.22 Ref.24 Ref.25 Ref.27 Ref.28 Ref.29 Ref.30 Ref.31 Ref.32 Ref.33 Ref.35 Ref.36 |
| Subcellular location | |
| Tissue specificity | Expressed in brain. Isoform 16 and isoform 17 are detected in brain. Ref.31 |
| Post-translational modification | Phosphorylated. Differentially phosphorylated in basal and agonist-induced conditions. Agonist-mediated phosphorylation modulates receptor internalization. Phosphorylated by ADRBK1 in a agonist-dependent manner. Phosphorylation at Tyr-168 requires receptor activation, is dependent on non-receptor protein tyrosine kinase Src and results in a decrease in agonist efficacy by reducing G-protein coupling efficiency. Phosphorylated on tyrosine residues; the phosphorylation is involved in agoinist-induced G-protein-indepenedent receptor down-regulation. Phosphorylation at Ser-377 is involved in G-protein-dependent but not beta-arrestin-dependent activation of the ERK pathway By similarity. Ubiquitinated. A basal ubiquitination seems not to be related to degradation. Ubiquitination is increased upon formation of OPRM1:OPRD1 oligomers leading to proteasomal degradation; the ubiquitination is diminished by RTP4 By similarity. |
| Polymorphism | Variant Asp-40 does not show altered binding affinities for most opioid peptides and alkaloids tested, but it binds beta-endorphin, an endogenous opioid that activates the mu opioid receptor, approximately 3 times more tightly than the most common allelic form. |
| Miscellaneous | OPRM1 is the main physiological target for most clinically important opioid analgesics. OPRM1-mediated inhibition of voltage-gated calcium channels on central presynaptic terminals of primary afferent nociceptors is thought to be one of the primary mechanisms mediating analgesia at the spinal level. Opioid-induced hyperalgesic responses are observed following both acute and chronic dosing associated with cellular excitation. |
| Sequence similarities | Belongs to the G-protein coupled receptor 1 family. |
| Sequence caution | The sequence CAI20458.1 differs from that shown. Reason: Erroneous initiation. The sequence EAW47705.1 differs from that shown. Reason: Erroneous initiation. Isoform 9: The sequence AAQ77392.1 differs from that shown. Reason: a polymorphism leading to premature termination of translation (position: 411:Q->Stop) |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| FLNA | P21333 | 5 | EBI-2624570,EBI-350432 | |
| RANBP9 | Q96S59 | 2 | EBI-2624570,EBI-636085 | |
| WLS | Q5T9L3 | 7 | EBI-2624570,EBI-2868748 |
Alternative products
| This entry describes 17 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform 1 (identifier: P35372-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P35372-2) Also known as: MOR1A; MOR-1A; The sequence of this isoform differs from the canonical sequence as follows: 389-400: LENLEAETAPLP → VRSL | ||||||
| Isoform 3 (identifier: P35372-3) Also known as: MOR-1R; MOR-1X; The sequence of this isoform differs from the canonical sequence as follows: 389-400: LENLEAETAPLP → CLPIPSLSCWALEQGCLVVYPGPLQGPLVRYDLPAILHSSCLRGNTAPSPSGGAFLLS | ||||||
| Isoform 4 (identifier: P35372-4) Also known as: MOR-1B3; The sequence of this isoform differs from the canonical sequence as follows: 389-400: LENLEAETAPLP → GPPAKFVADQLAGSS | ||||||
| Isoform 5 (identifier: P35372-5) Also known as: MOR-1C; MOR-1O; The sequence of this isoform differs from the canonical sequence as follows: 389-400: LENLEAETAPLP → PPLAVSMAQIFTRYPPPTHREKTCNDYMKR | ||||||
| Isoform 6 (identifier: P35372-6) Also known as: MOR-1V; MOR-1Y; MOR-1Y2; MOR-1Y3; The sequence of this isoform differs from the canonical sequence as follows: 389-400: LENLEAETAPLP → IRDPISNLPRVSVF | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 7 (identifier: P35372-7) Also known as: MOR-1B1; The sequence of this isoform differs from the canonical sequence as follows: 389-400: LENLEAETAPLP → KIDLFQKSSLLNCEHTKG | ||||||
| Isoform 8 (identifier: P35372-8) Also known as: MOR-1B2; The sequence of this isoform differs from the canonical sequence as follows: 389-400: LENLEAETAPLP → RERRQKSDW | ||||||
| Isoform 9 (identifier: P35372-9) Also known as: MOR-1B5; The sequence of this isoform differs from the canonical sequence as follows: 389-400: LENLEAETAPLP → VELNLDCHCENAKPWPLSYNAGQSPFPFPGRV | ||||||
| Isoform 10 (identifier: P35372-10) Also known as: MOR-1i; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MCLHRRVPSE...SGARPAVSTM | ||||||
| Isoform 11 (identifier: P35372-11) Also known as: MOR-1B4; The sequence of this isoform differs from the canonical sequence as follows: 389-400: LENLEAETAPLP → S | ||||||
| Isoform 12 (identifier: P35372-12) Also known as: MOR-1G1; MOR-1K; The sequence of this isoform differs from the canonical sequence as follows: 1-100: Missing. | ||||||
| Isoform 13 (identifier: P35372-13) Also known as: MOR-1G2; The sequence of this isoform differs from the canonical sequence as follows: 1-96: MDSSAAPTNA...GNFLVMYVIV → MMRAKSISTKAGKPS | ||||||
| Isoform 14 (identifier: P35372-14) Also known as: Mu3; The sequence of this isoform differs from the canonical sequence as follows: 1-100: Missing. 389-400: LENLEAETAPLP → NYYIIHRCCCNTPLISQKPVLLWFCD | ||||||
| Isoform 15 (identifier: P35372-15) Also known as: MOR-1W; The sequence of this isoform differs from the canonical sequence as follows: 1-100: Missing. 389-400: LENLEAETAPLP → VRSL | ||||||
| Isoform 16 (identifier: P35372-16) Also known as: SV1; The sequence of this isoform differs from the canonical sequence as follows: 98-400: YTKMKTATNI...NLEAETAPLP → YSWFVIGGPEGRRKQRRLGEDKRARGCGEKG | ||||||
| Isoform 17 (identifier: P35372-17) Also known as: SV2; The sequence of this isoform differs from the canonical sequence as follows: 97-400: RYTKMKTATN...NLEAETAPLP → SSSWF |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 400 | 400 | Mu-type opioid receptor | PRO_0000069972 | |||||||
Regions | |||||||||||
| Topological domain | 1 – 66 | 66 | Extracellular Potential | ||||||||
| Transmembrane | 67 – 96 | 30 | Helical; Name=1; Potential | ||||||||
| Topological domain | 97 – 105 | 9 | Cytoplasmic Potential | ||||||||
| Transmembrane | 106 – 123 | 18 | Helical; Name=2; Potential | ||||||||
| Topological domain | 124 – 145 | 22 | Extracellular Potential | ||||||||
| Transmembrane | 146 – 165 | 20 | Helical; Name=3; Potential | ||||||||
| Topological domain | 166 – 195 | 30 | Cytoplasmic Potential | ||||||||
| Transmembrane | 196 – 211 | 16 | Helical; Name=4; Potential | ||||||||
| Topological domain | 212 – 236 | 25 | Extracellular Potential | ||||||||
| Transmembrane | 237 – 259 | 23 | Helical; Name=5; Potential | ||||||||
| Topological domain | 260 – 282 | 23 | Cytoplasmic Potential | ||||||||
| Transmembrane | 283 – 305 | 23 | Helical; Name=6; Potential | ||||||||
| Topological domain | 306 – 313 | 8 | Extracellular Potential | ||||||||
| Transmembrane | 314 – 330 | 17 | Helical; Name=7; Potential | ||||||||
| Topological domain | 331 – 400 | 70 | Cytoplasmic Potential | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 168 | 1 | Phosphotyrosine By similarity | ||||||||
| Modified residue | 365 | 1 | Phosphoserine By similarity | ||||||||
| Modified residue | 372 | 1 | Phosphothreonine By similarity | ||||||||
| Modified residue | 377 | 1 | Phosphoserine By similarity | ||||||||
| Lipidation | 353 | 1 | S-palmitoyl cysteine Potential | ||||||||
| Glycosylation | 9 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 12 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 33 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 40 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 48 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 142 ↔ 219 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 100 | 100 | Missing in isoform 12, isoform 14 and isoform 15. | VSP_042327 | |||||||
| Alternative sequence | 1 – 96 | 96 | MDSSA…MYVIV → MMRAKSISTKAGKPS in isoform 13. | VSP_042328 | |||||||
| Alternative sequence | 1 | 1 | M → MCLHRRVPSEETYSLDRFAQ NPPLFPPPSLPASESRMAHA PLLQRCGAARTGFCKKQQEL WQRRKEAAEALGTRKVSVLL ATSHSGARPAVSTM in isoform 10. | VSP_037693 | |||||||
| Alternative sequence | 97 – 400 | 304 | RYTKM…TAPLP → SSSWF in isoform 17. | VSP_042329 | |||||||
| Alternative sequence | 98 – 400 | 303 | YTKMK…TAPLP → YSWFVIGGPEGRRKQRRLGE DKRARGCGEKG in isoform 16. | VSP_042330 | |||||||
| Alternative sequence | 389 – 400 | 12 | LENLE…TAPLP → S in isoform 11. | VSP_037694 | |||||||
| Alternative sequence | 389 – 400 | 12 | LENLE…TAPLP → NYYIIHRCCCNTPLISQKPV LLWFCD in isoform 14. | VSP_042331 | |||||||
| Alternative sequence | 389 – 400 | 12 | LENLE…TAPLP → VRSL in isoform 2 and isoform 15. | VSP_001896 | |||||||
| Alternative sequence | 389 – 400 | 12 | LENLE…TAPLP → CLPIPSLSCWALEQGCLVVY PGPLQGPLVRYDLPAILHSS CLRGNTAPSPSGGAFLLS in isoform 3. | VSP_037695 | |||||||
| Alternative sequence | 389 – 400 | 12 | LENLE…TAPLP → GPPAKFVADQLAGSS in isoform 4. | VSP_037696 | |||||||
| Alternative sequence | 389 – 400 | 12 | LENLE…TAPLP → PPLAVSMAQIFTRYPPPTHR EKTCNDYMKR in isoform 5. | VSP_037697 | |||||||
| Alternative sequence | 389 – 400 | 12 | LENLE…TAPLP → IRDPISNLPRVSVF in isoform 6. | VSP_037698 | |||||||
| Alternative sequence | 389 – 400 | 12 | LENLE…TAPLP → KIDLFQKSSLLNCEHTKG in isoform 7. | VSP_037699 | |||||||
| Alternative sequence | 389 – 400 | 12 | LENLE…TAPLP → RERRQKSDW in isoform 8. | VSP_037700 | |||||||
| Alternative sequence | 389 – 400 | 12 | LENLE…TAPLP → VELNLDCHCENAKPWPLSYN AGQSPFPFPGRV in isoform 9. | VSP_037701 | |||||||
| Natural variant | 6 | 1 | A → V. Ref.12 Ref.17 Ref.38 Ref.39 Corresponds to variant rs1799972 [ dbSNP | Ensembl ]. | VAR_009525 | |||||||
| Natural variant | 40 | 1 | N → D in 10% of the population. Ref.2 Ref.12 Ref.38 Ref.39 Corresponds to variant rs1799971 [ dbSNP | Ensembl ]. | VAR_009524 | |||||||
| Natural variant | 63 | 1 | G → V. Corresponds to variant rs9282817 [ dbSNP | Ensembl ]. | VAR_049426 | |||||||
| Natural variant | 66 | 1 | S → F. Corresponds to variant rs9282819 [ dbSNP | Ensembl ]. | VAR_049427 | |||||||
| Natural variant | 147 | 1 | S → C Rare polymorphism. Ref.12 Ref.38 Corresponds to variant rs17174794 [ dbSNP | Ensembl ]. | VAR_009526 | |||||||
| Natural variant | 152 | 1 | N → D. Ref.12 Corresponds to variant rs17174801 [ dbSNP | Ensembl ]. | VAR_019252 | |||||||
| Natural variant | 260 | 1 | R → H Rare polymorphism. Ref.39 Corresponds to variant rs1799974 [ dbSNP | Ensembl ]. | VAR_009527 | |||||||
| Natural variant | 265 | 1 | R → C. Ref.12 Corresponds to variant rs17174822 [ dbSNP | Ensembl ]. | VAR_019253 | |||||||
| Natural variant | 274 | 1 | D → N. Ref.12 Corresponds to variant rs17174829 [ dbSNP | Ensembl ]. | VAR_019254 | |||||||
Experimental info | |||||||||||
| Mutagenesis | 142 | 1 | C → A or S: Abolishes ligand binding; when associated with A-219 or S-219. Ref.21 | ||||||||
| Mutagenesis | 219 | 1 | C → A or S: Abolishes ligand binding; when associated with A-142 or S-142. Ref.21 | ||||||||
| Mutagenesis | 273 | 1 | K → A: Impairs interaction with calmodulin. Ref.22 Ref.24 | ||||||||
| Mutagenesis | 275 | 1 | R → A: Impairs interaction with calmodulin. Ref.24 | ||||||||
| Sequence conflict | 26 | 1 | P → L in BAG36624. Ref.10 | ||||||||
| Sequence conflict | 51 | 1 | D → N in AAA20580. Ref.1 | ||||||||
| Sequence conflict | 109 | 1 | I → V in AAQ77391. Ref.6 | ||||||||
| Sequence conflict | 207 | 1 | M → I in AAB60354. Ref.2 | ||||||||
| Sequence conflict | 234 | 1 | L → V in AAA20580. Ref.1 | ||||||||
| Isoform 3: | |||||||||||
| Sequence conflict | 402 | 1 | Q → H in AAK74189. Ref.4 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Human mu opiate receptor. cDNA and genomic clones, pharmacologic characterization and chromosomal assignment." Wang J.-B., Johnson P.S., Persico A.M., Hawkins A.L., Griffin C.A., Uhl G.R. FEBS Lett. 338:217-222(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Brain. |
| [2] | "Expression of two variants of the human mu opioid receptor mRNA in SK-N-SH cells and human brain." Bare L.A., Mansson E., Yang D. FEBS Lett. 354:213-216(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), VARIANT ASP-40. Tissue: Brain. |
| [3] | "The human mu opioid receptor: modulation of functional desensitization by calcium/calmodulin-dependent protein kinase and protein kinase C." Mestek A. Jr., Hurley J.H., Bye L.S., Campbell A.D., Chen Y., Tian M., Liu J., Schulman H., Yu L. J. Neurosci. 15:2396-2406(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Brain. |
| [4] | "Identification and characterization of two new human mu opioid receptor splice variants, hMOR-1O and hMOR-1X." Pan Y.X., Xu J., Mahurter L., Xu M., Gilbert A.K., Pasternak G.W. Biochem. Biophys. Res. Commun. 301:1057-1061(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3 AND 5). |
| [5] | "Molecular identification and functional expression of mu 3, a novel alternatively spliced variant of the human mu opiate receptor gene." Cadet P., Mantione K.J., Stefano G.B. J. Immunol. 170:5118-5123(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 14). |
| [6] | "Identification and characterization of six new alternatively spliced variants of the human mu opioid receptor gene, Oprm." Pan L., Xu J., Yu R., Xu M.-M., Pan Y.-X., Pasternak G.W. Neuroscience 133:209-220(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 4; 6; 7; 8; 9 AND 11). |
| [7] | "Isolation and characterization of new exon 11-associated N-terminal splice variants of the human mu opioid receptor gene." Xu J., Xu M., Hurd Y.L., Pasternak G.W., Pan Y.X. J. Neurochem. 108:962-972(2009) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 10; 12 AND 13). |
| [8] | "Novel variants of the human mu opioid receptor are generated by alternative splicing and transcription from different positions in the OPRM1 gene." Baar C., Kvam T.-M., Rakvag T.T., Kaasa S., Skorpen F. Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 6 AND 15). Tissue: Brain. |
| [9] | "Expansion of the human mu-opioid receptor gene architecture: novel functional variants." Shabalina S.A., Zaykin D.V., Gris P., Ogurtsov A.Y., Gauthier J., Shibata K., Tchivileva I.E., Belfer I., Mishra B., Kiselycznyk C., Wallace M.R., Staud R., Spiridonov N.A., Max M.B., Goldman D., Fillingim R.B., Maixner W., Diatchenko L. Hum. Mol. Genet. 18:1037-1051(2009) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 12). Tissue: Brain. |
| [10] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [11] | "cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org)." Kopatz S.A., Aronstam R.S., Sharma S.V. Submitted (JAN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [12] | NIEHS SNPs program Submitted (NOV-2006) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS VAL-6; ASP-40; CYS-147; ASP-152; CYS-265 AND ASN-274. |
| [13] | "Isolation and characterization of two alternatively spliced variants from the human mu opioid receptor, OPRM1, gene." Xu J., Xu M., Pasternak G.W., Pan Y. Submitted (AUG-2008) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 6 AND 10). |
| [14] | "The DNA sequence and analysis of human chromosome 6." Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. Beck S.Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [15] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [16] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [17] | "An homozygous Ala 6 Val (GCC->GTC) mutation was detected on human mu opioid receptor gene of an African American individual with sickle cell anemia." Metha S., Glendenning M., Kutlar A., Kutlar F. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-20, VARIANT VAL-6. Tissue: Blood. |
| [18] | "The mu opiate receptor as a candidate gene for pain: polymorphisms, variations in expression, nociception, and opiate responses." Uhl G.R., Sora I., Wang Z. Proc. Natl. Acad. Sci. U.S.A. 96:7752-7755(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-47. |
| [19] | "Mu opioid receptor gene expression in immune cells." Chuang T.K., Killam K.F. Jr., Chuang L.F., Kung H.F., Sheng W.S., Chao C.C., Yu L., Chuang R.Y. Biochem. Biophys. Res. Commun. 216:922-930(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 229-374. |
| [20] | "ADP-ribosylation factor-dependent phospholipase D2 activation is required for agonist-induced mu-opioid receptor endocytosis." Koch T., Brandenburg L.O., Schulz S., Liang Y., Klein J., Hollt V. J. Biol. Chem. 278:9979-9985(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH PLD2. |
| [21] | "Mutation of human mu opioid receptor extracellular 'disulfide cysteine' residues alters ligand binding but does not prevent receptor targeting to the cell plasma membrane." Zhang P., Johnson P.S., Zollner C., Wang W., Wang Z., Montes A.E., Seidleck B.K., Blaschak C.J., Surratt C.K. Brain Res. Mol. Brain Res. 72:195-204(1999) [PubMed] [Europe PMC] [Abstract] Cited for: MUTAGENESIS OF CYS-142 AND CYS-219. |
| [22] | "Calmodulin binding to G protein-coupling domain of opioid receptors." Wang D., Sadee W., Quillan J.M. J. Biol. Chem. 274:22081-22088(1999) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CALMODULIN, MUTAGENESIS OF LYS-273. |
| [23] | "Molecular mechanisms and regulation of opioid receptor signaling." Law P.Y., Wong Y.H., Loh H.H. Annu. Rev. Pharmacol. Toxicol. 40:389-430(2000) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW. |
| [24] | "Calmodulin regulation of basal and agonist-stimulated G protein coupling by the mu-opioid receptor (OP(3)) in morphine-pretreated cell." Wang D., Surratt C.K., Sadee W. J. Neurochem. 75:763-771(2000) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CALMODULIN, MUTAGENESIS OF LYS-273 AND ARG-275. |
| [25] | "Interactions of opioid and chemokine receptors: oligomerization of mu, kappa, and delta with CCR5 on immune cells." Suzuki S., Chuang L.F., Yau P., Doi R.H., Chuang R.Y. Exp. Cell Res. 280:192-200(2002) [PubMed] [Europe PMC] [Abstract] Cited for: RECEPTOR HETEROOLIGOMERIZATION, INTERACTION WITH CCR5. |
| [26] | "Agonists activate Gi1 alpha or Gi2 alpha fused to the human mu opioid receptor differently." Massotte D., Brillet K., Kieffer B., Milligan G. J. Neurochem. 81:1372-1382(2002) [PubMed] [Europe PMC] [Abstract] Cited for: COUPLING TO GNAI1 AND GNAI2. |
| [27] | "Selective interactions between helix VIII of the human mu-opioid receptors and the C terminus of periplakin disrupt G protein activation." Feng G.J., Kellett E., Scorer C.A., Wilde J., White J.H., Milligan G. J. Biol. Chem. 278:33400-33407(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH PPL. |
| [28] | "Interaction between the mu opioid receptor and filamin A is involved in receptor regulation and trafficking." Onoprishvili I., Andria M.L., Kramer H.K., Ancevska-Taneva N., Hiller J.M., Simon E.J. Mol. Pharmacol. 64:1092-1100(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH FLNA. |
| [29] | "Opioid receptor homo- and heterodimerization in living cells by quantitative bioluminescence resonance energy transfer." Wang D., Sun X., Bohn L.M., Sadee W. Mol. Pharmacol. 67:2173-2184(2005) [PubMed] [Europe PMC] [Abstract] Cited for: HOMOOLIGOMERIZATION, RECEPTOR HETEROOLIGOMERIZATION, INTERACTION WITH OPRD1 AND OPRK1. |
| [30] | "Functional complementation and the analysis of opioid receptor homodimerization." Pascal G., Milligan G. Mol. Pharmacol. 68:905-915(2005) [PubMed] [Europe PMC] [Abstract] Cited for: HOMOOLIGOMERIZATION. |
| [31] | "The opioid ligand binding of human mu-opioid receptor is modulated by novel splice variants of the receptor." Choi H.S., Kim C.S., Hwang C.K., Song K.Y., Wang W., Qiu Y., Law P.Y., Wei L.N., Loh H.H. Biochem. Biophys. Res. Commun. 343:1132-1140(2006) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING (ISOFORMS 16 AND 17), FUNCTION (ISOFORMS 16 AND 17), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, SUBUNIT. |
| [32] | "A member of the heat shock protein 40 family, hlj1, binds to the carboxyl tail of the human mu opioid receptor." Ancevska-Taneva N., Onoprishvili I., Andria M.L., Hiller J.M., Simon E.J. Brain Res. 1081:28-33(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH DNAJB4. |
| [33] | "Physical association between neuropeptide FF and micro-opioid receptors as a possible molecular basis for anti-opioid activity." Roumy M., Lorenzo C., Mazeres S., Bouchet S., Zajac J.M., Mollereau C. J. Biol. Chem. 282:8332-8342(2007) [PubMed] [Europe PMC] [Abstract] Cited for: RECEPTOR HETEROOLIGOMERIZATION, INTERACTION WITH NPFFR2. |
| [34] | "Membrane functional organisation and dynamic of mu-opioid receptors." Lopez A., Salome L. Cell. Mol. Life Sci. 66:2093-2108(2009) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW. |
| [35] | "Regulation of mu opioid receptor internalization by the scaffold protein RanBPM." Talbot J.N., Skifter D.A., Bianchi E., Monaghan D.T., Toews M.L., Murrin L.C. Neurosci. Lett. 466:154-158(2009) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH RANBP9. |
| [36] | "Interaction of the mu-opioid receptor with GPR177 (Wntless) inhibits Wnt secretion: potential implications for opioid dependence." Jin J., Kittanakom S., Wong V., Reyes B.A., Van Bockstaele E.J., Stagljar I., Berrettini W., Levenson R. BMC Neurosci. 11:33-33(2010) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH WLS. |
| [37] | "A novel alternatively spliced isoform of the mu-opioid receptor: functional antagonism." Gris P., Gauthier J., Cheng P., Gibson D.G., Gris D., Laur O., Pierson J., Wentworth S., Nackley A.G., Maixner W., Diatchenko L. Mol. Pain 6:33-33(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION (ISOFORM 12), SUBCELLULAR LOCATION (ISOFORM 12). |
| [38] | "Mu opioid receptor gene variants: lack of association with alcohol dependence." Bergen A.W., Kokoszka J., Peterson R., Long J.C., Virkkunen M., Linnoila M., Goldman D. Mol. Psychiatry 2:490-494(1997) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS VAL-6; ASP-40 AND CYS-147. |
| [39] | "Single-nucleotide polymorphism in the human mu opioid receptor gene alters beta-endorphin binding and activity: possible implications for opiate addiction." Bond C., LaForge K.S., Tian M., Melia D., Zhang S., Borg L., Gong J., Schluger J., Strong J.A., Leal S.M., Tischfield J.A., Kreek M.J., Yu L. Proc. Natl. Acad. Sci. U.S.A. 95:9608-9613(1998) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS VAL-6; ASP-40 AND HIS-260. |
| + | Additional computationally mapped references. |
Web resources
| Wikipedia Mu opioid receptor entry |
| NIEHS-SNPs |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | L25119 mRNA. Translation: AAA20580.1. U12569 mRNA. Translation: AAB60354.1. L29301 mRNA. Translation: AAA73958.1. AY036622 mRNA. Translation: AAK74189.1. AY036623 mRNA. Translation: AAK74190.1. AY195733 mRNA. Translation: AAO21305.1. AY225404 mRNA. Translation: AAP44727.1. AY309001 mRNA. Translation: AAQ77385.1. AY309005 mRNA. Translation: AAQ77389.1. AY309006 mRNA. Translation: AAQ77390.1. AY309007 mRNA. Translation: AAQ77391.1. AY309008 mRNA. Translation: AAQ77392.1. AY309009 mRNA. Translation: AAQ77393.1. EU340241 mRNA. Translation: ACA49726.1. EU340242 mRNA. Translation: ACA49727.1. EU340243 mRNA. Translation: ACA49728.1. AY364230 mRNA. Translation: AAR12887.1. AY364890 mRNA. Translation: AAR11568.1. EU360599 mRNA. Translation: ABY61366.1. EU362990 mRNA. Translation: ABY66530.1. AK313901 mRNA. Translation: BAG36624.1. AY521028 mRNA. Translation: AAS00462.1. AY587764 Genomic DNA. Translation: AAS83107.1. FJ041292 mRNA. Translation: ACM90350.1. FJ041293 mRNA. Translation: ACM90351.1. FJ041294 mRNA. Translation: ACM90352.1. AL132774, AL136444 Genomic DNA. Translation: CAI20458.1. Different initiation. CH471051 Genomic DNA. Translation: EAW47705.1. Different initiation. BC074927 mRNA. Translation: AAH74927.1. AY292290 Genomic DNA. Translation: AAP44409.1. AY292291 Genomic DNA. Translation: AAP44410.1. AF153500 Genomic DNA. Translation: AAD44318.1. |
| IPI | IPI00217416. IPI00514084. IPI00922177. IPI00922430. IPI00922493. IPI00922515. IPI00922551. IPI00922644. IPI00922913. IPI00942295. IPI00943201. IPI00967650. IPI00975883. |
| PIR | I56553. S65693. |
| RefSeq | NP_000905.3. NM_000914.3. NP_001008503.2. NM_001008503.1. NP_001008504.2. NM_001008504.2. NP_001008505.2. NM_001008505.1. NP_001138751.1. NM_001145279.2. NP_001138752.1. NM_001145280.2. NP_001138753.1. NM_001145281.1. NP_001138754.1. NM_001145282.1. NP_001138755.1. NM_001145283.1. NP_001138756.1. NM_001145284.2. NP_001138757.1. NM_001145285.1. NP_001138758.1. NM_001145286.1. NP_001138759.1. NM_001145287.1. |
| UniGene | Hs.2353. |
3D structure databases | |
| DisProt | DP00272. |
| ProteinModelPortal | P35372. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P35372. 4 interactions. |
Protein family/group databases | |
| GPCRDB | Search... |
PTM databases | |
| PhosphoSite | P35372. |
Polymorphism databases | |
| DMDM | 2851402. |
Proteomic databases | |
| PaxDb | P35372. |
| PRIDE | P35372. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000229768; ENSP00000229768; ENSG00000112038. ENST00000330432; ENSP00000328264; ENSG00000112038. ENST00000337049; ENSP00000338381; ENSG00000112038. ENST00000360422; ENSP00000353598; ENSG00000112038. ENST00000414028; ENSP00000399359; ENSG00000112038. ENST00000419506; ENSP00000403549; ENSG00000112038. ENST00000428397; ENSP00000411903; ENSG00000112038. ENST00000434900; ENSP00000394624; ENSG00000112038. ENST00000435918; ENSP00000413752; ENSG00000112038. ENST00000452687; ENSP00000410497; ENSG00000112038. ENST00000518759; ENSP00000430260; ENSG00000112038. ENST00000519083; ENSP00000431048; ENSG00000112038. ENST00000520708; ENSP00000430876; ENSG00000112038. ENST00000522236; ENSP00000429373; ENSG00000112038. ENST00000522555; ENSP00000429719; ENSG00000112038. ENST00000522739; ENSP00000428018; ENSG00000112038. ENST00000524163; ENSP00000430097; ENSG00000112038. |
| GeneID | 4988. |
| KEGG | hsa:4988. |
| UCSC | uc003qpn.2. human. uc003qpo.1. human. uc003qpq.1. human. uc003qpr.2. human. uc003qpt.1. human. uc011efb.2. human. uc011eff.1. human. uc011efg.1. human. uc011efh.1. human. uc011efi.2. human. |
Organism-specific databases | |
| CTD | 4988. |
| GeneCards | GC06P154391. |
| HGNC | HGNC:8156. OPRM1. |
| HPA | HPA014509. |
| MIM | 600018. gene. |
| neXtProt | NX_P35372. |
| PharmGKB | PA31945. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG279457. |
| HOGENOM | HOG000230486. |
| HOVERGEN | HBG106919. |
| InParanoid | P35372. |
| KO | K04215. |
| OMA | HASTANT. |
| OrthoDB | EOG4KD6MF. |
Enzyme and pathway databases | |
| Pathway_Interaction_DB | il4_2pathway. IL4-mediated signaling events. |
| Reactome | REACT_111102. Signal Transduction. |
Gene expression databases | |
| ArrayExpress | P35372. |
| Bgee | P35372. |
| CleanEx | HS_OPRM1. |
| Genevestigator | P35372. |
| GermOnline | ENSG00000112038. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR000276. GPCR_Rhodpsn. IPR017452. GPCR_Rhodpsn_7TM. IPR000105. Mu_opioid_rcpt. IPR001418. Opioid_rcpt. [Graphical view] |
| Pfam | PF00001. 7tm_1. 1 hit. [Graphical view] |
| PRINTS | PR00237. GPCRRHODOPSN. PR00537. MUOPIOIDR. PR00384. OPIOIDR. |
| PROSITE | PS00237. G_PROTEIN_RECEP_F1_1. 1 hit. PS50262. G_PROTEIN_RECEP_F1_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | P35372. |
| ChEMBL | CHEMBL233. |
| DrugBank | DB00802. Alfentanil. DB00913. Anileridine. DB00921. Buprenorphine. DB00611. Butorphanol. DB00318. Codeine. DB01209. Dezocine. DB01081. Diphenoxylate. DB00813. Fentanyl. DB00956. Hydrocodone. DB00327. Hydromorphone. DB00504. Levallorphan. DB01227. Levomethadyl Acetate. DB00854. Levorphanol. DB00836. Loperamide. DB00333. Methadone. DB01433. Methadyl Acetate. DB00295. Morphine. DB00844. Nalbuphine. DB01183. Naloxone. DB00704. Naltrexone. DB00497. Oxycodone. DB01192. Oxymorphone. DB00652. Pentazocine. DB00647. Propoxyphene. DB00899. Remifentanil. DB00708. Sufentanil. DB00193. Tramadol. |
| GenomeRNAi | 4988. |
| NextBio | 19206. |
| SOURCE | Search... |
Entry information
| Entry name | OPRM_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P35372 Secondary accession number(s): B0FXJ1 Q9UN57 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| 7-transmembrane G-linked receptors List of 7-transmembrane G-linked receptor entries |
| Human chromosome 6 Human chromosome 6: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
