Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Alpha-1A adrenergic receptor

Gene

ADRA1A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

This alpha-adrenergic receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Its effect is mediated by G(q) and G(11) proteins. Nuclear ADRA1A-ADRA1B heterooligomers regulate phenylephrine(PE)-stimulated ERK signaling in cardiac myocytes.2 Publications

GO - Molecular functioni

  • alpha1-adrenergic receptor activity Source: BHF-UCL
  • protein heterodimerization activity Source: UniProtKB

GO - Biological processi

Keywordsi

Molecular functionG-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

ReactomeiR-HSA-390696 Adrenoceptors
R-HSA-416476 G alpha (q) signalling events
R-HSA-416482 G alpha (12/13) signalling events
SignaLinkiP35348
SIGNORiP35348

Names & Taxonomyi

Protein namesi
Recommended name:
Alpha-1A adrenergic receptor
Alternative name(s):
Alpha-1A adrenoreceptor
Short name:
Alpha-1A adrenoceptor
Alpha-1C adrenergic receptor
Alpha-adrenergic receptor 1c
Gene namesi
Name:ADRA1A
Synonyms:ADRA1C
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 8

Organism-specific databases

EuPathDBiHostDB:ENSG00000120907.17
HGNCiHGNC:277 ADRA1A
MIMi104221 gene
neXtProtiNX_P35348

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 27ExtracellularBy similarityAdd BLAST27
Transmembranei28 – 51Helical; Name=1By similarityAdd BLAST24
Topological domaini52 – 64CytoplasmicBy similarityAdd BLAST13
Transmembranei65 – 88Helical; Name=2By similarityAdd BLAST24
Topological domaini89 – 99ExtracellularBy similarityAdd BLAST11
Transmembranei100 – 122Helical; Name=3By similarityAdd BLAST23
Topological domaini123 – 143CytoplasmicBy similarityAdd BLAST21
Transmembranei144 – 167Helical; Name=4By similarityAdd BLAST24
Topological domaini168 – 181ExtracellularBy similarityAdd BLAST14
Transmembranei182 – 205Helical; Name=5By similarityAdd BLAST24
Topological domaini206 – 273CytoplasmicBy similarityAdd BLAST68
Transmembranei274 – 297Helical; Name=6By similarityAdd BLAST24
Topological domaini298 – 305ExtracellularBy similarity8
Transmembranei306 – 329Helical; Name=7By similarityAdd BLAST24
Topological domaini330 – 466CytoplasmicBy similarityAdd BLAST137

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi334K → A: Abolishes targeting to the nuclear membrane of cardiac myocytes; when associated with A-335; A-342; A-348 and A-349. 1 Publication1
Mutagenesisi335K → A: Abolishes targeting to the nuclear membrane of cardiac myocytes; when associated with A-334; A-342; A-348 and A-349. 1 Publication1
Mutagenesisi342R → A: Abolishes targeting to the nuclear membrane of cardiac myocytes; when associated with A-334; A-335; A-348 and A-349. 1 Publication1
Mutagenesisi348R → A: Abolishes targeting to the nuclear membrane of cardiac myocytes; when associated with A-334; A-335; A-342 and A-349. 1 Publication1
Mutagenesisi349K → A: Abolishes targeting to the nuclear membrane of cardiac myocytes; when associated with A-334; A-335; A-342 and A-348. 1 Publication1

Organism-specific databases

DisGeNETi148
OpenTargetsiENSG00000120907
PharmGKBiPA34

Chemistry databases

ChEMBLiCHEMBL229
DrugBankiDB01472 4-Methoxyamphetamine
DB01614 Acepromazine
DB00346 Alfuzosin
DB00321 Amitriptyline
DB00543 Amoxapine
DB00182 Amphetamine
DB00964 Apraclonidine
DB01238 Aripiprazole
DB06216 Asenapine
DB00865 Benzphetamine
DB01295 Bevantolol
DB01200 Bromocriptine
DB00248 Cabergoline
DB01136 Carvedilol
DB00477 Chlorpromazine
DB09202 Cirazoline
DB00215 Citalopram
DB00575 Clonidine
DB00363 Clozapine
DB00298 Dapiprazole
DB01151 Desipramine
DB01576 Dextroamphetamine
DB00449 Dipivefrin
DB00590 Doxazosin
DB01142 Doxepin
DB04855 Dronedarone
DB00450 Droperidol
DB06262 Droxidopa
DB01364 Ephedrine
DB05492 Epicept NP-1
DB00751 Epinastine
DB00668 Epinephrine
DB01049 Ergoloid mesylate
DB01253 Ergonovine
DB00696 Ergotamine
DB01175 Escitalopram
DB00800 Fenoldopam
DB00875 Flupentixol
DB04946 Iloperidone
DB00458 Imipramine
DB06706 Isometheptene
DB00598 Labetalol
DB00408 Loxapine
DB00934 Maprotiline
DB01365 Mephentermine
DB00610 Metaraminol
DB01403 Methotrimeprazine
DB00723 Methoxamine
DB06148 Mianserin
DB00211 Midodrine
DB00370 Mirtazapine
DB06711 Naphazoline
DB01149 Nefazodone
DB00622 Nicardipine
DB00699 Nicergoline
DB00368 Norepinephrine
DB00540 Nortriptyline
DB00334 Olanzapine
DB00935 Oxymetazoline
DB01267 Paliperidone
DB01186 Pergolide
DB01579 Phendimetrazine
DB00925 Phenoxybenzamine
DB00692 Phentolamine
DB00388 Phenylephrine
DB00397 Phenylpropanolamine
DB00457 Prazosin
DB00420 Promazine
DB01069 Promethazine
DB00777 Propiomazine
DB00852 Pseudoephedrine
DB01224 Quetiapine
DB05469 R450
DB00734 Risperidone
DB06144 Sertindole
DB06207 Silodosin
DB00706 Tamsulosin
DB01162 Terazosin
DB06764 Tetryzoline
DB01622 Thioproperazine
DB00679 Thioridazine
DB13025 Tiapride
DB00797 Tolazoline
DB00656 Trazodone
DB00831 Trifluoperazine
DB00726 Trimipramine
DB06694 Xylometazoline
DB00246 Ziprasidone
DB01624 Zuclopenthixol
GuidetoPHARMACOLOGYi22

Polymorphism and mutation databases

BioMutaiADRA1A
DMDMi1168246

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000690631 – 466Alpha-1A adrenergic receptorAdd BLAST466

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi7N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi13N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi22N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi99 ↔ 176PROSITE-ProRule annotation
Modified residuei215Phosphoserine; by PKASequence analysis1
Lipidationi345S-palmitoyl cysteineSequence analysis1

Post-translational modificationi

C-terminal Ser or Thr residues may be phosphorylated.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

PaxDbiP35348
PeptideAtlasiP35348
PRIDEiP35348
ProteomicsDBi55026
55027 [P35348-2]
55028 [P35348-3]
55029 [P35348-4]
55030 [P35348-5]
55031 [P35348-6]
55032 [P35348-7]
55033 [P35348-8]
55034 [P35348-9]

PTM databases

iPTMnetiP35348
PhosphoSitePlusiP35348

Expressioni

Tissue specificityi

Expressed in heart, brain, liver and prostate, but not in kidney, lung, adrenal, aorta and pituitary. Within the prostate, expressed in the apex, base, periurethral and lateral lobe. Isoform 4 is the most abundant isoform expressed in the prostate with high levels also detected in liver and heart.3 Publications

Gene expression databases

BgeeiENSG00000120907
CleanExiHS_ADRA1A
ExpressionAtlasiP35348 baseline and differential
GenevisibleiP35348 HS

Organism-specific databases

HPAiHPA029678
HPA029679

Interactioni

Subunit structurei

Homo- and heterooligomer. Heterooligomerizes with ADRA1B homooligomers in cardiac myocytes (PubMed:22120526). Interacts with CAVIN4 (PubMed:24567387).2 Publications

GO - Molecular functioni

  • protein heterodimerization activity Source: UniProtKB

Protein-protein interaction databases

BioGridi106658, 2 interactors
CORUMiP35348
DIPiDIP-33401N
IntActiP35348, 4 interactors
STRINGi9606.ENSP00000369960

Chemistry databases

BindingDBiP35348

Structurei

3D structure databases

ProteinModelPortaliP35348
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi334 – 349Nuclear localization signalAdd BLAST16

Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family. Adrenergic receptor subfamily. ADRA1A sub-subfamily.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3656 Eukaryota
ENOG410XRW9 LUCA
GeneTreeiENSGT00760000118795
HOVERGENiHBG106962
InParanoidiP35348
KOiK04135
OMAiEILGYWA
PhylomeDBiP35348
TreeFamiTF331895

Family and domain databases

InterProiView protein in InterPro
IPR002233 ADR_fam
IPR001004 ADRA1A_rcpt
IPR000276 GPCR_Rhodpsn
IPR017452 GPCR_Rhodpsn_7TM
PfamiView protein in Pfam
PF00001 7tm_1, 1 hit
PRINTSiPR01103 ADRENERGICR
PR00557 ADRENRGCA1AR
PR00237 GPCRRHODOPSN
SMARTiView protein in SMART
SM01381 7TM_GPCR_Srsx, 1 hit
PROSITEiView protein in PROSITE
PS00237 G_PROTEIN_RECEP_F1_1, 1 hit
PS50262 G_PROTEIN_RECEP_F1_2, 1 hit

Sequences (9)i

Sequence statusi: Complete.

This entry describes 9 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P35348-1) [UniParc]FASTAAdd to basket
Also known as: Alpha 1c-1, Alpha(1A-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVFLSGNASD SSNCTQPPAP VNISKAILLG VILGGLILFG VLGNILVILS
60 70 80 90 100
VACHRHLHSV THYYIVNLAV ADLLLTSTVL PFSAIFEVLG YWAFGRVFCN
110 120 130 140 150
IWAAVDVLCC TASIMGLCII SIDRYIGVSY PLRYPTIVTQ RRGLMALLCV
160 170 180 190 200
WALSLVISIG PLFGWRQPAP EDETICQINE EPGYVLFSAL GSFYLPLAII
210 220 230 240 250
LVMYCRVYVV AKRESRGLKS GLKTDKSDSE QVTLRIHRKN APAGGSGMAS
260 270 280 290 300
AKTKTHFSVR LLKFSREKKA AKTLGIVVGC FVLCWLPFFL VMPIGSFFPD
310 320 330 340 350
FKPSETVFKI VFWLGYLNSC INPIIYPCSS QEFKKAFQNV LRIQCLCRKQ
360 370 380 390 400
SSKHALGYTL HPPSQAVEGQ HKDMVRIPVG SRETFYRISK TDGVCEWKFF
410 420 430 440 450
SSMPRGSARI TVSKDQSSCT TARVRSKSFL QVCCCVGPST PSLDKNHQVP
460
TIKVHTISLS ENGEEV
Length:466
Mass (Da):51,487
Last modified:November 1, 1995 - v2
Checksum:i1A50487531DECDF0
GO
Isoform 2 (identifier: P35348-2) [UniParc]FASTAAdd to basket
Also known as: Alpha 1c-2, Alpha(1A-2)

The sequence of this isoform differs from the canonical sequence as follows:
     424-466: VRSKSFLQVC...ISLSENGEEV → TKSRSVTRLE...CHQADATRPS

Show »
Length:475
Mass (Da):52,205
Checksum:iDE3CEEDD1AB3E56D
GO
Isoform 3 (identifier: P35348-3) [UniParc]FASTAAdd to basket
Also known as: Alpha 1c-3, Alpha(1A-3)

The sequence of this isoform differs from the canonical sequence as follows:
     424-429: VRSKSF → GHTPMT
     430-466: Missing.

Show »
Length:429
Mass (Da):47,461
Checksum:iE67B19B5CA668687
GO
Isoform 4 (identifier: P35348-4) [UniParc]FASTAAdd to basket
Also known as: Alpha(1A-4)

The sequence of this isoform differs from the canonical sequence as follows:
     424-466: VRSKSFLQVCCCVGPSTPSLDKNHQVPTIKVHTISLSENGEEV → RGMDCRYFTKNCREHIKHVNFMMPPWRKGSEC

Show »
Length:455
Mass (Da):50,777
Checksum:i80C61B88FA608B6C
GO
Isoform 5 (identifier: P35348-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     296-297: SF → KS
     298-466: Missing.

Show »
Length:297
Mass (Da):32,433
Checksum:i4871F9BE42A87D6E
GO
Isoform 6 (identifier: P35348-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     295-342: GSFFPDFKPS...FKKAFQNVLR → DEETEAQEGK...VSRKDTCGVW
     343-466: Missing.

Show »
Length:342
Mass (Da):37,468
Checksum:i2B6E7CC81B9CBE50
GO
Isoform 7 (identifier: P35348-7) [UniParc]FASTAAdd to basket
Also known as: 2b/3b

The sequence of this isoform differs from the canonical sequence as follows:
     296-324: SFFPDFKPSETVFKIVFWLGYLNSCINPI → TYILKYDVLFWRKGLSVCTRLRERKEIKN
     325-466: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:324
Mass (Da):35,829
Checksum:i608DACD5497EE83E
GO
Isoform 8 (identifier: P35348-8) [UniParc]FASTAAdd to basket
Also known as: 2c

The sequence of this isoform differs from the canonical sequence as follows:
     295-466: GSFFPDFKPS...ISLSENGEEV → DEVSLCHQAG...GQDDLDLLTS

Show »
Length:370
Mass (Da):40,725
Checksum:iF00E717A4C4A59AC
GO
Isoform 9 (identifier: P35348-9) [UniParc]FASTAAdd to basket
Also known as: 3c

The sequence of this isoform differs from the canonical sequence as follows:
     296-466: SFFPDFKPSE...ISLSENGEEV → THTHDMKPAS...TVTDTGKTVT

Show »
Length:372
Mass (Da):40,638
Checksum:i839C5750F9B428F5
GO

Sequence cautioni

Isoform 2 : The sequence ACA05900 differs from that shown. Reason: Erroneous gene model prediction.Curated
Isoform 2 : The sequence BAA06901 differs from that shown. Reason: Frameshift at position 465.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti43G → C in AAA93114 (PubMed:8564208).Curated1
Sequence conflicti129S → T in AAA93114 (PubMed:8564208).Curated1
Sequence conflicti130Y → H in AAK77197 (Ref. 9) Curated1
Sequence conflicti185V → A in AAH95512 (PubMed:15489334).Curated1
Sequence conflicti338Q → C (PubMed:8024574).Curated1
Sequence conflicti359T → P in AAA93114 (PubMed:8564208).Curated1
Sequence conflicti384T → A in AAK77197 (Ref. 9) Curated1
Sequence conflicti387R → G in AAK77197 (Ref. 9) Curated1
Sequence conflicti390K → R in AAK77197 (Ref. 9) Curated1
Sequence conflicti431Q → E in BAA04960 (PubMed:8396931).Curated1
Sequence conflicti437G → E in AAK77197 (Ref. 9) Curated1
Sequence conflicti442S → C in AAA93114 (PubMed:8564208).Curated1
Isoform 6 (identifier: P35348-6)
Sequence conflicti302E → Q in AAR84650 (PubMed:10493934).Curated1
Isoform 4 (identifier: P35348-4)
Sequence conflicti453S → L in AAC06138 (PubMed:9490024).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03575640G → W in a breast cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_049370200I → S. Corresponds to variant dbSNP:rs2229125Ensembl.1
Natural variantiVAR_019509347C → R Frequent polymorphism. 9 PublicationsCorresponds to variant dbSNP:rs1048101Ensembl.1
Natural variantiVAR_049371414K → R. Corresponds to variant dbSNP:rs3730247Ensembl.1
Natural variantiVAR_049372465E → D. Corresponds to variant dbSNP:rs2229126Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_011046295 – 466GSFFP…NGEEV → DEVSLCHQAGVQWHDLGSLQ PPPPGFKRFSCLSLPSSWDY RDVPPGRRHQAQLIFVFLVE TGFHHVGQDDLDLLTS in isoform 8. 1 PublicationAdd BLAST172
Alternative sequenceiVSP_011053295 – 342GSFFP…QNVLR → DEETEAQEGKNDSPSFKQPV HHAAVLGLEVMEKENLEGVS RKDTCGVW in isoform 6. 1 PublicationAdd BLAST48
Alternative sequenceiVSP_011049296 – 466SFFPD…NGEEV → THTHDMKPASRPRLLSLLPK EGEHETHHWSCDPLSLESTP GAQEPCLTLGFTSLSSIHLT KAQIQHVTVTDTGKTVT in isoform 9. 1 PublicationAdd BLAST171
Alternative sequenceiVSP_011047296 – 324SFFPD…CINPI → TYILKYDVLFWRKGLSVCTR LRERKEIKN in isoform 7. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_011051296 – 297SF → KS in isoform 5. 1 Publication2
Alternative sequenceiVSP_011052298 – 466Missing in isoform 5. 1 PublicationAdd BLAST169
Alternative sequenceiVSP_011048325 – 466Missing in isoform 7. 1 PublicationAdd BLAST142
Alternative sequenceiVSP_011054343 – 466Missing in isoform 6. 1 PublicationAdd BLAST124
Alternative sequenceiVSP_011055424 – 466VRSKS…NGEEV → TKSRSVTRLECSGMILAHCN LRLPGSRDSPASASQAAGTT GMCHQADATRPS in isoform 2. 1 PublicationAdd BLAST43
Alternative sequenceiVSP_011050424 – 466VRSKS…NGEEV → RGMDCRYFTKNCREHIKHVN FMMPPWRKGSEC in isoform 4. 1 PublicationAdd BLAST43
Alternative sequenceiVSP_011044424 – 429VRSKSF → GHTPMT in isoform 3. 1 Publication6
Alternative sequenceiVSP_011045430 – 466Missing in isoform 3. 1 PublicationAdd BLAST37

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D25235 mRNA Translation: BAA04960.1
U03866 Genomic DNA Translation: AAB60353.1
U02569 mRNA Translation: AAA93114.1
D32201 mRNA Translation: BAA06900.1
D32202 mRNA Translation: BAA06901.1 Frameshift.
L31774 mRNA Translation: AAB59486.1
AF013261 mRNA Translation: AAC06138.1
AY491775 mRNA Translation: AAR84644.1
AY491776 mRNA Translation: AAR84645.1
AY491777 mRNA Translation: AAR84646.1
AY491778 mRNA Translation: AAR84647.1
AY491779 mRNA Translation: AAR84648.1
AY491780 mRNA Translation: AAR84649.1
AY491781 mRNA Translation: AAR84650.1
AF395806 mRNA Translation: AAK77197.1
AB065703 Genomic DNA Translation: BAC05926.1
AY389505 Genomic DNA Translation: AAQ91331.1
AK289548 mRNA Translation: BAF82237.1
EU326301 Genomic DNA Translation: ACA05899.1
EU326301 Genomic DNA Translation: ACA05900.1 Sequence problems.
EU326301 Genomic DNA Translation: ACA05902.1
EU326301 Genomic DNA Translation: ACA05903.1
EU326301 Genomic DNA Translation: ACA05904.1
EU326301 Genomic DNA Translation: ACA05905.1
EU326301 Genomic DNA Translation: ACA05906.1
EU326301 Genomic DNA Translation: ACA05907.1
BC095512 mRNA Translation: AAH95512.1
CCDSiCCDS34869.1 [P35348-2]
CCDS6052.1 [P35348-3]
CCDS6053.1 [P35348-4]
CCDS6054.1 [P35348-1]
CCDS83269.1 [P35348-6]
PIRiJN0765
S65656
S65657
RefSeqiNP_000671.2, NM_000680.3 [P35348-1]
NP_001309431.1, NM_001322502.1 [P35348-9]
NP_001309432.1, NM_001322503.1 [P35348-8]
NP_001309433.1, NM_001322504.1 [P35348-6]
NP_150645.2, NM_033302.3 [P35348-3]
NP_150646.3, NM_033303.4 [P35348-2]
NP_150647.2, NM_033304.3 [P35348-4]
XP_006716356.1, XM_006716293.3 [P35348-3]
XP_011542713.1, XM_011544411.2 [P35348-7]
UniGeneiHs.52931
Hs.709175

Genome annotation databases

EnsembliENST00000276393; ENSP00000276393; ENSG00000120907 [P35348-1]
ENST00000354550; ENSP00000346557; ENSG00000120907 [P35348-4]
ENST00000380572; ENSP00000369946; ENSG00000120907 [P35348-6]
ENST00000380573; ENSP00000369947; ENSG00000120907 [P35348-1]
ENST00000380582; ENSP00000369956; ENSG00000120907 [P35348-3]
ENST00000380586; ENSP00000369960; ENSG00000120907 [P35348-2]
ENST00000519096; ENSP00000431073; ENSG00000120907 [P35348-7]
ENST00000521711; ENSP00000430414; ENSG00000120907 [P35348-7]
GeneIDi148
KEGGihsa:148
UCSCiuc003xfc.1 human [P35348-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiADA1A_HUMAN
AccessioniPrimary (citable) accession number: P35348
Secondary accession number(s): A8K0I3
, B0ZBD1, B0ZBD2, B0ZBD4, B0ZBD5, B0ZBD6, B0ZBD8, B0ZBD9, O60451, Q13675, Q13729, Q4VBM7, Q6RUJ4, Q6RUJ5, Q6RUJ7, Q6RUJ8, Q6RUJ9, Q96RE8, Q9UD63, Q9UD67
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 1, 1994
Last sequence update: November 1, 1995
Last modified: June 20, 2018
This is version 185 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health