Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Mu-type opioid receptor

Gene

OPRM1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Receptor for endogenous opioids such as beta-endorphin and endomorphin. Receptor for natural and synthetic opioids including morphine, heroin, DAMGO, fentanyl, etorphine, buprenorphin and methadone (PubMed:7905839, PubMed:7957926, PubMed:7891175, PubMed:12589820, PubMed:9689128). Agonist binding to the receptor induces coupling to an inactive GDP-bound heterotrimeric G-protein complex and subsequent exchange of GDP for GTP in the G-protein alpha subunit leading to dissociation of the G-protein complex with the free GTP-bound G-protein alpha and the G-protein beta-gamma dimer activating downstream cellular effectors (PubMed:7905839). The agonist- and cell type-specific activity is predominantly coupled to pertussis toxin-sensitive G(i) and G(o) G alpha proteins, GNAI1, GNAI2, GNAI3 and GNAO1 isoforms Alpha-1 and Alpha-2, and to a lesser extent to pertussis toxin-insensitive G alpha proteins GNAZ and GNA15 (PubMed:12068084). They mediate an array of downstream cellular responses, including inhibition of adenylate cyclase activity and both N-type and L-type calcium channels, activation of inward rectifying potassium channels, mitogen-activated protein kinase (MAPK), phospholipase C (PLC), phosphoinositide/protein kinase (PKC), phosphoinositide 3-kinase (PI3K) and regulation of NF-kappa-B. Also couples to adenylate cyclase stimulatory G alpha proteins. The selective temporal coupling to G-proteins and subsequent signaling can be regulated by RGSZ proteins, such as RGS9, RGS17 and RGS4. Phosphorylation by members of the GPRK subfamily of Ser/Thr protein kinases and association with beta-arrestins is involved in short-term receptor desensitization. Beta-arrestins associate with the GPRK-phosphorylated receptor and uncouple it from the G-protein thus terminating signal transduction. The phosphorylated receptor is internalized through endocytosis via clathrin-coated pits which involves beta-arrestins. The activation of the ERK pathway occurs either in a G-protein-dependent or a beta-arrestin-dependent manner and is regulated by agonist-specific receptor phosphorylation. Acts as a class A G-protein coupled receptor (GPCR) which dissociates from beta-arrestin at or near the plasma membrane and undergoes rapid recycling. Receptor down-regulation pathways are varying with the agonist and occur dependent or independent of G-protein coupling. Endogenous ligands induce rapid desensitization, endocytosis and recycling whereas morphine induces only low desensitization and endocytosis. Heterooligomerization with other GPCRs can modulate agonist binding, signaling and trafficking properties. Involved in neurogenesis. Isoform 12 couples to GNAS and is proposed to be involved in excitatory effects (PubMed:20525224). Isoform 16 and isoform 17 do not bind agonists but may act through oligomerization with binding-competent OPRM1 isoforms and reduce their ligand binding activity (PubMed:16580639).2 PublicationsBy similarity9 Publications

Miscellaneous

OPRM1 is the main physiological target for most clinically important opioid analgesics. OPRM1-mediated inhibition of voltage-gated calcium channels on central presynaptic terminals of primary afferent nociceptors is thought to be one of the primary mechanisms mediating analgesia at the spinal level. Opioid-induced hyperalgesic responses are observed following both acute and chronic dosing associated with cellular excitation.

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionG-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

ReactomeiR-HSA-111885 Opioid Signalling
R-HSA-202040 G-protein activation
R-HSA-375276 Peptide ligand-binding receptors
R-HSA-418594 G alpha (i) signalling events
R-HSA-6785807 Interleukin-4 and 13 signaling
SIGNORiP35372

Protein family/group databases

TCDBi9.A.14.13.18 the g-protein-coupled receptor (gpcr) family

Names & Taxonomyi

Protein namesi
Recommended name:
Mu-type opioid receptor
Short name:
M-OR-1
Short name:
MOR-1
Alternative name(s):
Mu opiate receptor
Mu opioid receptor
Short name:
MOP
Short name:
hMOP
Gene namesi
Name:OPRM1
Synonyms:MOR1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

EuPathDBiHostDB:ENSG00000112038.17
HGNCiHGNC:8156 OPRM1
MIMi600018 gene
neXtProtiNX_P35372

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 68ExtracellularBy similarityAdd BLAST68
Transmembranei69 – 93Helical; Name=1By similarityAdd BLAST25
Topological domaini94 – 106CytoplasmicBy similarityAdd BLAST13
Transmembranei107 – 131Helical; Name=2By similarityAdd BLAST25
Topological domaini132 – 142ExtracellularBy similarityAdd BLAST11
Transmembranei143 – 165Helical; Name=3By similarityAdd BLAST23
Topological domaini166 – 185CytoplasmicBy similarityAdd BLAST20
Transmembranei186 – 207Helical; Name=4By similarityAdd BLAST22
Topological domaini208 – 230ExtracellularBy similarityAdd BLAST23
Transmembranei231 – 255Helical; Name=5By similarityAdd BLAST25
Topological domaini256 – 279CytoplasmicBy similarityAdd BLAST24
Transmembranei280 – 306Helical; Name=6By similarityAdd BLAST27
Topological domaini307 – 314ExtracellularBy similarity8
Transmembranei315 – 338Helical; Name=7By similarityAdd BLAST24
Topological domaini339 – 400CytoplasmicBy similarityAdd BLAST62

Keywords - Cellular componenti

Cell membrane, Cell projection, Cytoplasm, Endosome, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi142C → A or S: Abolishes ligand binding; when associated with A-219 or S-219. 1 Publication1
Mutagenesisi219C → A or S: Abolishes ligand binding; when associated with A-142 or S-142. 1 Publication1
Mutagenesisi273K → A: Impairs interaction with calmodulin. 2 Publications1
Mutagenesisi275R → A: Impairs interaction with calmodulin. 1 Publication1

Organism-specific databases

DisGeNETi4988
OpenTargetsiENSG00000112038
PharmGKBiPA31945

Chemistry databases

ChEMBLiCHEMBL233
DrugBankiDB01571 3-Methylfentanyl
DB01439 3-Methylthiofentanyl
DB00802 Alfentanil
DB06274 Alvimopan
DB00321 Amitriptyline
DB00913 Anileridine
DB00921 Buprenorphine
DB00611 Butorphanol
DB01535 Carfentanil
DB00318 Codeine
DB00514 Dextromethorphan
DB00647 Dextropropoxyphene
DB01209 Dezocine
DB01565 Dihydromorphine
DB01444 Dimethylthiambutene
DB01081 Diphenoxylate
DB01548 Diprenorphine
DB09272 Eluxadoline
DB05492 Epicept NP-1
DB01466 Ethylmorphine
DB01497 Etorphine
DB00813 Fentanyl
DB01452 Heroin
DB00956 Hydrocodone
DB00327 Hydromorphone
DB01221 Ketamine
DB06738 Ketobemidone
DB00504 Levallorphan
DB01227 Levomethadyl Acetate
DB00854 Levorphanol
DB05509 LI-301
DB00836 Loperamide
DB00333 Methadone
DB01433 Methadyl Acetate
DB06800 Methylnaltrexone
DB00295 Morphine
DB00844 Nalbuphine
DB09049 Naloxegol
DB01183 Naloxone
DB00704 Naltrexone
DB00904 Ondansetron
DB00497 Oxycodone
DB01192 Oxymorphone
DB00652 Pentazocine
DB00454 Pethidine
DB09396 Propoxyphene napsylate
DB00899 Remifentanil
DB00708 Sufentanil
DB06204 Tapentadol
DB00193 Tramadol
DB05046 V1003
GuidetoPHARMACOLOGYi319

Polymorphism and mutation databases

BioMutaiOPRM1
DMDMi2851402

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000699721 – 400Mu-type opioid receptorAdd BLAST400

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi9N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi12N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi33N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi40N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi48N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi142 ↔ 219PROSITE-ProRule annotation
Modified residuei168PhosphotyrosineBy similarity1
Lipidationi353S-palmitoyl cysteineSequence analysis1
Modified residuei365PhosphoserineBy similarity1
Modified residuei372PhosphothreonineBy similarity1
Modified residuei377PhosphoserineBy similarity1
Modified residuei396PhosphothreonineBy similarity1

Post-translational modificationi

Phosphorylated. Differentially phosphorylated in basal and agonist-induced conditions. Agonist-mediated phosphorylation modulates receptor internalization. Phosphorylated by GRK2 in a agonist-dependent manner. Phosphorylation at Tyr-168 requires receptor activation, is dependent on non-receptor protein tyrosine kinase Src and results in a decrease in agonist efficacy by reducing G-protein coupling efficiency. Phosphorylated on tyrosine residues; the phosphorylation is involved in agonist-induced G-protein-independent receptor down-regulation. Phosphorylation at Ser-377 is involved in G-protein-dependent but not beta-arrestin-dependent activation of the ERK pathway (By similarity).By similarity
Ubiquitinated. A basal ubiquitination seems not to be related to degradation. Ubiquitination is increased upon formation of OPRM1:OPRD1 oligomers leading to proteasomal degradation; the ubiquitination is diminished by RTP4.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Lipoprotein, Palmitate, Phosphoprotein, Ubl conjugation

Proteomic databases

PaxDbiP35372
PeptideAtlasiP35372
PRIDEiP35372
ProteomicsDBi55038
55039 [P35372-10]
55040 [P35372-11]
55041 [P35372-12]
55042 [P35372-13]
55043 [P35372-14]
55044 [P35372-15]
55045 [P35372-16]
55046 [P35372-17]
55047 [P35372-2]
55048 [P35372-3]
55049 [P35372-4]
55050 [P35372-5]
55051 [P35372-6]
55052 [P35372-7]
55053 [P35372-8]
55054 [P35372-9]

PTM databases

iPTMnetiP35372
PhosphoSitePlusiP35372
SwissPalmiP35372

Expressioni

Tissue specificityi

Expressed in brain. Isoform 16 and isoform 17 are detected in brain.1 Publication

Gene expression databases

BgeeiENSG00000112038
CleanExiHS_OPRM1
ExpressionAtlasiP35372 baseline and differential
GenevisibleiP35372 HS

Organism-specific databases

HPAiHPA014509
HPA067435

Interactioni

Subunit structurei

Forms homooligomers and heterooligomers with other GPCRs, such as OPRD1, OPRK1, OPRL1, NPFFR2, ADRA2A, SSTR2, CNR1 and CCR5 (probably in dimeric forms) (PubMed:12413885, PubMed:15778451, PubMed:15967873, PubMed:17224450). Interacts with heterotrimeric G proteins; interaction with a heterotrimeric complex containing GNAI1, GNB1 and GNG2 stabilizes the active conformation of the receptor and increases its affinity for endomorphin-2, the synthetic opioid peptide DAMGO and for morphinan agonists (By similarity). Interacts with PPL; the interaction disrupts agonist-mediated G-protein activation (PubMed:12810704). Interacts (via C-terminus) with DNAJB4 (via C-terminus) (PubMed:16542645). Interacts with calmodulin; the interaction inhibits the constitutive activity of OPRM1; it abolishes basal and attenuates agonist-stimulated G-protein coupling (PubMed:10419536, PubMed:10899953). Interacts with FLNA, PLD2, RANBP9 and WLS and GPM6A (PubMed:12519790, PubMed:14573758, PubMed:19788913, PubMed:20214800). Interacts with RTP4 (By similarity). Interacts with SYP and GNAS (By similarity). Interacts with RGS9, RGS17, RGS20, RGS4, PPP1R9B and HINT1 (By similarity).By similarity12 Publications

Binary interactionsi

Show more details

GO - Molecular functioni

Protein-protein interaction databases

BioGridi111033, 77 interactors
IntActiP35372, 58 interactors
STRINGi9606.ENSP00000394624

Chemistry databases

BindingDBiP35372

Structurei

3D structure databases

ProteinModelPortaliP35372
SMRiP35372
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi334 – 338NPxxY; plays a role in stabilizing the activated conformation of the receptorBy similarity5

Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3656 Eukaryota
ENOG410XRW9 LUCA
GeneTreeiENSGT00760000118797
HOGENOMiHOG000230486
HOVERGENiHBG106919
InParanoidiP35372
KOiK04215
OMAiSNCTDPF
OrthoDBiEOG091G0HEN
PhylomeDBiP35372
TreeFamiTF315737

Family and domain databases

CDDicd15090 7tmA_Mu_opioid_R, 1 hit
InterProiView protein in InterPro
IPR000276 GPCR_Rhodpsn
IPR017452 GPCR_Rhodpsn_7TM
IPR000105 Mu_opioid_rcpt
IPR001418 Opioid_rcpt
PfamiView protein in Pfam
PF00001 7tm_1, 1 hit
PRINTSiPR00237 GPCRRHODOPSN
PR00537 MUOPIOIDR
PR00384 OPIOIDR
PROSITEiView protein in PROSITE
PS00237 G_PROTEIN_RECEP_F1_1, 1 hit
PS50262 G_PROTEIN_RECEP_F1_2, 1 hit

Sequences (18)i

Sequence statusi: Complete.

This entry describes 18 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.
Isoform 1 (identifier: P35372-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDSSAAPTNA SNCTDALAYS SCSPAPSPGS WVNLSHLDGN LSDPCGPNRT
60 70 80 90 100
DLGGRDSLCP PTGSPSMITA ITIMALYSIV CVVGLFGNFL VMYVIVRYTK
110 120 130 140 150
MKTATNIYIF NLALADALAT STLPFQSVNY LMGTWPFGTI LCKIVISIDY
160 170 180 190 200
YNMFTSIFTL CTMSVDRYIA VCHPVKALDF RTPRNAKIIN VCNWILSSAI
210 220 230 240 250
GLPVMFMATT KYRQGSIDCT LTFSHPTWYW ENLLKICVFI FAFIMPVLII
260 270 280 290 300
TVCYGLMILR LKSVRMLSGS KEKDRNLRRI TRMVLVVVAV FIVCWTPIHI
310 320 330 340 350
YVIIKALVTI PETTFQTVSW HFCIALGYTN SCLNPVLYAF LDENFKRCFR
360 370 380 390 400
EFCIPTSSNI EQQNSTRIRQ NTRDHPSTAN TVDRTNHQLE NLEAETAPLP
Length:400
Mass (Da):44,779
Last modified:July 15, 1998 - v2
Checksum:i1DABEBEC9AFF6F66
GO
Isoform 2 (identifier: P35372-2) [UniParc]FASTAAdd to basket
Also known as: MOR1A, MOR-1A

The sequence of this isoform differs from the canonical sequence as follows:
     389-400: LENLEAETAPLP → VRSL

Show »
Length:392
Mass (Da):43,957
Checksum:i14184C69F06AFCBE
GO
Isoform 3 (identifier: P35372-3) [UniParc]FASTAAdd to basket
Also known as: MOR-1R, MOR-1X

The sequence of this isoform differs from the canonical sequence as follows:
     389-400: LENLEAETAPLP → CLPIPSLSCWALEQGCLVVYPGPLQGPLVRYDLPAILHSSCLRGNTAPSPSGGAFLLS

Show »
Length:446
Mass (Da):49,520
Checksum:i42DC76968E6352A8
GO
Isoform 4 (identifier: P35372-4) [UniParc]FASTAAdd to basket
Also known as: MOR-1B3

The sequence of this isoform differs from the canonical sequence as follows:
     389-400: LENLEAETAPLP → GPPAKFVADQLAGSS

Show »
Length:403
Mass (Da):44,928
Checksum:iB3FFA10F7B1C5311
GO
Isoform 5 (identifier: P35372-5) [UniParc]FASTAAdd to basket
Also known as: MOR-1C, MOR-1O

The sequence of this isoform differs from the canonical sequence as follows:
     389-400: LENLEAETAPLP → PPLAVSMAQIFTRYPPPTHREKTCNDYMKR

Show »
Length:418
Mass (Da):47,032
Checksum:i51B9E7B131122196
GO
Isoform 6 (identifier: P35372-6) [UniParc]FASTAAdd to basket
Also known as: MOR-1V, MOR-1Y, MOR-1Y2, MOR-1Y3

The sequence of this isoform differs from the canonical sequence as follows:
     389-400: LENLEAETAPLP → IRDPISNLPRVSVF

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:402
Mass (Da):45,096
Checksum:i5BC8380AB8196D70
GO
Isoform 7 (identifier: P35372-7) [UniParc]FASTAAdd to basket
Also known as: MOR-1B1

The sequence of this isoform differs from the canonical sequence as follows:
     389-400: LENLEAETAPLP → KIDLFQKSSLLNCEHTKG

Show »
Length:406
Mass (Da):45,544
Checksum:i1A0330578A82B183
GO
Isoform 8 (identifier: P35372-8) [UniParc]FASTAAdd to basket
Also known as: MOR-1B2

The sequence of this isoform differs from the canonical sequence as follows:
     389-400: LENLEAETAPLP → RERRQKSDW

Show »
Length:397
Mass (Da):44,743
Checksum:i3BC7E1C19B9739E3
GO
Isoform 9 (identifier: P35372-9) [UniParc]FASTAAdd to basket
Also known as: MOR-1B5

The sequence of this isoform differs from the canonical sequence as follows:
     389-400: LENLEAETAPLP → VELNLDCHCENAKPWPLSYNAGQSPFPFPGRV

Show »
Length:420
Mass (Da):47,070
Checksum:i63301322222198DE
GO
Isoform 10 (identifier: P35372-10) [UniParc]FASTAAdd to basket
Also known as: MOR-1i

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MCLHRRVPSE...SGARPAVSTM

Show »
Length:493
Mass (Da):55,045
Checksum:i14A90F782A013067
GO
Isoform 11 (identifier: P35372-11) [UniParc]FASTAAdd to basket
Also known as: MOR-1B4

The sequence of this isoform differs from the canonical sequence as follows:
     389-400: LENLEAETAPLP → S

Show »
Length:389
Mass (Da):43,588
Checksum:i7E806AFCBE572CD5
GO
Isoform 12 (identifier: P35372-12) [UniParc]FASTAAdd to basket
Also known as: MOR-1G1, MOR-1K

The sequence of this isoform differs from the canonical sequence as follows:
     1-100: Missing.

Show »
Length:300
Mass (Da):34,393
Checksum:i03FE8402349A629C
GO
Isoform 13 (identifier: P35372-13) [UniParc]FASTAAdd to basket
Also known as: MOR-1G2

The sequence of this isoform differs from the canonical sequence as follows:
     1-96: MDSSAAPTNA...GNFLVMYVIV → MMRAKSISTKAGKPS

Show »
Length:319
Mass (Da):36,516
Checksum:i6373C1D800FF5E53
GO
Isoform 14 (identifier: P35372-14) [UniParc]FASTAAdd to basket
Also known as: Mu3

The sequence of this isoform differs from the canonical sequence as follows:
     1-100: Missing.
     389-400: LENLEAETAPLP → NYYIIHRCCCNTPLISQKPVLLWFCD

Show »
Length:314
Mass (Da):36,240
Checksum:i7346DB61E594896E
GO
Isoform 15 (identifier: P35372-15) [UniParc]FASTAAdd to basket
Also known as: MOR-1W

The sequence of this isoform differs from the canonical sequence as follows:
     1-100: Missing.
     389-400: LENLEAETAPLP → VRSL

Show »
Length:292
Mass (Da):33,570
Checksum:i62A80E8005705E4C
GO
Isoform 16 (identifier: P35372-16) [UniParc]FASTAAdd to basket
Also known as: SV1

The sequence of this isoform differs from the canonical sequence as follows:
     98-400: YTKMKTATNI...NLEAETAPLP → YSWFVIGGPEGRRKQRRLGEDKRARGCGEKG

Show »
Length:128
Mass (Da):13,544
Checksum:i1E780EE294726795
GO
Isoform 17 (identifier: P35372-17) [UniParc]FASTAAdd to basket
Also known as: SV2

The sequence of this isoform differs from the canonical sequence as follows:
     97-400: RYTKMKTATN...NLEAETAPLP → SSSWF

Show »
Length:101
Mass (Da):10,451
Checksum:iE6590D98EDF64171
GO
Isoform 18 (identifier: P35372-18) [UniParc]FASTAAdd to basket
Also known as: hMOR-1Z

The sequence of this isoform differs from the canonical sequence as follows:
     98-186: YTKMKTATNI...ALDFRTPRNA → FHRLYTNILS...LDSHSHLRHH
     187-400: Missing.

Show »
Length:186
Mass (Da):20,188
Checksum:i2A80DD5FADA6B83B
GO

Sequence cautioni

Isoform 9 : The sequence AAQ77392 differs from that shown. a polymorphism leading to premature termination of translation (position: 411:Q->Stop)Curated
The sequence CAI20458 differs from that shown. Reason: Erroneous initiation.Curated
The sequence EAW47705 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti26P → L in BAG36624 (PubMed:14702039).Curated1
Sequence conflicti51D → N in AAA20580 (PubMed:7905839).Curated1
Sequence conflicti109I → V in AAQ77391 (PubMed:15893644).Curated1
Sequence conflicti207M → I in AAB60354 (PubMed:7957926).Curated1
Sequence conflicti234L → V in AAA20580 (PubMed:7905839).Curated1
Isoform 3 (identifier: P35372-3)
Sequence conflicti402Q → H in AAK74189 (PubMed:12589820).Curated1

Polymorphismi

Variant Asp-40 does not show altered binding affinities for most opioid peptides and alkaloids tested, but it binds beta-endorphin, an endogenous opioid that activates the mu opioid receptor, approximately 3 times more tightly than the most common allelic form.1 Publication

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0095256A → V4 PublicationsCorresponds to variant dbSNP:rs1799972Ensembl.1
Natural variantiVAR_00952440N → D in 10% of the population. 4 PublicationsCorresponds to variant dbSNP:rs1799971EnsemblClinVar.1
Natural variantiVAR_04942663G → V. Corresponds to variant dbSNP:rs9282817Ensembl.1
Natural variantiVAR_04942766S → F. Corresponds to variant dbSNP:rs9282819Ensembl.1
Natural variantiVAR_009526147S → C Rare polymorphism. 2 PublicationsCorresponds to variant dbSNP:rs17174794Ensembl.1
Natural variantiVAR_019252152N → D1 PublicationCorresponds to variant dbSNP:rs17174801Ensembl.1
Natural variantiVAR_009527260R → H Rare polymorphism. 1 PublicationCorresponds to variant dbSNP:rs1799974Ensembl.1
Natural variantiVAR_019253265R → C1 PublicationCorresponds to variant dbSNP:rs17174822Ensembl.1
Natural variantiVAR_019254274D → N1 PublicationCorresponds to variant dbSNP:rs17174829Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0423271 – 100Missing in isoform 12, isoform 14 and isoform 15. 4 PublicationsAdd BLAST100
Alternative sequenceiVSP_0423281 – 96MDSSA…MYVIV → MMRAKSISTKAGKPS in isoform 13. 1 PublicationAdd BLAST96
Alternative sequenceiVSP_0376931M → MCLHRRVPSEETYSLDRFAQ NPPLFPPPSLPASESRMAHA PLLQRCGAARTGFCKKQQEL WQRRKEAAEALGTRKVSVLL ATSHSGARPAVSTM in isoform 10. 2 Publications1
Alternative sequenceiVSP_04232997 – 400RYTKM…TAPLP → SSSWF in isoform 17. CuratedAdd BLAST304
Alternative sequenceiVSP_04233098 – 400YTKMK…TAPLP → YSWFVIGGPEGRRKQRRLGE DKRARGCGEKG in isoform 16. CuratedAdd BLAST303
Alternative sequenceiVSP_04757798 – 186YTKMK…TPRNA → FHRLYTNILSSNLVLGKPAE DLCFHLRLHYASAHHYRVLW TDDLAPQECPHALWLQRKGQ ESSKDHQDGAGGGGCVHRLL DSHSHLRHH in isoform 18. 1 PublicationAdd BLAST89
Alternative sequenceiVSP_047578187 – 400Missing in isoform 18. 1 PublicationAdd BLAST214
Alternative sequenceiVSP_037694389 – 400LENLE…TAPLP → S in isoform 11. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_042331389 – 400LENLE…TAPLP → NYYIIHRCCCNTPLISQKPV LLWFCD in isoform 14. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_001896389 – 400LENLE…TAPLP → VRSL in isoform 2 and isoform 15. 3 PublicationsAdd BLAST12
Alternative sequenceiVSP_037695389 – 400LENLE…TAPLP → CLPIPSLSCWALEQGCLVVY PGPLQGPLVRYDLPAILHSS CLRGNTAPSPSGGAFLLS in isoform 3. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_037696389 – 400LENLE…TAPLP → GPPAKFVADQLAGSS in isoform 4. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_037697389 – 400LENLE…TAPLP → PPLAVSMAQIFTRYPPPTHR EKTCNDYMKR in isoform 5. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_037698389 – 400LENLE…TAPLP → IRDPISNLPRVSVF in isoform 6. 3 PublicationsAdd BLAST12
Alternative sequenceiVSP_037699389 – 400LENLE…TAPLP → KIDLFQKSSLLNCEHTKG in isoform 7. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_037700389 – 400LENLE…TAPLP → RERRQKSDW in isoform 8. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_037701389 – 400LENLE…TAPLP → VELNLDCHCENAKPWPLSYN AGQSPFPFPGRV in isoform 9. 1 PublicationAdd BLAST12

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L25119 mRNA Translation: AAA20580.1
U12569 mRNA Translation: AAB60354.1
L29301 mRNA Translation: AAA73958.1
AY036622 mRNA Translation: AAK74189.1
AY036623 mRNA Translation: AAK74190.1
AY195733 mRNA Translation: AAO21305.1
AY225404 mRNA Translation: AAP44727.1
AY309001 mRNA Translation: AAQ77385.1
AY309005 mRNA Translation: AAQ77389.1
AY309006 mRNA Translation: AAQ77390.1
AY309007 mRNA Translation: AAQ77391.1
AY309008 mRNA Translation: AAQ77392.1
AY309009 mRNA Translation: AAQ77393.1
EU340241 mRNA Translation: ACA49726.1
EU340242 mRNA Translation: ACA49727.1
EU340243 mRNA Translation: ACA49728.1
AY364230 mRNA Translation: AAR12887.1
AY364890 mRNA Translation: AAR11568.1
HQ699462 mRNA Translation: AET97615.1
EU360599 mRNA Translation: ABY61366.1
EU362990 mRNA Translation: ABY66530.1
AK313901 mRNA Translation: BAG36624.1
AY521028 mRNA Translation: AAS00462.1
AY587764 Genomic DNA Translation: AAS83107.1
FJ041292 mRNA Translation: ACM90350.1
FJ041293 mRNA Translation: ACM90351.1
FJ041294 mRNA Translation: ACM90352.1
AL132774, AL136444 Genomic DNA Translation: CAI20458.1 Different initiation.
AL445220 Genomic DNA No translation available.
CH471051 Genomic DNA Translation: EAW47705.1 Different initiation.
BC074927 mRNA Translation: AAH74927.1
AY292290 Genomic DNA Translation: AAP44409.1
AY292291 Genomic DNA Translation: AAP44410.1
AF153500 Genomic DNA Translation: AAD44318.1
CCDSiCCDS43517.1 [P35372-5]
CCDS43518.1 [P35372-3]
CCDS47503.1 [P35372-10]
CCDS47504.1 [P35372-7]
CCDS47505.1 [P35372-8]
CCDS47506.1 [P35372-4]
CCDS47507.1 [P35372-9]
CCDS47508.1 [P35372-2]
CCDS55068.1 [P35372-13]
CCDS55069.1 [P35372-11]
CCDS55070.1 [P35372-1]
CCDS55071.1 [P35372-12]
PIRiI56553
S65693
RefSeqiNP_000905.3, NM_000914.4 [P35372-1]
NP_001008503.2, NM_001008503.2 [P35372-5]
NP_001008504.2, NM_001008504.3 [P35372-2]
NP_001008505.2, NM_001008505.2 [P35372-3]
NP_001138751.1, NM_001145279.3 [P35372-10]
NP_001138752.1, NM_001145280.3 [P35372-12]
NP_001138753.1, NM_001145281.2 [P35372-13]
NP_001138754.1, NM_001145282.2 [P35372-7]
NP_001138755.1, NM_001145283.2 [P35372-8]
NP_001138756.1, NM_001145284.3 [P35372-4]
NP_001138757.1, NM_001145285.2 [P35372-11]
NP_001138758.1, NM_001145286.2 [P35372-9]
NP_001138759.1, NM_001145287.2 [P35372-12]
NP_001272452.1, NM_001285523.2
NP_001272453.1, NM_001285524.1 [P35372-10]
NP_001272455.1, NM_001285526.1 [P35372-12]
NP_001272456.1, NM_001285527.1 [P35372-15]
NP_001272457.1, NM_001285528.2 [P35372-14]
XP_016866395.1, XM_017010906.1 [P35372-12]
UniGeneiHs.2353

Genome annotation databases

EnsembliENST00000229768; ENSP00000229768; ENSG00000112038 [P35372-3]
ENST00000330432; ENSP00000328264; ENSG00000112038 [P35372-1]
ENST00000337049; ENSP00000338381; ENSG00000112038 [P35372-5]
ENST00000414028; ENSP00000399359; ENSG00000112038 [P35372-4]
ENST00000419506; ENSP00000403549; ENSG00000112038 [P35372-9]
ENST00000428397; ENSP00000411903; ENSG00000112038 [P35372-2]
ENST00000434900; ENSP00000394624; ENSG00000112038 [P35372-10]
ENST00000435918; ENSP00000413752; ENSG00000112038 [P35372-8]
ENST00000452687; ENSP00000410497; ENSG00000112038 [P35372-7]
ENST00000518759; ENSP00000430260; ENSG00000112038 [P35372-13]
ENST00000519083; ENSP00000431048; ENSG00000112038 [P35372-6]
ENST00000520708; ENSP00000430876; ENSG00000112038 [P35372-12]
ENST00000522236; ENSP00000429373; ENSG00000112038 [P35372-12]
ENST00000522555; ENSP00000429719; ENSG00000112038 [P35372-12]
ENST00000522739; ENSP00000428018; ENSG00000112038 [P35372-6]
ENST00000524150; ENSP00000430575; ENSG00000112038 [P35372-18]
ENST00000524163; ENSP00000430097; ENSG00000112038 [P35372-11]
GeneIDi4988
KEGGihsa:4988
UCSCiuc003qpn.4 human [P35372-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiOPRM_HUMAN
AccessioniPrimary (citable) accession number: P35372
Secondary accession number(s): B0FXJ1
, B2R9S7, B8Q1L7, B8Q1L8, B8Q1L9, E7EWZ3, G8XRH6, G8XRH8, Q12930, Q4VWM1, Q4VWM2, Q4VWM3, Q4VWM4, Q4VWM6, Q4VWX6, Q5TDA1, Q6UPP1, Q6UQ80, Q7Z2D8, Q86V80, Q8IWW3, Q8IWW4, Q9UCZ4, Q9UN57
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 1, 1994
Last sequence update: July 15, 1998
Last modified: June 20, 2018
This is version 182 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health