Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Alpha-1A adrenergic receptor

Gene

ADRA1A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

This alpha-adrenergic receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Its effect is mediated by G(q) and G(11) proteins. Nuclear ADRA1A-ADRA1B heterooligomers regulate phenylephrine(PE)-stimulated ERK signaling in cardiac myocytes.2 Publications

GO - Molecular functioni

  1. alpha1-adrenergic receptor activity Source: UniProtKB
  2. protein heterodimerization activity Source: UniProtKB

GO - Biological processi

  1. activation of phospholipase C activity Source: BHF-UCL
  2. adrenergic receptor signaling pathway Source: GOC
  3. adult heart development Source: Ensembl
  4. aging Source: BHF-UCL
  5. apoptotic process Source: ProtInc
  6. calcium ion transport into cytosol Source: BHF-UCL
  7. cell-cell signaling Source: ProtInc
  8. cell growth Source: Ensembl
  9. G-protein coupled receptor signaling pathway Source: ProtInc
  10. intracellular signal transduction Source: ProtInc
  11. micturition Source: Ensembl
  12. negative regulation of cell proliferation Source: ProtInc
  13. negative regulation of heart rate involved in baroreceptor response to increased systemic arterial blood pressure Source: Ensembl
  14. negative regulation of Rho protein signal transduction Source: BHF-UCL
  15. norepinephrine-epinephrine vasoconstriction involved in regulation of systemic arterial blood pressure Source: Ensembl
  16. organ growth Source: Ensembl
  17. phospholipase C-activating G-protein coupled receptor signaling pathway Source: Ensembl
  18. pilomotor reflex Source: Ensembl
  19. positive regulation of action potential Source: BHF-UCL
  20. positive regulation of cardiac muscle contraction Source: BHF-UCL
  21. positive regulation of cytosolic calcium ion concentration Source: BHF-UCL
  22. positive regulation of ERK1 and ERK2 cascade Source: BHF-UCL
  23. positive regulation of heart rate by epinephrine-norepinephrine Source: Ensembl
  24. positive regulation of MAPK cascade Source: UniProtKB
  25. positive regulation of protein kinase C signaling Source: BHF-UCL
  26. positive regulation of smooth muscle contraction Source: Ensembl
  27. positive regulation of synaptic transmission, GABAergic Source: BHF-UCL
  28. positive regulation of systemic arterial blood pressure Source: Ensembl
  29. positive regulation of the force of heart contraction by epinephrine-norepinephrine Source: Ensembl
  30. positive regulation of vasoconstriction Source: BHF-UCL
  31. response to drug Source: BHF-UCL
  32. response to hormone Source: BHF-UCL
  33. signal transduction Source: ProtInc
  34. smooth muscle contraction Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

ReactomeiREACT_16927. Adrenoceptors.
REACT_18283. G alpha (q) signalling events.
REACT_18407. G alpha (12/13) signalling events.
SignaLinkiP35348.

Names & Taxonomyi

Protein namesi
Recommended name:
Alpha-1A adrenergic receptor
Alternative name(s):
Alpha-1A adrenoreceptor
Short name:
Alpha-1A adrenoceptor
Alpha-1C adrenergic receptor
Alpha-adrenergic receptor 1c
Gene namesi
Name:ADRA1A
Synonyms:ADRA1C
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 8

Organism-specific databases

HGNCiHGNC:277. ADRA1A.

Subcellular locationi

Nucleus membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein
Note: Location at the nuclear membrane facilitates heterooligomerization and regulates ERK-mediated signaling in cardiac myocytes. Colocalizes with GNAQ, PLCB1 as well as LAP2 at the nuclear membrane of cardiac myocytes.

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 2727ExtracellularBy similarityAdd
BLAST
Transmembranei28 – 5124Helical; Name=1By similarityAdd
BLAST
Topological domaini52 – 6413CytoplasmicBy similarityAdd
BLAST
Transmembranei65 – 8824Helical; Name=2By similarityAdd
BLAST
Topological domaini89 – 9911ExtracellularBy similarityAdd
BLAST
Transmembranei100 – 12223Helical; Name=3By similarityAdd
BLAST
Topological domaini123 – 14321CytoplasmicBy similarityAdd
BLAST
Transmembranei144 – 16724Helical; Name=4By similarityAdd
BLAST
Topological domaini168 – 18114ExtracellularBy similarityAdd
BLAST
Transmembranei182 – 20524Helical; Name=5By similarityAdd
BLAST
Topological domaini206 – 27368CytoplasmicBy similarityAdd
BLAST
Transmembranei274 – 29724Helical; Name=6By similarityAdd
BLAST
Topological domaini298 – 3058ExtracellularBy similarity
Transmembranei306 – 32924Helical; Name=7By similarityAdd
BLAST
Topological domaini330 – 466137CytoplasmicBy similarityAdd
BLAST

GO - Cellular componenti

  1. integral component of plasma membrane Source: ProtInc
  2. nuclear membrane Source: UniProtKB
  3. nucleus Source: UniProtKB
  4. plasma membrane Source: Reactome
  5. T-tubule Source: Ensembl
  6. Z disc Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi334 – 3341K → A: Abolishes targeting to the nuclear membrane of cardiac myocytes; when associated with A-335; A-342; A-348 and A-349. 1 Publication
Mutagenesisi335 – 3351K → A: Abolishes targeting to the nuclear membrane of cardiac myocytes; when associated with A-334; A-342; A-348 and A-349. 1 Publication
Mutagenesisi342 – 3421R → A: Abolishes targeting to the nuclear membrane of cardiac myocytes; when associated with A-334; A-335; A-348 and A-349. 1 Publication
Mutagenesisi348 – 3481R → A: Abolishes targeting to the nuclear membrane of cardiac myocytes; when associated with A-334; A-335; A-342 and A-349. 1 Publication
Mutagenesisi349 – 3491K → A: Abolishes targeting to the nuclear membrane of cardiac myocytes; when associated with A-334; A-335; A-342 and A-348. 1 Publication

Organism-specific databases

PharmGKBiPA34.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 466466Alpha-1A adrenergic receptorPRO_0000069063Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi7 – 71N-linked (GlcNAc...)Sequence Analysis
Glycosylationi13 – 131N-linked (GlcNAc...)Sequence Analysis
Glycosylationi22 – 221N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi99 ↔ 176PROSITE-ProRule annotation
Modified residuei215 – 2151Phosphoserine; by PKASequence Analysis
Lipidationi345 – 3451S-palmitoyl cysteineSequence Analysis

Post-translational modificationi

C-terminal Ser or Thr residues may be phosphorylated.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

PaxDbiP35348.
PRIDEiP35348.

PTM databases

PhosphoSiteiP35348.

Expressioni

Tissue specificityi

Expressed in heart, brain, liver and prostate, but not in kidney, lung, adrenal, aorta and pituitary. Within the prostate, expressed in the apex, base, periurethral and lateral lobe. Isoform 4 is the most abundant isoform expressed in the prostate with high levels also detected in liver and heart.3 Publications

Gene expression databases

BgeeiP35348.
CleanExiHS_ADRA1A.
ExpressionAtlasiP35348. baseline and differential.
GenevestigatoriP35348.

Organism-specific databases

HPAiHPA029678.
HPA029679.

Interactioni

Subunit structurei

Homo- and heterooligomer. Heterooligomerizes with ADRA1B homooligomers in cardiac myocytes.1 Publication

Protein-protein interaction databases

DIPiDIP-33401N.
IntActiP35348. 3 interactions.

Structurei

3D structure databases

ProteinModelPortaliP35348.
SMRiP35348. Positions 29-341.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi334 – 34916Nuclear localization signalAdd
BLAST

Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family. Adrenergic receptor subfamily. ADRA1A sub-subfamily.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG253615.
GeneTreeiENSGT00760000118795.
HOVERGENiHBG106962.
InParanoidiP35348.
KOiK04135.
OMAiEGQHKDM.
OrthoDBiEOG7H4DTB.
PhylomeDBiP35348.
TreeFamiTF331895.

Family and domain databases

InterProiIPR002233. ADR_fam.
IPR001004. ADRA1A_rcpt.
IPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
[Graphical view]
PfamiPF00001. 7tm_1. 1 hit.
[Graphical view]
PRINTSiPR01103. ADRENERGICR.
PR00557. ADRENRGCA1AR.
PR00237. GPCRRHODOPSN.
PROSITEiPS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]

Sequences (9)i

Sequence statusi: Complete.

This entry describes 9 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P35348-1) [UniParc]FASTAAdd to basket

Also known as: Alpha 1c-1, Alpha(1A-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVFLSGNASD SSNCTQPPAP VNISKAILLG VILGGLILFG VLGNILVILS
60 70 80 90 100
VACHRHLHSV THYYIVNLAV ADLLLTSTVL PFSAIFEVLG YWAFGRVFCN
110 120 130 140 150
IWAAVDVLCC TASIMGLCII SIDRYIGVSY PLRYPTIVTQ RRGLMALLCV
160 170 180 190 200
WALSLVISIG PLFGWRQPAP EDETICQINE EPGYVLFSAL GSFYLPLAII
210 220 230 240 250
LVMYCRVYVV AKRESRGLKS GLKTDKSDSE QVTLRIHRKN APAGGSGMAS
260 270 280 290 300
AKTKTHFSVR LLKFSREKKA AKTLGIVVGC FVLCWLPFFL VMPIGSFFPD
310 320 330 340 350
FKPSETVFKI VFWLGYLNSC INPIIYPCSS QEFKKAFQNV LRIQCLCRKQ
360 370 380 390 400
SSKHALGYTL HPPSQAVEGQ HKDMVRIPVG SRETFYRISK TDGVCEWKFF
410 420 430 440 450
SSMPRGSARI TVSKDQSSCT TARVRSKSFL QVCCCVGPST PSLDKNHQVP
460
TIKVHTISLS ENGEEV
Length:466
Mass (Da):51,487
Last modified:November 1, 1995 - v2
Checksum:i1A50487531DECDF0
GO
Isoform 2 (identifier: P35348-2) [UniParc]FASTAAdd to basket

Also known as: Alpha 1c-2, Alpha(1A-2)

The sequence of this isoform differs from the canonical sequence as follows:
     424-466: VRSKSFLQVC...ISLSENGEEV → TKSRSVTRLE...CHQADATRPS

Show »
Length:475
Mass (Da):52,205
Checksum:iDE3CEEDD1AB3E56D
GO
Isoform 3 (identifier: P35348-3) [UniParc]FASTAAdd to basket

Also known as: Alpha 1c-3, Alpha(1A-3)

The sequence of this isoform differs from the canonical sequence as follows:
     424-429: VRSKSF → GHTPMT
     430-466: Missing.

Show »
Length:429
Mass (Da):47,461
Checksum:iE67B19B5CA668687
GO
Isoform 4 (identifier: P35348-4) [UniParc]FASTAAdd to basket

Also known as: Alpha(1A-4)

The sequence of this isoform differs from the canonical sequence as follows:
     424-466: VRSKSFLQVCCCVGPSTPSLDKNHQVPTIKVHTISLSENGEEV → RGMDCRYFTKNCREHIKHVNFMMPPWRKGSEC

Show »
Length:455
Mass (Da):50,777
Checksum:i80C61B88FA608B6C
GO
Isoform 5 (identifier: P35348-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     296-297: SF → KS
     298-466: Missing.

Show »
Length:297
Mass (Da):32,433
Checksum:i4871F9BE42A87D6E
GO
Isoform 6 (identifier: P35348-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     295-342: GSFFPDFKPS...FKKAFQNVLR → DEETEAQEGK...VSRKDTCGVW
     343-466: Missing.

Show »
Length:342
Mass (Da):37,468
Checksum:i2B6E7CC81B9CBE50
GO
Isoform 7 (identifier: P35348-7) [UniParc]FASTAAdd to basket

Also known as: 2b/3b

The sequence of this isoform differs from the canonical sequence as follows:
     296-324: SFFPDFKPSETVFKIVFWLGYLNSCINPI → TYILKYDVLFWRKGLSVCTRLRERKEIKN
     325-466: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:324
Mass (Da):35,829
Checksum:i608DACD5497EE83E
GO
Isoform 8 (identifier: P35348-8) [UniParc]FASTAAdd to basket

Also known as: 2c

The sequence of this isoform differs from the canonical sequence as follows:
     295-466: GSFFPDFKPS...ISLSENGEEV → DEVSLCHQAG...GQDDLDLLTS

Show »
Length:370
Mass (Da):40,725
Checksum:iF00E717A4C4A59AC
GO
Isoform 9 (identifier: P35348-9) [UniParc]FASTAAdd to basket

Also known as: 3c

The sequence of this isoform differs from the canonical sequence as follows:
     296-466: SFFPDFKPSE...ISLSENGEEV → THTHDMKPAS...TVTDTGKTVT

Show »
Length:372
Mass (Da):40,638
Checksum:i839C5750F9B428F5
GO

Sequence cautioni

Isoform 2 : The sequence ACA05900.1 differs from that shown. Reason: Erroneous gene model prediction. Curated
Isoform 2 : The sequence BAA06901.1 differs from that shown. Reason: Frameshift at position 465. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti43 – 431G → C in AAA93114 (PubMed:8564208).Curated
Sequence conflicti129 – 1291S → T in AAA93114 (PubMed:8564208).Curated
Sequence conflicti130 – 1301Y → H in AAK77197 (Ref. 9) Curated
Sequence conflicti185 – 1851V → A in AAH95512 (PubMed:15489334).Curated
Sequence conflicti338 – 3381Q → C (PubMed:8024574).Curated
Sequence conflicti359 – 3591T → P in AAA93114 (PubMed:8564208).Curated
Sequence conflicti384 – 3841T → A in AAK77197 (Ref. 9) Curated
Sequence conflicti387 – 3871R → G in AAK77197 (Ref. 9) Curated
Sequence conflicti390 – 3901K → R in AAK77197 (Ref. 9) Curated
Sequence conflicti431 – 4311Q → E in BAA04960 (PubMed:8396931).Curated
Sequence conflicti437 – 4371G → E in AAK77197 (Ref. 9) Curated
Sequence conflicti442 – 4421S → C in AAA93114 (PubMed:8564208).Curated
Isoform 6 (identifier: P35348-6)
Sequence conflicti302 – 3021E → Q in AAR84650 (PubMed:10493934).Curated
Isoform 4 (identifier: P35348-4)
Sequence conflicti453 – 4531S → L in AAC06138 (PubMed:9490024).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti40 – 401G → W in a breast cancer sample; somatic mutation. 1 Publication
VAR_035756
Natural varianti200 – 2001I → S.
Corresponds to variant rs2229125 [ dbSNP | Ensembl ].
VAR_049370
Natural varianti347 – 3471C → R Frequent polymorphism. 9 Publications
Corresponds to variant rs1048101 [ dbSNP | Ensembl ].
VAR_019509
Natural varianti414 – 4141K → R.
Corresponds to variant rs3730247 [ dbSNP | Ensembl ].
VAR_049371
Natural varianti465 – 4651E → D.
Corresponds to variant rs2229126 [ dbSNP | Ensembl ].
VAR_049372

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei295 – 466172GSFFP…NGEEV → DEVSLCHQAGVQWHDLGSLQ PPPPGFKRFSCLSLPSSWDY RDVPPGRRHQAQLIFVFLVE TGFHHVGQDDLDLLTS in isoform 8. 1 PublicationVSP_011046Add
BLAST
Alternative sequencei295 – 34248GSFFP…QNVLR → DEETEAQEGKNDSPSFKQPV HHAAVLGLEVMEKENLEGVS RKDTCGVW in isoform 6. 1 PublicationVSP_011053Add
BLAST
Alternative sequencei296 – 466171SFFPD…NGEEV → THTHDMKPASRPRLLSLLPK EGEHETHHWSCDPLSLESTP GAQEPCLTLGFTSLSSIHLT KAQIQHVTVTDTGKTVT in isoform 9. 1 PublicationVSP_011049Add
BLAST
Alternative sequencei296 – 32429SFFPD…CINPI → TYILKYDVLFWRKGLSVCTR LRERKEIKN in isoform 7. 1 PublicationVSP_011047Add
BLAST
Alternative sequencei296 – 2972SF → KS in isoform 5. 1 PublicationVSP_011051
Alternative sequencei298 – 466169Missing in isoform 5. 1 PublicationVSP_011052Add
BLAST
Alternative sequencei325 – 466142Missing in isoform 7. 1 PublicationVSP_011048Add
BLAST
Alternative sequencei343 – 466124Missing in isoform 6. 1 PublicationVSP_011054Add
BLAST
Alternative sequencei424 – 46643VRSKS…NGEEV → TKSRSVTRLECSGMILAHCN LRLPGSRDSPASASQAAGTT GMCHQADATRPS in isoform 2. 1 PublicationVSP_011055Add
BLAST
Alternative sequencei424 – 46643VRSKS…NGEEV → RGMDCRYFTKNCREHIKHVN FMMPPWRKGSEC in isoform 4. 1 PublicationVSP_011050Add
BLAST
Alternative sequencei424 – 4296VRSKSF → GHTPMT in isoform 3. 1 PublicationVSP_011044
Alternative sequencei430 – 46637Missing in isoform 3. 1 PublicationVSP_011045Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D25235 mRNA. Translation: BAA04960.1.
U03866 Genomic DNA. Translation: AAB60353.1.
U02569 mRNA. Translation: AAA93114.1.
D32201 mRNA. Translation: BAA06900.1.
D32202 mRNA. Translation: BAA06901.1. Frameshift.
L31774 mRNA. Translation: AAB59486.1.
AF013261 mRNA. Translation: AAC06138.1.
AY491775 mRNA. Translation: AAR84644.1.
AY491776 mRNA. Translation: AAR84645.1.
AY491777 mRNA. Translation: AAR84646.1.
AY491778 mRNA. Translation: AAR84647.1.
AY491779 mRNA. Translation: AAR84648.1.
AY491780 mRNA. Translation: AAR84649.1.
AY491781 mRNA. Translation: AAR84650.1.
AF395806 mRNA. Translation: AAK77197.1.
AB065703 Genomic DNA. Translation: BAC05926.1.
AY389505 Genomic DNA. Translation: AAQ91331.1.
AK289548 mRNA. Translation: BAF82237.1.
EU326301 Genomic DNA. Translation: ACA05899.1.
EU326301 Genomic DNA. Translation: ACA05900.1. Sequence problems.
EU326301 Genomic DNA. Translation: ACA05902.1.
EU326301 Genomic DNA. Translation: ACA05903.1.
EU326301 Genomic DNA. Translation: ACA05904.1.
EU326301 Genomic DNA. Translation: ACA05905.1.
EU326301 Genomic DNA. Translation: ACA05906.1.
EU326301 Genomic DNA. Translation: ACA05907.1.
BC095512 mRNA. Translation: AAH95512.1.
CCDSiCCDS34869.1. [P35348-2]
CCDS6052.1. [P35348-3]
CCDS6053.1. [P35348-4]
CCDS6054.1. [P35348-1]
PIRiJN0765.
S65656.
S65657.
RefSeqiNP_000671.2. NM_000680.2. [P35348-1]
NP_150645.2. NM_033302.2. [P35348-3]
NP_150646.3. NM_033303.3. [P35348-2]
NP_150647.2. NM_033304.2. [P35348-4]
XP_005273471.1. XM_005273414.2. [P35348-1]
XP_006716356.1. XM_006716293.1. [P35348-3]
UniGeneiHs.709175.

Genome annotation databases

EnsembliENST00000276393; ENSP00000276393; ENSG00000120907. [P35348-1]
ENST00000354550; ENSP00000346557; ENSG00000120907. [P35348-4]
ENST00000380572; ENSP00000369946; ENSG00000120907. [P35348-6]
ENST00000380573; ENSP00000369947; ENSG00000120907. [P35348-1]
ENST00000380582; ENSP00000369956; ENSG00000120907. [P35348-3]
ENST00000380586; ENSP00000369960; ENSG00000120907. [P35348-2]
ENST00000519096; ENSP00000431073; ENSG00000120907. [P35348-7]
ENST00000521711; ENSP00000430414; ENSG00000120907. [P35348-7]
GeneIDi148.
KEGGihsa:148.
UCSCiuc003xfe.1. human. [P35348-3]
uc003xfg.1. human. [P35348-4]
uc003xfh.1. human. [P35348-1]
uc010lul.1. human. [P35348-8]
uc010lum.1. human. [P35348-9]
uc022atd.1. human. [P35348-5]

Polymorphism databases

DMDMi1168246.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D25235 mRNA. Translation: BAA04960.1.
U03866 Genomic DNA. Translation: AAB60353.1.
U02569 mRNA. Translation: AAA93114.1.
D32201 mRNA. Translation: BAA06900.1.
D32202 mRNA. Translation: BAA06901.1. Frameshift.
L31774 mRNA. Translation: AAB59486.1.
AF013261 mRNA. Translation: AAC06138.1.
AY491775 mRNA. Translation: AAR84644.1.
AY491776 mRNA. Translation: AAR84645.1.
AY491777 mRNA. Translation: AAR84646.1.
AY491778 mRNA. Translation: AAR84647.1.
AY491779 mRNA. Translation: AAR84648.1.
AY491780 mRNA. Translation: AAR84649.1.
AY491781 mRNA. Translation: AAR84650.1.
AF395806 mRNA. Translation: AAK77197.1.
AB065703 Genomic DNA. Translation: BAC05926.1.
AY389505 Genomic DNA. Translation: AAQ91331.1.
AK289548 mRNA. Translation: BAF82237.1.
EU326301 Genomic DNA. Translation: ACA05899.1.
EU326301 Genomic DNA. Translation: ACA05900.1. Sequence problems.
EU326301 Genomic DNA. Translation: ACA05902.1.
EU326301 Genomic DNA. Translation: ACA05903.1.
EU326301 Genomic DNA. Translation: ACA05904.1.
EU326301 Genomic DNA. Translation: ACA05905.1.
EU326301 Genomic DNA. Translation: ACA05906.1.
EU326301 Genomic DNA. Translation: ACA05907.1.
BC095512 mRNA. Translation: AAH95512.1.
CCDSiCCDS34869.1. [P35348-2]
CCDS6052.1. [P35348-3]
CCDS6053.1. [P35348-4]
CCDS6054.1. [P35348-1]
PIRiJN0765.
S65656.
S65657.
RefSeqiNP_000671.2. NM_000680.2. [P35348-1]
NP_150645.2. NM_033302.2. [P35348-3]
NP_150646.3. NM_033303.3. [P35348-2]
NP_150647.2. NM_033304.2. [P35348-4]
XP_005273471.1. XM_005273414.2. [P35348-1]
XP_006716356.1. XM_006716293.1. [P35348-3]
UniGeneiHs.709175.

3D structure databases

ProteinModelPortaliP35348.
SMRiP35348. Positions 29-341.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

DIPiDIP-33401N.
IntActiP35348. 3 interactions.

Chemistry

BindingDBiP35348.
ChEMBLiCHEMBL2331074.
DrugBankiDB01614. Acepromazine.
DB00346. Alfuzosin.
DB00321. Amitriptyline.
DB00543. Amoxapine.
DB00182. Amphetamine.
DB00964. Apraclonidine.
DB01238. Aripiprazole.
DB06216. Asenapine.
DB00865. Benzphetamine.
DB01295. Bevantolol.
DB01200. Bromocriptine.
DB00248. Cabergoline.
DB01136. Carvedilol.
DB00477. Chlorpromazine.
DB00215. Citalopram.
DB00575. Clonidine.
DB00363. Clozapine.
DB00298. Dapiprazole.
DB01151. Desipramine.
DB01576. Dextroamphetamine.
DB00449. Dipivefrin.
DB00590. Doxazosin.
DB01142. Doxepin.
DB04855. Dronedarone.
DB00450. Droperidol.
DB06262. Droxidopa.
DB01364. Ephedrine.
DB00751. Epinastine.
DB00668. Epinephrine.
DB01049. Ergoloid mesylate.
DB01253. Ergonovine.
DB00696. Ergotamine.
DB01175. Escitalopram.
DB00800. Fenoldopam.
DB00875. Flupentixol.
DB04946. Iloperidone.
DB00458. Imipramine.
DB06706. Isometheptene.
DB00598. Labetalol.
DB06707. Levonordefrin.
DB00408. Loxapine.
DB00934. Maprotiline.
DB01365. Mephentermine.
DB00610. Metaraminol.
DB01403. Methotrimeprazine.
DB00723. Methoxamine.
DB06148. Mianserin.
DB00211. Midodrine.
DB00370. Mirtazapine.
DB06711. Naphazoline.
DB01149. Nefazodone.
DB00622. Nicardipine.
DB00699. Nicergoline.
DB00368. Norepinephrine.
DB00540. Nortriptyline.
DB00334. Olanzapine.
DB00935. Oxymetazoline.
DB01267. Paliperidone.
DB01186. Pergolide.
DB01579. Phendimetrazine.
DB00925. Phenoxybenzamine.
DB00692. Phentolamine.
DB00388. Phenylephrine.
DB00397. Phenylpropanolamine.
DB00457. Prazosin.
DB00420. Promazine.
DB01069. Promethazine.
DB00777. Propiomazine.
DB00852. Pseudoephedrine.
DB01224. Quetiapine.
DB00734. Risperidone.
DB06144. Sertindole.
DB06207. Silodosin.
DB00706. Tamsulosin.
DB01162. Terazosin.
DB01622. Thioproperazine.
DB00679. Thioridazine.
DB00797. Tolazoline.
DB00656. Trazodone.
DB00831. Trifluoperazine.
DB00726. Trimipramine.
DB06694. Xylometazoline.
DB00246. Ziprasidone.
DB01624. Zuclopenthixol.
GuidetoPHARMACOLOGYi22.

Protein family/group databases

GPCRDBiSearch...

PTM databases

PhosphoSiteiP35348.

Polymorphism databases

DMDMi1168246.

Proteomic databases

PaxDbiP35348.
PRIDEiP35348.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000276393; ENSP00000276393; ENSG00000120907. [P35348-1]
ENST00000354550; ENSP00000346557; ENSG00000120907. [P35348-4]
ENST00000380572; ENSP00000369946; ENSG00000120907. [P35348-6]
ENST00000380573; ENSP00000369947; ENSG00000120907. [P35348-1]
ENST00000380582; ENSP00000369956; ENSG00000120907. [P35348-3]
ENST00000380586; ENSP00000369960; ENSG00000120907. [P35348-2]
ENST00000519096; ENSP00000431073; ENSG00000120907. [P35348-7]
ENST00000521711; ENSP00000430414; ENSG00000120907. [P35348-7]
GeneIDi148.
KEGGihsa:148.
UCSCiuc003xfe.1. human. [P35348-3]
uc003xfg.1. human. [P35348-4]
uc003xfh.1. human. [P35348-1]
uc010lul.1. human. [P35348-8]
uc010lum.1. human. [P35348-9]
uc022atd.1. human. [P35348-5]

Organism-specific databases

CTDi148.
GeneCardsiGC08M026605.
HGNCiHGNC:277. ADRA1A.
HPAiHPA029678.
HPA029679.
MIMi104221. gene.
neXtProtiNX_P35348.
PharmGKBiPA34.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG253615.
GeneTreeiENSGT00760000118795.
HOVERGENiHBG106962.
InParanoidiP35348.
KOiK04135.
OMAiEGQHKDM.
OrthoDBiEOG7H4DTB.
PhylomeDBiP35348.
TreeFamiTF331895.

Enzyme and pathway databases

ReactomeiREACT_16927. Adrenoceptors.
REACT_18283. G alpha (q) signalling events.
REACT_18407. G alpha (12/13) signalling events.
SignaLinkiP35348.

Miscellaneous databases

GeneWikiiAlpha-1A_adrenergic_receptor.
GenomeRNAii148.
NextBioi585.
PROiP35348.
SOURCEiSearch...

Gene expression databases

BgeeiP35348.
CleanExiHS_ADRA1A.
ExpressionAtlasiP35348. baseline and differential.
GenevestigatoriP35348.

Family and domain databases

InterProiIPR002233. ADR_fam.
IPR001004. ADRA1A_rcpt.
IPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
[Graphical view]
PfamiPF00001. 7tm_1. 1 hit.
[Graphical view]
PRINTSiPR01103. ADRENERGICR.
PR00557. ADRENRGCA1AR.
PR00237. GPCRRHODOPSN.
PROSITEiPS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning, functional expression and tissue distribution of human cDNA for the alpha 1C-adrenergic receptor."
    Hirasawa A., Horie K., Tanaka T., Takagaki K., Murai M., Yano J., Tsujimoto G.
    Biochem. Biophys. Res. Commun. 195:902-909(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1), VARIANT ARG-347.
    Tissue: Prostate.
  2. "Cloning, expression and characterization of human alpha adrenergic receptors alpha 1a, alpha 1b and alpha 1c."
    Weinberg D.H., Trivedi P., Tan C.P., Mitra S., Perkins-Barrow A., Borkowski D., Strader C.D., Bayne M.
    Biochem. Biophys. Res. Commun. 201:1296-1304(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ARG-347.
    Tissue: Heart.
  3. "The alpha 1-adrenergic receptor that mediates smooth muscle contraction in human prostate has the pharmacological properties of the cloned human alpha 1c subtype."
    Forray C., Bard J.A., Wetzel J.M., Chiu G., Shapiro E., Tang R., Lepor H., Hartig P.R., Weinshank R.L., Branchek T.A., Gluchowski C.
    Mol. Pharmacol. 45:703-708(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1).
    Tissue: Hippocampus and Lymphocyte.
  4. "The alpha 1C-adrenoceptor in human prostate: cloning, functional expression, and localization to specific prostatic cell types."
    Tseng-Crank J., Kost T., Goetz A., Hazum S., Roberson K.M., Haizlip J., Godinot N., Robertson C.N., Saussy D.
    Br. J. Pharmacol. 115:1475-1485(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ARG-347.
  5. "Cloning, functional expression and tissue distribution of human alpha 1c-adrenoceptor splice variants."
    Hirasawa A., Shibata K., Horie K., Takei Y., Obika K., Tanaka T., Muramoto N., Takagaki K., Yano J., Tsujimoto G.
    FEBS Lett. 363:256-260(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), VARIANT ARG-347, TISSUE SPECIFICITY.
    Tissue: Prostate.
  6. "Cloning and pharmacological characterization of human alpha-1 adrenergic receptors: sequence corrections and direct comparison with other species homologues."
    Schwinn D.A., Johnston G.I., Page S.O., Mosley M.J., Wilson K.H., Worman N.P., Campbell S., Fidock M.D., Furness L.M., Parry-Smith D.J., Peter B., Bailey D.S.
    J. Pharmacol. Exp. Ther. 272:134-142(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ARG-347.
  7. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), TISSUE SPECIFICITY.
    Tissue: Prostate.
  8. "Truncated isoforms inhibit [3H]prazosin binding and cellular trafficking of native human alpha1A-adrenoceptors."
    Coge F., Guenin S.P., Renouard-Try A., Rique H., Ouvry C., Fabry N., Beauverger P., Nicolas J.P., Galizzi J.-P., Boutin J.A., Canet E.
    Biochem. J. 343:231-239(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 5; 6; 7; 8 AND 9).
    Tissue: Liver.
  9. "RT-PCR cloning and sequence analysis of adrenergic receptor subtype-alpha-1a cDNA from human prostrate cell-line DU-145."
    Banerjee A.G.N., Aarti A.
    Submitted (MAY-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  10. "Genome-wide discovery and analysis of human seven transmembrane helix receptor genes."
    Suwa M., Sato T., Okouchi I., Arita M., Futami K., Matsumoto S., Tsutsumi S., Aburatani H., Asai K., Akiyama Y.
    Submitted (JUN-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  11. "cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org)."
    Kopatz S.A., Aronstam R.S., Sharma S.V.
    Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  12. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Cerebellum.
  13. NHLBI resequencing and genotyping service (RS&G)
    Submitted (NOV-2007) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  14. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ARG-347.
  15. "Identification of alpha 1-adrenoceptor subtypes present in the human prostate."
    Faure C., Pimoule C., Vallancien G., Langer S.Z., Graham D.
    Life Sci. 54:1595-1605(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 52-400 (ISOFORMS 1/2/3/4), TISSUE SPECIFICITY, VARIANT ARG-347.
    Tissue: Prostate.
  16. "Nuclear alpha1-adrenergic receptors signal activated ERK localization to caveolae in adult cardiac myocytes."
    Wright C.D., Chen Q., Baye N.L., Huang Y., Healy C.L., Kasinathan S., O'Connell T.D.
    Circ. Res. 103:992-1000(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION, FUNCTION.
  17. "Nuclear localization drives alpha1-adrenergic receptor oligomerization and signaling in cardiac myocytes."
    Wright C.D., Wu S.C., Dahl E.F., Sazama A.J., O'Connell T.D.
    Cell. Signal. 24:794-802(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION, SUBUNIT, FUNCTION, MUTAGENESIS OF LYS-334; LYS-335; ARG-342; ARG-348 AND LYS-349.
  18. "Alpha 1a-adrenoceptor polymorphism: pharmacological characterization and association with benign prostatic hypertrophy."
    Shibata K., Hirasawa A., Moriyama N., Kawabe K., Ogawa S., Tsujimoto G.
    Br. J. Pharmacol. 118:1403-1408(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT ARG-347.
  19. Cited for: VARIANT ARG-347.
  20. Cited for: VARIANT [LARGE SCALE ANALYSIS] TRP-40.

Entry informationi

Entry nameiADA1A_HUMAN
AccessioniPrimary (citable) accession number: P35348
Secondary accession number(s): A8K0I3
, B0ZBD1, B0ZBD2, B0ZBD4, B0ZBD5, B0ZBD6, B0ZBD8, B0ZBD9, O60451, Q13675, Q13729, Q4VBM7, Q6RUJ4, Q6RUJ5, Q6RUJ7, Q6RUJ8, Q6RUJ9, Q96RE8, Q9UD63, Q9UD67
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 1, 1994
Last sequence update: November 1, 1995
Last modified: April 1, 2015
This is version 155 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.