Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P35348

- ADA1A_HUMAN

UniProt

P35348 - ADA1A_HUMAN

Protein

Alpha-1A adrenergic receptor

Gene

ADRA1A

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 149 (01 Oct 2014)
      Sequence version 2 (01 Nov 1995)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    This alpha-adrenergic receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Its effect is mediated by G(q) and G(11) proteins. Nuclear ADRA1A-ADRA1B heterooligomers regulate phenylephrine(PE)-stimulated ERK signaling in cardiac myocytes.2 Publications

    GO - Molecular functioni

    1. alpha1-adrenergic receptor activity Source: UniProtKB
    2. protein heterodimerization activity Source: UniProtKB

    GO - Biological processi

    1. activation of phospholipase C activity Source: BHF-UCL
    2. adrenergic receptor signaling pathway Source: GOC
    3. adult heart development Source: Ensembl
    4. aging Source: BHF-UCL
    5. apoptotic process Source: ProtInc
    6. calcium ion transport into cytosol Source: BHF-UCL
    7. cell-cell signaling Source: ProtInc
    8. cell growth Source: Ensembl
    9. G-protein coupled receptor signaling pathway Source: ProtInc
    10. intracellular signal transduction Source: ProtInc
    11. micturition Source: Ensembl
    12. negative regulation of cell proliferation Source: ProtInc
    13. negative regulation of heart rate involved in baroreceptor response to increased systemic arterial blood pressure Source: Ensembl
    14. negative regulation of Rho protein signal transduction Source: BHF-UCL
    15. negative regulation of synaptic transmission, GABAergic Source: BHF-UCL
    16. norepinephrine-epinephrine vasoconstriction involved in regulation of systemic arterial blood pressure Source: Ensembl
    17. organ growth Source: Ensembl
    18. phospholipase C-activating G-protein coupled receptor signaling pathway Source: Ensembl
    19. pilomotor reflex Source: Ensembl
    20. positive regulation of action potential Source: BHF-UCL
    21. positive regulation of cardiac muscle contraction Source: BHF-UCL
    22. positive regulation of cytosolic calcium ion concentration Source: BHF-UCL
    23. positive regulation of ERK1 and ERK2 cascade Source: BHF-UCL
    24. positive regulation of heart rate by epinephrine-norepinephrine Source: Ensembl
    25. positive regulation of MAPK cascade Source: UniProtKB
    26. positive regulation of protein kinase C signaling Source: BHF-UCL
    27. positive regulation of smooth muscle contraction Source: Ensembl
    28. positive regulation of systemic arterial blood pressure Source: Ensembl
    29. positive regulation of the force of heart contraction by epinephrine-norepinephrine Source: Ensembl
    30. positive regulation of vasoconstriction Source: BHF-UCL
    31. response to drug Source: BHF-UCL
    32. response to hormone Source: BHF-UCL
    33. signal transduction Source: ProtInc
    34. smooth muscle contraction Source: ProtInc

    Keywords - Molecular functioni

    G-protein coupled receptor, Receptor, Transducer

    Enzyme and pathway databases

    ReactomeiREACT_16927. Adrenoceptors.
    REACT_18283. G alpha (q) signalling events.
    REACT_18407. G alpha (12/13) signalling events.
    SignaLinkiP35348.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Alpha-1A adrenergic receptor
    Alternative name(s):
    Alpha-1A adrenoreceptor
    Short name:
    Alpha-1A adrenoceptor
    Alpha-1C adrenergic receptor
    Alpha-adrenergic receptor 1c
    Gene namesi
    Name:ADRA1A
    Synonyms:ADRA1C
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 8

    Organism-specific databases

    HGNCiHGNC:277. ADRA1A.

    Subcellular locationi

    Nucleus membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein
    Note: Location at the nuclear membrane facilitates heterooligomerization and regulates ERK-mediated signaling in cardiac myocytes. Colocalizes with GNAQ, PLCB1 as well as LAP2 at the nuclear membrane of cardiac myocytes.

    GO - Cellular componenti

    1. integral component of plasma membrane Source: ProtInc
    2. nuclear membrane Source: UniProtKB
    3. nucleus Source: UniProtKB
    4. plasma membrane Source: Reactome
    5. T-tubule Source: Ensembl
    6. Z disc Source: Ensembl

    Keywords - Cellular componenti

    Cell membrane, Membrane, Nucleus

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi334 – 3341K → A: Abolishes targeting to the nuclear membrane of cardiac myocytes; when associated with A-335; A-342; A-348 and A-349. 1 Publication
    Mutagenesisi335 – 3351K → A: Abolishes targeting to the nuclear membrane of cardiac myocytes; when associated with A-334; A-342; A-348 and A-349. 1 Publication
    Mutagenesisi342 – 3421R → A: Abolishes targeting to the nuclear membrane of cardiac myocytes; when associated with A-334; A-335; A-348 and A-349. 1 Publication
    Mutagenesisi348 – 3481R → A: Abolishes targeting to the nuclear membrane of cardiac myocytes; when associated with A-334; A-335; A-342 and A-349. 1 Publication
    Mutagenesisi349 – 3491K → A: Abolishes targeting to the nuclear membrane of cardiac myocytes; when associated with A-334; A-335; A-342 and A-348. 1 Publication

    Organism-specific databases

    PharmGKBiPA34.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 466466Alpha-1A adrenergic receptorPRO_0000069063Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi7 – 71N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi13 – 131N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi22 – 221N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi99 ↔ 176PROSITE-ProRule annotation
    Modified residuei215 – 2151Phosphoserine; by PKASequence Analysis
    Lipidationi345 – 3451S-palmitoyl cysteineSequence Analysis

    Post-translational modificationi

    C-terminal Ser or Thr residues may be phosphorylated.By similarity

    Keywords - PTMi

    Disulfide bond, Glycoprotein, Lipoprotein, Palmitate, Phosphoprotein

    Proteomic databases

    PaxDbiP35348.
    PRIDEiP35348.

    PTM databases

    PhosphoSiteiP35348.

    Expressioni

    Tissue specificityi

    Expressed in heart, brain, liver and prostate, but not in kidney, lung, adrenal, aorta and pituitary. Within the prostate, expressed in the apex, base, periurethral and lateral lobe. Isoform 4 is the most abundant isoform expressed in the prostate with high levels also detected in liver and heart.3 Publications

    Gene expression databases

    ArrayExpressiP35348.
    BgeeiP35348.
    CleanExiHS_ADRA1A.
    GenevestigatoriP35348.

    Organism-specific databases

    HPAiHPA029678.

    Interactioni

    Subunit structurei

    Homo- and heterooligomer. Heterooligomerizes with ADRA1B homooligomers in cardiac myocytes.1 Publication

    Protein-protein interaction databases

    DIPiDIP-33401N.
    IntActiP35348. 3 interactions.

    Structurei

    3D structure databases

    ProteinModelPortaliP35348.
    SMRiP35348. Positions 29-341.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 2727ExtracellularBy similarityAdd
    BLAST
    Topological domaini52 – 6413CytoplasmicBy similarityAdd
    BLAST
    Topological domaini89 – 9911ExtracellularBy similarityAdd
    BLAST
    Topological domaini123 – 14321CytoplasmicBy similarityAdd
    BLAST
    Topological domaini168 – 18114ExtracellularBy similarityAdd
    BLAST
    Topological domaini206 – 27368CytoplasmicBy similarityAdd
    BLAST
    Topological domaini298 – 3058ExtracellularBy similarity
    Topological domaini330 – 466137CytoplasmicBy similarityAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei28 – 5124Helical; Name=1By similarityAdd
    BLAST
    Transmembranei65 – 8824Helical; Name=2By similarityAdd
    BLAST
    Transmembranei100 – 12223Helical; Name=3By similarityAdd
    BLAST
    Transmembranei144 – 16724Helical; Name=4By similarityAdd
    BLAST
    Transmembranei182 – 20524Helical; Name=5By similarityAdd
    BLAST
    Transmembranei274 – 29724Helical; Name=6By similarityAdd
    BLAST
    Transmembranei306 – 32924Helical; Name=7By similarityAdd
    BLAST

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni334 – 34916Nuclear localization signalAdd
    BLAST

    Sequence similaritiesi

    Belongs to the G-protein coupled receptor 1 family. Adrenergic receptor subfamily. ADRA1A sub-subfamily.PROSITE-ProRule annotation

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG253615.
    HOVERGENiHBG106962.
    KOiK04135.
    OMAiCTTARVR.
    OrthoDBiEOG7H4DTB.
    PhylomeDBiP35348.
    TreeFamiTF331895.

    Family and domain databases

    Gene3Di1.20.1070.10. 1 hit.
    InterProiIPR002233. ADR_fam.
    IPR001004. ADRA1A_rcpt.
    IPR000276. GPCR_Rhodpsn.
    IPR017452. GPCR_Rhodpsn_7TM.
    [Graphical view]
    PfamiPF00001. 7tm_1. 1 hit.
    [Graphical view]
    PRINTSiPR01103. ADRENERGICR.
    PR00557. ADRENRGCA1AR.
    PR00237. GPCRRHODOPSN.
    PROSITEiPS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
    PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
    [Graphical view]

    Sequences (9)i

    Sequence statusi: Complete.

    This entry describes 9 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P35348-1) [UniParc]FASTAAdd to Basket

    Also known as: Alpha 1c-1, Alpha(1A-1)

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MVFLSGNASD SSNCTQPPAP VNISKAILLG VILGGLILFG VLGNILVILS    50
    VACHRHLHSV THYYIVNLAV ADLLLTSTVL PFSAIFEVLG YWAFGRVFCN 100
    IWAAVDVLCC TASIMGLCII SIDRYIGVSY PLRYPTIVTQ RRGLMALLCV 150
    WALSLVISIG PLFGWRQPAP EDETICQINE EPGYVLFSAL GSFYLPLAII 200
    LVMYCRVYVV AKRESRGLKS GLKTDKSDSE QVTLRIHRKN APAGGSGMAS 250
    AKTKTHFSVR LLKFSREKKA AKTLGIVVGC FVLCWLPFFL VMPIGSFFPD 300
    FKPSETVFKI VFWLGYLNSC INPIIYPCSS QEFKKAFQNV LRIQCLCRKQ 350
    SSKHALGYTL HPPSQAVEGQ HKDMVRIPVG SRETFYRISK TDGVCEWKFF 400
    SSMPRGSARI TVSKDQSSCT TARVRSKSFL QVCCCVGPST PSLDKNHQVP 450
    TIKVHTISLS ENGEEV 466
    Length:466
    Mass (Da):51,487
    Last modified:November 1, 1995 - v2
    Checksum:i1A50487531DECDF0
    GO
    Isoform 2 (identifier: P35348-2) [UniParc]FASTAAdd to Basket

    Also known as: Alpha 1c-2, Alpha(1A-2)

    The sequence of this isoform differs from the canonical sequence as follows:
         424-466: VRSKSFLQVC...ISLSENGEEV → TKSRSVTRLE...CHQADATRPS

    Show »
    Length:475
    Mass (Da):52,205
    Checksum:iDE3CEEDD1AB3E56D
    GO
    Isoform 3 (identifier: P35348-3) [UniParc]FASTAAdd to Basket

    Also known as: Alpha 1c-3, Alpha(1A-3)

    The sequence of this isoform differs from the canonical sequence as follows:
         424-429: VRSKSF → GHTPMT
         430-466: Missing.

    Show »
    Length:429
    Mass (Da):47,461
    Checksum:iE67B19B5CA668687
    GO
    Isoform 4 (identifier: P35348-4) [UniParc]FASTAAdd to Basket

    Also known as: Alpha(1A-4)

    The sequence of this isoform differs from the canonical sequence as follows:
         424-466: VRSKSFLQVCCCVGPSTPSLDKNHQVPTIKVHTISLSENGEEV → RGMDCRYFTKNCREHIKHVNFMMPPWRKGSEC

    Show »
    Length:455
    Mass (Da):50,777
    Checksum:i80C61B88FA608B6C
    GO
    Isoform 5 (identifier: P35348-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         296-297: SF → KS
         298-466: Missing.

    Show »
    Length:297
    Mass (Da):32,433
    Checksum:i4871F9BE42A87D6E
    GO
    Isoform 6 (identifier: P35348-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         295-342: GSFFPDFKPS...FKKAFQNVLR → DEETEAQEGK...VSRKDTCGVW
         343-466: Missing.

    Show »
    Length:342
    Mass (Da):37,468
    Checksum:i2B6E7CC81B9CBE50
    GO
    Isoform 7 (identifier: P35348-7) [UniParc]FASTAAdd to Basket

    Also known as: 2b/3b

    The sequence of this isoform differs from the canonical sequence as follows:
         296-324: SFFPDFKPSETVFKIVFWLGYLNSCINPI → TYILKYDVLFWRKGLSVCTRLRERKEIKN
         325-466: Missing.

    Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:324
    Mass (Da):35,829
    Checksum:i608DACD5497EE83E
    GO
    Isoform 8 (identifier: P35348-8) [UniParc]FASTAAdd to Basket

    Also known as: 2c

    The sequence of this isoform differs from the canonical sequence as follows:
         295-466: GSFFPDFKPS...ISLSENGEEV → DEVSLCHQAG...GQDDLDLLTS

    Show »
    Length:370
    Mass (Da):40,725
    Checksum:iF00E717A4C4A59AC
    GO
    Isoform 9 (identifier: P35348-9) [UniParc]FASTAAdd to Basket

    Also known as: 3c

    The sequence of this isoform differs from the canonical sequence as follows:
         296-466: SFFPDFKPSE...ISLSENGEEV → THTHDMKPAS...TVTDTGKTVT

    Show »
    Length:372
    Mass (Da):40,638
    Checksum:i839C5750F9B428F5
    GO

    Sequence cautioni

    Isoform 2 : The sequence BAA06901.1 differs from that shown. Reason: Frameshift at position 465.
    Isoform 2 : The sequence ACA05900.1 differs from that shown. Reason: Erroneous gene model prediction.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti43 – 431G → C in AAA93114. (PubMed:8564208)Curated
    Sequence conflicti129 – 1291S → T in AAA93114. (PubMed:8564208)Curated
    Sequence conflicti130 – 1301Y → H in AAK77197. 1 PublicationCurated
    Sequence conflicti185 – 1851V → A in AAH95512. (PubMed:15489334)Curated
    Sequence conflicti338 – 3381Q → C(PubMed:8024574)Curated
    Sequence conflicti359 – 3591T → P in AAA93114. (PubMed:8564208)Curated
    Sequence conflicti384 – 3841T → A in AAK77197. 1 PublicationCurated
    Sequence conflicti387 – 3871R → G in AAK77197. 1 PublicationCurated
    Sequence conflicti390 – 3901K → R in AAK77197. 1 PublicationCurated
    Sequence conflicti431 – 4311Q → E in BAA04960. (PubMed:8396931)Curated
    Sequence conflicti437 – 4371G → E in AAK77197. 1 PublicationCurated
    Sequence conflicti442 – 4421S → C in AAA93114. (PubMed:8564208)Curated
    Isoform 6 (identifier: P35348-6)
    Sequence conflicti302 – 3021E → Q in AAR84650. (PubMed:10493934)Curated
    Isoform 4 (identifier: P35348-4)
    Sequence conflicti453 – 4531S → L in AAC06138. (PubMed:9490024)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti40 – 401G → W in a breast cancer sample; somatic mutation. 1 Publication
    VAR_035756
    Natural varianti200 – 2001I → S.
    Corresponds to variant rs2229125 [ dbSNP | Ensembl ].
    VAR_049370
    Natural varianti347 – 3471C → R Frequent polymorphism. 9 Publications
    Corresponds to variant rs1048101 [ dbSNP | Ensembl ].
    VAR_019509
    Natural varianti414 – 4141K → R.
    Corresponds to variant rs3730247 [ dbSNP | Ensembl ].
    VAR_049371
    Natural varianti465 – 4651E → D.
    Corresponds to variant rs2229126 [ dbSNP | Ensembl ].
    VAR_049372

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei295 – 466172GSFFP…NGEEV → DEVSLCHQAGVQWHDLGSLQ PPPPGFKRFSCLSLPSSWDY RDVPPGRRHQAQLIFVFLVE TGFHHVGQDDLDLLTS in isoform 8. 1 PublicationVSP_011046Add
    BLAST
    Alternative sequencei295 – 34248GSFFP…QNVLR → DEETEAQEGKNDSPSFKQPV HHAAVLGLEVMEKENLEGVS RKDTCGVW in isoform 6. 1 PublicationVSP_011053Add
    BLAST
    Alternative sequencei296 – 466171SFFPD…NGEEV → THTHDMKPASRPRLLSLLPK EGEHETHHWSCDPLSLESTP GAQEPCLTLGFTSLSSIHLT KAQIQHVTVTDTGKTVT in isoform 9. 1 PublicationVSP_011049Add
    BLAST
    Alternative sequencei296 – 32429SFFPD…CINPI → TYILKYDVLFWRKGLSVCTR LRERKEIKN in isoform 7. 1 PublicationVSP_011047Add
    BLAST
    Alternative sequencei296 – 2972SF → KS in isoform 5. 1 PublicationVSP_011051
    Alternative sequencei298 – 466169Missing in isoform 5. 1 PublicationVSP_011052Add
    BLAST
    Alternative sequencei325 – 466142Missing in isoform 7. 1 PublicationVSP_011048Add
    BLAST
    Alternative sequencei343 – 466124Missing in isoform 6. 1 PublicationVSP_011054Add
    BLAST
    Alternative sequencei424 – 46643VRSKS…NGEEV → TKSRSVTRLECSGMILAHCN LRLPGSRDSPASASQAAGTT GMCHQADATRPS in isoform 2. 1 PublicationVSP_011055Add
    BLAST
    Alternative sequencei424 – 46643VRSKS…NGEEV → RGMDCRYFTKNCREHIKHVN FMMPPWRKGSEC in isoform 4. 1 PublicationVSP_011050Add
    BLAST
    Alternative sequencei424 – 4296VRSKSF → GHTPMT in isoform 3. 1 PublicationVSP_011044
    Alternative sequencei430 – 46637Missing in isoform 3. 1 PublicationVSP_011045Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D25235 mRNA. Translation: BAA04960.1.
    U03866 Genomic DNA. Translation: AAB60353.1.
    U02569 mRNA. Translation: AAA93114.1.
    D32201 mRNA. Translation: BAA06900.1.
    D32202 mRNA. Translation: BAA06901.1. Frameshift.
    L31774 mRNA. Translation: AAB59486.1.
    AF013261 mRNA. Translation: AAC06138.1.
    AY491775 mRNA. Translation: AAR84644.1.
    AY491776 mRNA. Translation: AAR84645.1.
    AY491777 mRNA. Translation: AAR84646.1.
    AY491778 mRNA. Translation: AAR84647.1.
    AY491779 mRNA. Translation: AAR84648.1.
    AY491780 mRNA. Translation: AAR84649.1.
    AY491781 mRNA. Translation: AAR84650.1.
    AF395806 mRNA. Translation: AAK77197.1.
    AB065703 Genomic DNA. Translation: BAC05926.1.
    AY389505 Genomic DNA. Translation: AAQ91331.1.
    AK289548 mRNA. Translation: BAF82237.1.
    EU326301 Genomic DNA. Translation: ACA05899.1.
    EU326301 Genomic DNA. Translation: ACA05900.1. Sequence problems.
    EU326301 Genomic DNA. Translation: ACA05902.1.
    EU326301 Genomic DNA. Translation: ACA05903.1.
    EU326301 Genomic DNA. Translation: ACA05904.1.
    EU326301 Genomic DNA. Translation: ACA05905.1.
    EU326301 Genomic DNA. Translation: ACA05906.1.
    EU326301 Genomic DNA. Translation: ACA05907.1.
    BC095512 mRNA. Translation: AAH95512.1.
    CCDSiCCDS34869.1. [P35348-2]
    CCDS6052.1. [P35348-3]
    CCDS6053.1. [P35348-4]
    CCDS6054.1. [P35348-1]
    PIRiJN0765.
    S65656.
    S65657.
    RefSeqiNP_000671.2. NM_000680.2. [P35348-1]
    NP_150645.2. NM_033302.2. [P35348-3]
    NP_150646.3. NM_033303.3. [P35348-2]
    NP_150647.2. NM_033304.2. [P35348-4]
    XP_005273471.1. XM_005273414.2. [P35348-1]
    XP_006716356.1. XM_006716293.1. [P35348-3]
    UniGeneiHs.709175.

    Genome annotation databases

    EnsembliENST00000276393; ENSP00000276393; ENSG00000120907. [P35348-1]
    ENST00000354550; ENSP00000346557; ENSG00000120907. [P35348-4]
    ENST00000380572; ENSP00000369946; ENSG00000120907. [P35348-6]
    ENST00000380573; ENSP00000369947; ENSG00000120907. [P35348-1]
    ENST00000380582; ENSP00000369956; ENSG00000120907. [P35348-3]
    ENST00000380586; ENSP00000369960; ENSG00000120907. [P35348-2]
    ENST00000519096; ENSP00000431073; ENSG00000120907. [P35348-7]
    ENST00000521711; ENSP00000430414; ENSG00000120907. [P35348-7]
    GeneIDi148.
    KEGGihsa:148.
    UCSCiuc003xfe.1. human. [P35348-3]
    uc003xfg.1. human. [P35348-4]
    uc003xfh.1. human. [P35348-1]
    uc010lul.1. human. [P35348-8]
    uc010lum.1. human. [P35348-9]
    uc022atd.1. human. [P35348-5]

    Polymorphism databases

    DMDMi1168246.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D25235 mRNA. Translation: BAA04960.1 .
    U03866 Genomic DNA. Translation: AAB60353.1 .
    U02569 mRNA. Translation: AAA93114.1 .
    D32201 mRNA. Translation: BAA06900.1 .
    D32202 mRNA. Translation: BAA06901.1 . Frameshift.
    L31774 mRNA. Translation: AAB59486.1 .
    AF013261 mRNA. Translation: AAC06138.1 .
    AY491775 mRNA. Translation: AAR84644.1 .
    AY491776 mRNA. Translation: AAR84645.1 .
    AY491777 mRNA. Translation: AAR84646.1 .
    AY491778 mRNA. Translation: AAR84647.1 .
    AY491779 mRNA. Translation: AAR84648.1 .
    AY491780 mRNA. Translation: AAR84649.1 .
    AY491781 mRNA. Translation: AAR84650.1 .
    AF395806 mRNA. Translation: AAK77197.1 .
    AB065703 Genomic DNA. Translation: BAC05926.1 .
    AY389505 Genomic DNA. Translation: AAQ91331.1 .
    AK289548 mRNA. Translation: BAF82237.1 .
    EU326301 Genomic DNA. Translation: ACA05899.1 .
    EU326301 Genomic DNA. Translation: ACA05900.1 . Sequence problems.
    EU326301 Genomic DNA. Translation: ACA05902.1 .
    EU326301 Genomic DNA. Translation: ACA05903.1 .
    EU326301 Genomic DNA. Translation: ACA05904.1 .
    EU326301 Genomic DNA. Translation: ACA05905.1 .
    EU326301 Genomic DNA. Translation: ACA05906.1 .
    EU326301 Genomic DNA. Translation: ACA05907.1 .
    BC095512 mRNA. Translation: AAH95512.1 .
    CCDSi CCDS34869.1. [P35348-2 ]
    CCDS6052.1. [P35348-3 ]
    CCDS6053.1. [P35348-4 ]
    CCDS6054.1. [P35348-1 ]
    PIRi JN0765.
    S65656.
    S65657.
    RefSeqi NP_000671.2. NM_000680.2. [P35348-1 ]
    NP_150645.2. NM_033302.2. [P35348-3 ]
    NP_150646.3. NM_033303.3. [P35348-2 ]
    NP_150647.2. NM_033304.2. [P35348-4 ]
    XP_005273471.1. XM_005273414.2. [P35348-1 ]
    XP_006716356.1. XM_006716293.1. [P35348-3 ]
    UniGenei Hs.709175.

    3D structure databases

    ProteinModelPortali P35348.
    SMRi P35348. Positions 29-341.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    DIPi DIP-33401N.
    IntActi P35348. 3 interactions.

    Chemistry

    BindingDBi P35348.
    ChEMBLi CHEMBL229.
    DrugBanki DB00346. Alfuzosin.
    DB01118. Amiodarone.
    DB00182. Amphetamine.
    DB00865. Benzphetamine.
    DB00217. Bethanidine.
    DB01136. Carvedilol.
    DB00298. Dapiprazole.
    DB04840. Debrisoquin.
    DB01576. Dextroamphetamine.
    DB00590. Doxazosin.
    DB00751. Epinastine.
    DB00668. Epinephrine.
    DB00696. Ergotamine.
    DB00875. Flupenthixol.
    DB00226. Guanadrel Sulfate.
    DB01170. Guanethidine.
    DB00598. Labetalol.
    DB01255. Lisdexamfetamine.
    DB00934. Maprotiline.
    DB01365. Mephentermine.
    DB00610. Metaraminol.
    DB01577. Methamphetamine.
    DB01403. Methotrimeprazine.
    DB00723. Methoxamine.
    DB00211. Midodrine.
    DB01149. Nefazodone.
    DB00699. Nicergoline.
    DB00665. Nilutamide.
    DB00368. Norepinephrine.
    DB00506. Norgestrel.
    DB00935. Oxymetazoline.
    DB00850. Perphenazine.
    DB01579. Phendimetrazine.
    DB00925. Phenoxybenzamine.
    DB00388. Phenylephrine.
    DB00397. Phenylpropanolamine.
    DB00457. Prazosin.
    DB00420. Promazine.
    DB01069. Promethazine.
    DB01608. Propericiazine.
    DB00777. Propiomazine.
    DB00852. Pseudoephedrine.
    DB00734. Risperidone.
    DB06144. Sertindole.
    DB00706. Tamsulosin.
    DB01162. Terazosin.
    DB00679. Thioridazine.
    DB00797. Tolazoline.
    DB00656. Trazodone.
    DB00831. Trifluoperazine.
    DB00246. Ziprasidone.
    GuidetoPHARMACOLOGYi 22.

    Protein family/group databases

    GPCRDBi Search...

    PTM databases

    PhosphoSitei P35348.

    Polymorphism databases

    DMDMi 1168246.

    Proteomic databases

    PaxDbi P35348.
    PRIDEi P35348.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000276393 ; ENSP00000276393 ; ENSG00000120907 . [P35348-1 ]
    ENST00000354550 ; ENSP00000346557 ; ENSG00000120907 . [P35348-4 ]
    ENST00000380572 ; ENSP00000369946 ; ENSG00000120907 . [P35348-6 ]
    ENST00000380573 ; ENSP00000369947 ; ENSG00000120907 . [P35348-1 ]
    ENST00000380582 ; ENSP00000369956 ; ENSG00000120907 . [P35348-3 ]
    ENST00000380586 ; ENSP00000369960 ; ENSG00000120907 . [P35348-2 ]
    ENST00000519096 ; ENSP00000431073 ; ENSG00000120907 . [P35348-7 ]
    ENST00000521711 ; ENSP00000430414 ; ENSG00000120907 . [P35348-7 ]
    GeneIDi 148.
    KEGGi hsa:148.
    UCSCi uc003xfe.1. human. [P35348-3 ]
    uc003xfg.1. human. [P35348-4 ]
    uc003xfh.1. human. [P35348-1 ]
    uc010lul.1. human. [P35348-8 ]
    uc010lum.1. human. [P35348-9 ]
    uc022atd.1. human. [P35348-5 ]

    Organism-specific databases

    CTDi 148.
    GeneCardsi GC08M026605.
    HGNCi HGNC:277. ADRA1A.
    HPAi HPA029678.
    MIMi 104221. gene.
    neXtProti NX_P35348.
    PharmGKBi PA34.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG253615.
    HOVERGENi HBG106962.
    KOi K04135.
    OMAi CTTARVR.
    OrthoDBi EOG7H4DTB.
    PhylomeDBi P35348.
    TreeFami TF331895.

    Enzyme and pathway databases

    Reactomei REACT_16927. Adrenoceptors.
    REACT_18283. G alpha (q) signalling events.
    REACT_18407. G alpha (12/13) signalling events.
    SignaLinki P35348.

    Miscellaneous databases

    GeneWikii Alpha-1A_adrenergic_receptor.
    GenomeRNAii 148.
    NextBioi 585.
    PROi P35348.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P35348.
    Bgeei P35348.
    CleanExi HS_ADRA1A.
    Genevestigatori P35348.

    Family and domain databases

    Gene3Di 1.20.1070.10. 1 hit.
    InterProi IPR002233. ADR_fam.
    IPR001004. ADRA1A_rcpt.
    IPR000276. GPCR_Rhodpsn.
    IPR017452. GPCR_Rhodpsn_7TM.
    [Graphical view ]
    Pfami PF00001. 7tm_1. 1 hit.
    [Graphical view ]
    PRINTSi PR01103. ADRENERGICR.
    PR00557. ADRENRGCA1AR.
    PR00237. GPCRRHODOPSN.
    PROSITEi PS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
    PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning, functional expression and tissue distribution of human cDNA for the alpha 1C-adrenergic receptor."
      Hirasawa A., Horie K., Tanaka T., Takagaki K., Murai M., Yano J., Tsujimoto G.
      Biochem. Biophys. Res. Commun. 195:902-909(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1), VARIANT ARG-347.
      Tissue: Prostate.
    2. "Cloning, expression and characterization of human alpha adrenergic receptors alpha 1a, alpha 1b and alpha 1c."
      Weinberg D.H., Trivedi P., Tan C.P., Mitra S., Perkins-Barrow A., Borkowski D., Strader C.D., Bayne M.
      Biochem. Biophys. Res. Commun. 201:1296-1304(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ARG-347.
      Tissue: Heart.
    3. "The alpha 1-adrenergic receptor that mediates smooth muscle contraction in human prostate has the pharmacological properties of the cloned human alpha 1c subtype."
      Forray C., Bard J.A., Wetzel J.M., Chiu G., Shapiro E., Tang R., Lepor H., Hartig P.R., Weinshank R.L., Branchek T.A., Gluchowski C.
      Mol. Pharmacol. 45:703-708(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1).
      Tissue: Hippocampus and Lymphocyte.
    4. "The alpha 1C-adrenoceptor in human prostate: cloning, functional expression, and localization to specific prostatic cell types."
      Tseng-Crank J., Kost T., Goetz A., Hazum S., Roberson K.M., Haizlip J., Godinot N., Robertson C.N., Saussy D.
      Br. J. Pharmacol. 115:1475-1485(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ARG-347.
    5. "Cloning, functional expression and tissue distribution of human alpha 1c-adrenoceptor splice variants."
      Hirasawa A., Shibata K., Horie K., Takei Y., Obika K., Tanaka T., Muramoto N., Takagaki K., Yano J., Tsujimoto G.
      FEBS Lett. 363:256-260(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), VARIANT ARG-347, TISSUE SPECIFICITY.
      Tissue: Prostate.
    6. "Cloning and pharmacological characterization of human alpha-1 adrenergic receptors: sequence corrections and direct comparison with other species homologues."
      Schwinn D.A., Johnston G.I., Page S.O., Mosley M.J., Wilson K.H., Worman N.P., Campbell S., Fidock M.D., Furness L.M., Parry-Smith D.J., Peter B., Bailey D.S.
      J. Pharmacol. Exp. Ther. 272:134-142(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ARG-347.
    7. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), TISSUE SPECIFICITY.
      Tissue: Prostate.
    8. "Truncated isoforms inhibit [3H]prazosin binding and cellular trafficking of native human alpha1A-adrenoceptors."
      Coge F., Guenin S.P., Renouard-Try A., Rique H., Ouvry C., Fabry N., Beauverger P., Nicolas J.P., Galizzi J.-P., Boutin J.A., Canet E.
      Biochem. J. 343:231-239(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 5; 6; 7; 8 AND 9).
      Tissue: Liver.
    9. "RT-PCR cloning and sequence analysis of adrenergic receptor subtype-alpha-1a cDNA from human prostrate cell-line DU-145."
      Banerjee A.G.N., Aarti A.
      Submitted (JUN-2001) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    10. "Genome-wide discovery and analysis of human seven transmembrane helix receptor genes."
      Suwa M., Sato T., Okouchi I., Arita M., Futami K., Matsumoto S., Tsutsumi S., Aburatani H., Asai K., Akiyama Y.
      Submitted (JUL-2001) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    11. "cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org)."
      Kopatz S.A., Aronstam R.S., Sharma S.V.
      Submitted (SEP-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    12. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Cerebellum.
    13. NHLBI resequencing and genotyping service (RS&G)
      Submitted (DEC-2007) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    14. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ARG-347.
    15. "Identification of alpha 1-adrenoceptor subtypes present in the human prostate."
      Faure C., Pimoule C., Vallancien G., Langer S.Z., Graham D.
      Life Sci. 54:1595-1605(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 52-400 (ISOFORMS 1/2/3/4), TISSUE SPECIFICITY, VARIANT ARG-347.
      Tissue: Prostate.
    16. "Nuclear alpha1-adrenergic receptors signal activated ERK localization to caveolae in adult cardiac myocytes."
      Wright C.D., Chen Q., Baye N.L., Huang Y., Healy C.L., Kasinathan S., O'Connell T.D.
      Circ. Res. 103:992-1000(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION, FUNCTION.
    17. "Nuclear localization drives alpha1-adrenergic receptor oligomerization and signaling in cardiac myocytes."
      Wright C.D., Wu S.C., Dahl E.F., Sazama A.J., O'Connell T.D.
      Cell. Signal. 24:794-802(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION, SUBUNIT, FUNCTION, MUTAGENESIS OF LYS-334; LYS-335; ARG-342; ARG-348 AND LYS-349.
    18. "Alpha 1a-adrenoceptor polymorphism: pharmacological characterization and association with benign prostatic hypertrophy."
      Shibata K., Hirasawa A., Moriyama N., Kawabe K., Ogawa S., Tsujimoto G.
      Br. J. Pharmacol. 118:1403-1408(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANT ARG-347.
    19. Cited for: VARIANT ARG-347.
    20. Cited for: VARIANT [LARGE SCALE ANALYSIS] TRP-40.

    Entry informationi

    Entry nameiADA1A_HUMAN
    AccessioniPrimary (citable) accession number: P35348
    Secondary accession number(s): A8K0I3
    , B0ZBD1, B0ZBD2, B0ZBD4, B0ZBD5, B0ZBD6, B0ZBD8, B0ZBD9, O60451, Q13675, Q13729, Q4VBM7, Q6RUJ4, Q6RUJ5, Q6RUJ7, Q6RUJ8, Q6RUJ9, Q96RE8, Q9UD63, Q9UD67
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 1, 1994
    Last sequence update: November 1, 1995
    Last modified: October 1, 2014
    This is version 149 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. 7-transmembrane G-linked receptors
      List of 7-transmembrane G-linked receptor entries
    2. Human chromosome 8
      Human chromosome 8: entries, gene names and cross-references to MIM
    3. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    4. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    5. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3