Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Alpha-1A adrenergic receptor

Gene

ADRA1A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

This alpha-adrenergic receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Its effect is mediated by G(q) and G(11) proteins. Nuclear ADRA1A-ADRA1B heterooligomers regulate phenylephrine(PE)-stimulated ERK signaling in cardiac myocytes.2 Publications

GO - Molecular functioni

  • alpha1-adrenergic receptor activity Source: UniProtKB
  • protein heterodimerization activity Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

BioCyciZFISH:ENSG00000120907-MONOMER.
ReactomeiR-HSA-390696. Adrenoceptors.
R-HSA-416476. G alpha (q) signalling events.
R-HSA-416482. G alpha (12/13) signalling events.
SignaLinkiP35348.
SIGNORiP35348.

Names & Taxonomyi

Protein namesi
Recommended name:
Alpha-1A adrenergic receptor
Alternative name(s):
Alpha-1A adrenoreceptor
Short name:
Alpha-1A adrenoceptor
Alpha-1C adrenergic receptor
Alpha-adrenergic receptor 1c
Gene namesi
Name:ADRA1A
Synonyms:ADRA1C
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 8

Organism-specific databases

HGNCiHGNC:277. ADRA1A.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 27ExtracellularBy similarityAdd BLAST27
Transmembranei28 – 51Helical; Name=1By similarityAdd BLAST24
Topological domaini52 – 64CytoplasmicBy similarityAdd BLAST13
Transmembranei65 – 88Helical; Name=2By similarityAdd BLAST24
Topological domaini89 – 99ExtracellularBy similarityAdd BLAST11
Transmembranei100 – 122Helical; Name=3By similarityAdd BLAST23
Topological domaini123 – 143CytoplasmicBy similarityAdd BLAST21
Transmembranei144 – 167Helical; Name=4By similarityAdd BLAST24
Topological domaini168 – 181ExtracellularBy similarityAdd BLAST14
Transmembranei182 – 205Helical; Name=5By similarityAdd BLAST24
Topological domaini206 – 273CytoplasmicBy similarityAdd BLAST68
Transmembranei274 – 297Helical; Name=6By similarityAdd BLAST24
Topological domaini298 – 305ExtracellularBy similarity8
Transmembranei306 – 329Helical; Name=7By similarityAdd BLAST24
Topological domaini330 – 466CytoplasmicBy similarityAdd BLAST137

GO - Cellular componenti

  • integral component of plasma membrane Source: ProtInc
  • nuclear membrane Source: UniProtKB
  • nucleus Source: UniProtKB
  • plasma membrane Source: Reactome
  • T-tubule Source: Ensembl
  • Z disc Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi334K → A: Abolishes targeting to the nuclear membrane of cardiac myocytes; when associated with A-335; A-342; A-348 and A-349. 1 Publication1
Mutagenesisi335K → A: Abolishes targeting to the nuclear membrane of cardiac myocytes; when associated with A-334; A-342; A-348 and A-349. 1 Publication1
Mutagenesisi342R → A: Abolishes targeting to the nuclear membrane of cardiac myocytes; when associated with A-334; A-335; A-348 and A-349. 1 Publication1
Mutagenesisi348R → A: Abolishes targeting to the nuclear membrane of cardiac myocytes; when associated with A-334; A-335; A-342 and A-349. 1 Publication1
Mutagenesisi349K → A: Abolishes targeting to the nuclear membrane of cardiac myocytes; when associated with A-334; A-335; A-342 and A-348. 1 Publication1

Organism-specific databases

DisGeNETi148.
OpenTargetsiENSG00000120907.
PharmGKBiPA34.

Chemistry databases

ChEMBLiCHEMBL229.
DrugBankiDB01614. Acepromazine.
DB00346. Alfuzosin.
DB00321. Amitriptyline.
DB00543. Amoxapine.
DB00182. Amphetamine.
DB00964. Apraclonidine.
DB01238. Aripiprazole.
DB06216. Asenapine.
DB00865. Benzphetamine.
DB01295. Bevantolol.
DB01200. Bromocriptine.
DB00248. Cabergoline.
DB01136. Carvedilol.
DB00477. Chlorpromazine.
DB00215. Citalopram.
DB00575. Clonidine.
DB00363. Clozapine.
DB00298. Dapiprazole.
DB01151. Desipramine.
DB01576. Dextroamphetamine.
DB00449. Dipivefrin.
DB00590. Doxazosin.
DB01142. Doxepin.
DB04855. Dronedarone.
DB00450. Droperidol.
DB06262. Droxidopa.
DB01364. Ephedrine.
DB00751. Epinastine.
DB00668. Epinephrine.
DB01049. Ergoloid mesylate.
DB01253. Ergonovine.
DB00696. Ergotamine.
DB01175. Escitalopram.
DB00800. Fenoldopam.
DB00875. Flupentixol.
DB04946. Iloperidone.
DB00458. Imipramine.
DB06706. Isometheptene.
DB00598. Labetalol.
DB06707. Levonordefrin.
DB00408. Loxapine.
DB00934. Maprotiline.
DB01365. Mephentermine.
DB00610. Metaraminol.
DB01403. Methotrimeprazine.
DB00723. Methoxamine.
DB06148. Mianserin.
DB00211. Midodrine.
DB00370. Mirtazapine.
DB06711. Naphazoline.
DB01149. Nefazodone.
DB00622. Nicardipine.
DB00699. Nicergoline.
DB00368. Norepinephrine.
DB00540. Nortriptyline.
DB00334. Olanzapine.
DB00935. Oxymetazoline.
DB01267. Paliperidone.
DB01186. Pergolide.
DB01579. Phendimetrazine.
DB00925. Phenoxybenzamine.
DB00692. Phentolamine.
DB00388. Phenylephrine.
DB00397. Phenylpropanolamine.
DB00457. Prazosin.
DB00420. Promazine.
DB01069. Promethazine.
DB00777. Propiomazine.
DB00852. Pseudoephedrine.
DB01224. Quetiapine.
DB00734. Risperidone.
DB06144. Sertindole.
DB06207. Silodosin.
DB00706. Tamsulosin.
DB01162. Terazosin.
DB06764. Tetryzoline.
DB01622. Thioproperazine.
DB00679. Thioridazine.
DB00797. Tolazoline.
DB00656. Trazodone.
DB00831. Trifluoperazine.
DB00726. Trimipramine.
DB06694. Xylometazoline.
DB00246. Ziprasidone.
DB01624. Zuclopenthixol.
GuidetoPHARMACOLOGYi22.

Polymorphism and mutation databases

BioMutaiADRA1A.
DMDMi1168246.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000690631 – 466Alpha-1A adrenergic receptorAdd BLAST466

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi7N-linked (GlcNAc...)Sequence analysis1
Glycosylationi13N-linked (GlcNAc...)Sequence analysis1
Glycosylationi22N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi99 ↔ 176PROSITE-ProRule annotation
Modified residuei215Phosphoserine; by PKASequence analysis1
Lipidationi345S-palmitoyl cysteineSequence analysis1

Post-translational modificationi

C-terminal Ser or Thr residues may be phosphorylated.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

PaxDbiP35348.
PeptideAtlasiP35348.
PRIDEiP35348.

PTM databases

iPTMnetiP35348.
PhosphoSitePlusiP35348.

Expressioni

Tissue specificityi

Expressed in heart, brain, liver and prostate, but not in kidney, lung, adrenal, aorta and pituitary. Within the prostate, expressed in the apex, base, periurethral and lateral lobe. Isoform 4 is the most abundant isoform expressed in the prostate with high levels also detected in liver and heart.3 Publications

Gene expression databases

BgeeiENSG00000120907.
CleanExiHS_ADRA1A.
ExpressionAtlasiP35348. baseline and differential.
GenevisibleiP35348. HS.

Organism-specific databases

HPAiHPA029678.
HPA029679.

Interactioni

Subunit structurei

Homo- and heterooligomer. Heterooligomerizes with ADRA1B homooligomers in cardiac myocytes.1 Publication

GO - Molecular functioni

  • protein heterodimerization activity Source: UniProtKB

Protein-protein interaction databases

DIPiDIP-33401N.
IntActiP35348. 3 interactors.
STRINGi9606.ENSP00000369960.

Chemistry databases

BindingDBiP35348.

Structurei

3D structure databases

ProteinModelPortaliP35348.
SMRiP35348.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi334 – 349Nuclear localization signalAdd BLAST16

Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family. Adrenergic receptor subfamily. ADRA1A sub-subfamily.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3656. Eukaryota.
ENOG410XRW9. LUCA.
GeneTreeiENSGT00760000118795.
HOVERGENiHBG106962.
InParanoidiP35348.
KOiK04135.
OMAiETFYRIS.
PhylomeDBiP35348.
TreeFamiTF331895.

Family and domain databases

InterProiIPR002233. ADR_fam.
IPR001004. ADRA1A_rcpt.
IPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
[Graphical view]
PfamiPF00001. 7tm_1. 1 hit.
[Graphical view]
PRINTSiPR01103. ADRENERGICR.
PR00557. ADRENRGCA1AR.
PR00237. GPCRRHODOPSN.
SMARTiSM01381. 7TM_GPCR_Srsx. 1 hit.
[Graphical view]
PROSITEiPS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]

Sequences (9)i

Sequence statusi: Complete.

This entry describes 9 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P35348-1) [UniParc]FASTAAdd to basket
Also known as: Alpha 1c-1, Alpha(1A-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVFLSGNASD SSNCTQPPAP VNISKAILLG VILGGLILFG VLGNILVILS
60 70 80 90 100
VACHRHLHSV THYYIVNLAV ADLLLTSTVL PFSAIFEVLG YWAFGRVFCN
110 120 130 140 150
IWAAVDVLCC TASIMGLCII SIDRYIGVSY PLRYPTIVTQ RRGLMALLCV
160 170 180 190 200
WALSLVISIG PLFGWRQPAP EDETICQINE EPGYVLFSAL GSFYLPLAII
210 220 230 240 250
LVMYCRVYVV AKRESRGLKS GLKTDKSDSE QVTLRIHRKN APAGGSGMAS
260 270 280 290 300
AKTKTHFSVR LLKFSREKKA AKTLGIVVGC FVLCWLPFFL VMPIGSFFPD
310 320 330 340 350
FKPSETVFKI VFWLGYLNSC INPIIYPCSS QEFKKAFQNV LRIQCLCRKQ
360 370 380 390 400
SSKHALGYTL HPPSQAVEGQ HKDMVRIPVG SRETFYRISK TDGVCEWKFF
410 420 430 440 450
SSMPRGSARI TVSKDQSSCT TARVRSKSFL QVCCCVGPST PSLDKNHQVP
460
TIKVHTISLS ENGEEV
Length:466
Mass (Da):51,487
Last modified:November 1, 1995 - v2
Checksum:i1A50487531DECDF0
GO
Isoform 2 (identifier: P35348-2) [UniParc]FASTAAdd to basket
Also known as: Alpha 1c-2, Alpha(1A-2)

The sequence of this isoform differs from the canonical sequence as follows:
     424-466: VRSKSFLQVC...ISLSENGEEV → TKSRSVTRLE...CHQADATRPS

Show »
Length:475
Mass (Da):52,205
Checksum:iDE3CEEDD1AB3E56D
GO
Isoform 3 (identifier: P35348-3) [UniParc]FASTAAdd to basket
Also known as: Alpha 1c-3, Alpha(1A-3)

The sequence of this isoform differs from the canonical sequence as follows:
     424-429: VRSKSF → GHTPMT
     430-466: Missing.

Show »
Length:429
Mass (Da):47,461
Checksum:iE67B19B5CA668687
GO
Isoform 4 (identifier: P35348-4) [UniParc]FASTAAdd to basket
Also known as: Alpha(1A-4)

The sequence of this isoform differs from the canonical sequence as follows:
     424-466: VRSKSFLQVCCCVGPSTPSLDKNHQVPTIKVHTISLSENGEEV → RGMDCRYFTKNCREHIKHVNFMMPPWRKGSEC

Show »
Length:455
Mass (Da):50,777
Checksum:i80C61B88FA608B6C
GO
Isoform 5 (identifier: P35348-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     296-297: SF → KS
     298-466: Missing.

Show »
Length:297
Mass (Da):32,433
Checksum:i4871F9BE42A87D6E
GO
Isoform 6 (identifier: P35348-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     295-342: GSFFPDFKPS...FKKAFQNVLR → DEETEAQEGK...VSRKDTCGVW
     343-466: Missing.

Show »
Length:342
Mass (Da):37,468
Checksum:i2B6E7CC81B9CBE50
GO
Isoform 7 (identifier: P35348-7) [UniParc]FASTAAdd to basket
Also known as: 2b/3b

The sequence of this isoform differs from the canonical sequence as follows:
     296-324: SFFPDFKPSETVFKIVFWLGYLNSCINPI → TYILKYDVLFWRKGLSVCTRLRERKEIKN
     325-466: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:324
Mass (Da):35,829
Checksum:i608DACD5497EE83E
GO
Isoform 8 (identifier: P35348-8) [UniParc]FASTAAdd to basket
Also known as: 2c

The sequence of this isoform differs from the canonical sequence as follows:
     295-466: GSFFPDFKPS...ISLSENGEEV → DEVSLCHQAG...GQDDLDLLTS

Show »
Length:370
Mass (Da):40,725
Checksum:iF00E717A4C4A59AC
GO
Isoform 9 (identifier: P35348-9) [UniParc]FASTAAdd to basket
Also known as: 3c

The sequence of this isoform differs from the canonical sequence as follows:
     296-466: SFFPDFKPSE...ISLSENGEEV → THTHDMKPAS...TVTDTGKTVT

Show »
Length:372
Mass (Da):40,638
Checksum:i839C5750F9B428F5
GO

Sequence cautioni

Isoform 2 : The sequence ACA05900 differs from that shown. Reason: Erroneous gene model prediction.Curated
Isoform 2 : The sequence BAA06901 differs from that shown. Reason: Frameshift at position 465.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti43G → C in AAA93114 (PubMed:8564208).Curated1
Sequence conflicti129S → T in AAA93114 (PubMed:8564208).Curated1
Sequence conflicti130Y → H in AAK77197 (Ref. 9) Curated1
Sequence conflicti185V → A in AAH95512 (PubMed:15489334).Curated1
Sequence conflicti338Q → C (PubMed:8024574).Curated1
Sequence conflicti359T → P in AAA93114 (PubMed:8564208).Curated1
Sequence conflicti384T → A in AAK77197 (Ref. 9) Curated1
Sequence conflicti387R → G in AAK77197 (Ref. 9) Curated1
Sequence conflicti390K → R in AAK77197 (Ref. 9) Curated1
Sequence conflicti431Q → E in BAA04960 (PubMed:8396931).Curated1
Sequence conflicti437G → E in AAK77197 (Ref. 9) Curated1
Sequence conflicti442S → C in AAA93114 (PubMed:8564208).Curated1
Isoform 6 (identifier: P35348-6)
Sequence conflicti302E → Q in AAR84650 (PubMed:10493934).Curated1
Isoform 4 (identifier: P35348-4)
Sequence conflicti453S → L in AAC06138 (PubMed:9490024).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03575640G → W in a breast cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_049370200I → S.Corresponds to variant rs2229125dbSNPEnsembl.1
Natural variantiVAR_019509347C → R Frequent polymorphism. 9 PublicationsCorresponds to variant rs1048101dbSNPEnsembl.1
Natural variantiVAR_049371414K → R.Corresponds to variant rs3730247dbSNPEnsembl.1
Natural variantiVAR_049372465E → D.Corresponds to variant rs2229126dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_011046295 – 466GSFFP…NGEEV → DEVSLCHQAGVQWHDLGSLQ PPPPGFKRFSCLSLPSSWDY RDVPPGRRHQAQLIFVFLVE TGFHHVGQDDLDLLTS in isoform 8. 1 PublicationAdd BLAST172
Alternative sequenceiVSP_011053295 – 342GSFFP…QNVLR → DEETEAQEGKNDSPSFKQPV HHAAVLGLEVMEKENLEGVS RKDTCGVW in isoform 6. 1 PublicationAdd BLAST48
Alternative sequenceiVSP_011049296 – 466SFFPD…NGEEV → THTHDMKPASRPRLLSLLPK EGEHETHHWSCDPLSLESTP GAQEPCLTLGFTSLSSIHLT KAQIQHVTVTDTGKTVT in isoform 9. 1 PublicationAdd BLAST171
Alternative sequenceiVSP_011047296 – 324SFFPD…CINPI → TYILKYDVLFWRKGLSVCTR LRERKEIKN in isoform 7. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_011051296 – 297SF → KS in isoform 5. 1 Publication2
Alternative sequenceiVSP_011052298 – 466Missing in isoform 5. 1 PublicationAdd BLAST169
Alternative sequenceiVSP_011048325 – 466Missing in isoform 7. 1 PublicationAdd BLAST142
Alternative sequenceiVSP_011054343 – 466Missing in isoform 6. 1 PublicationAdd BLAST124
Alternative sequenceiVSP_011055424 – 466VRSKS…NGEEV → TKSRSVTRLECSGMILAHCN LRLPGSRDSPASASQAAGTT GMCHQADATRPS in isoform 2. 1 PublicationAdd BLAST43
Alternative sequenceiVSP_011050424 – 466VRSKS…NGEEV → RGMDCRYFTKNCREHIKHVN FMMPPWRKGSEC in isoform 4. 1 PublicationAdd BLAST43
Alternative sequenceiVSP_011044424 – 429VRSKSF → GHTPMT in isoform 3. 1 Publication6
Alternative sequenceiVSP_011045430 – 466Missing in isoform 3. 1 PublicationAdd BLAST37

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D25235 mRNA. Translation: BAA04960.1.
U03866 Genomic DNA. Translation: AAB60353.1.
U02569 mRNA. Translation: AAA93114.1.
D32201 mRNA. Translation: BAA06900.1.
D32202 mRNA. Translation: BAA06901.1. Frameshift.
L31774 mRNA. Translation: AAB59486.1.
AF013261 mRNA. Translation: AAC06138.1.
AY491775 mRNA. Translation: AAR84644.1.
AY491776 mRNA. Translation: AAR84645.1.
AY491777 mRNA. Translation: AAR84646.1.
AY491778 mRNA. Translation: AAR84647.1.
AY491779 mRNA. Translation: AAR84648.1.
AY491780 mRNA. Translation: AAR84649.1.
AY491781 mRNA. Translation: AAR84650.1.
AF395806 mRNA. Translation: AAK77197.1.
AB065703 Genomic DNA. Translation: BAC05926.1.
AY389505 Genomic DNA. Translation: AAQ91331.1.
AK289548 mRNA. Translation: BAF82237.1.
EU326301 Genomic DNA. Translation: ACA05899.1.
EU326301 Genomic DNA. Translation: ACA05900.1. Sequence problems.
EU326301 Genomic DNA. Translation: ACA05902.1.
EU326301 Genomic DNA. Translation: ACA05903.1.
EU326301 Genomic DNA. Translation: ACA05904.1.
EU326301 Genomic DNA. Translation: ACA05905.1.
EU326301 Genomic DNA. Translation: ACA05906.1.
EU326301 Genomic DNA. Translation: ACA05907.1.
BC095512 mRNA. Translation: AAH95512.1.
CCDSiCCDS34869.1. [P35348-2]
CCDS6052.1. [P35348-3]
CCDS6053.1. [P35348-4]
CCDS6054.1. [P35348-1]
CCDS83269.1. [P35348-6]
PIRiJN0765.
S65656.
S65657.
RefSeqiNP_000671.2. NM_000680.3. [P35348-1]
NP_001309431.1. NM_001322502.1. [P35348-9]
NP_001309432.1. NM_001322503.1. [P35348-8]
NP_001309433.1. NM_001322504.1. [P35348-6]
NP_150645.2. NM_033302.3. [P35348-3]
NP_150646.3. NM_033303.4. [P35348-2]
NP_150647.2. NM_033304.3. [P35348-4]
XP_006716356.1. XM_006716293.3. [P35348-3]
XP_011542713.1. XM_011544411.2. [P35348-7]
UniGeneiHs.52931.
Hs.709175.

Genome annotation databases

EnsembliENST00000276393; ENSP00000276393; ENSG00000120907. [P35348-1]
ENST00000354550; ENSP00000346557; ENSG00000120907. [P35348-4]
ENST00000380572; ENSP00000369946; ENSG00000120907. [P35348-6]
ENST00000380573; ENSP00000369947; ENSG00000120907. [P35348-1]
ENST00000380582; ENSP00000369956; ENSG00000120907. [P35348-3]
ENST00000380586; ENSP00000369960; ENSG00000120907. [P35348-2]
ENST00000519096; ENSP00000431073; ENSG00000120907. [P35348-7]
ENST00000521711; ENSP00000430414; ENSG00000120907. [P35348-7]
GeneIDi148.
KEGGihsa:148.
UCSCiuc003xfc.1. human. [P35348-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D25235 mRNA. Translation: BAA04960.1.
U03866 Genomic DNA. Translation: AAB60353.1.
U02569 mRNA. Translation: AAA93114.1.
D32201 mRNA. Translation: BAA06900.1.
D32202 mRNA. Translation: BAA06901.1. Frameshift.
L31774 mRNA. Translation: AAB59486.1.
AF013261 mRNA. Translation: AAC06138.1.
AY491775 mRNA. Translation: AAR84644.1.
AY491776 mRNA. Translation: AAR84645.1.
AY491777 mRNA. Translation: AAR84646.1.
AY491778 mRNA. Translation: AAR84647.1.
AY491779 mRNA. Translation: AAR84648.1.
AY491780 mRNA. Translation: AAR84649.1.
AY491781 mRNA. Translation: AAR84650.1.
AF395806 mRNA. Translation: AAK77197.1.
AB065703 Genomic DNA. Translation: BAC05926.1.
AY389505 Genomic DNA. Translation: AAQ91331.1.
AK289548 mRNA. Translation: BAF82237.1.
EU326301 Genomic DNA. Translation: ACA05899.1.
EU326301 Genomic DNA. Translation: ACA05900.1. Sequence problems.
EU326301 Genomic DNA. Translation: ACA05902.1.
EU326301 Genomic DNA. Translation: ACA05903.1.
EU326301 Genomic DNA. Translation: ACA05904.1.
EU326301 Genomic DNA. Translation: ACA05905.1.
EU326301 Genomic DNA. Translation: ACA05906.1.
EU326301 Genomic DNA. Translation: ACA05907.1.
BC095512 mRNA. Translation: AAH95512.1.
CCDSiCCDS34869.1. [P35348-2]
CCDS6052.1. [P35348-3]
CCDS6053.1. [P35348-4]
CCDS6054.1. [P35348-1]
CCDS83269.1. [P35348-6]
PIRiJN0765.
S65656.
S65657.
RefSeqiNP_000671.2. NM_000680.3. [P35348-1]
NP_001309431.1. NM_001322502.1. [P35348-9]
NP_001309432.1. NM_001322503.1. [P35348-8]
NP_001309433.1. NM_001322504.1. [P35348-6]
NP_150645.2. NM_033302.3. [P35348-3]
NP_150646.3. NM_033303.4. [P35348-2]
NP_150647.2. NM_033304.3. [P35348-4]
XP_006716356.1. XM_006716293.3. [P35348-3]
XP_011542713.1. XM_011544411.2. [P35348-7]
UniGeneiHs.52931.
Hs.709175.

3D structure databases

ProteinModelPortaliP35348.
SMRiP35348.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

DIPiDIP-33401N.
IntActiP35348. 3 interactors.
STRINGi9606.ENSP00000369960.

Chemistry databases

BindingDBiP35348.
ChEMBLiCHEMBL229.
DrugBankiDB01614. Acepromazine.
DB00346. Alfuzosin.
DB00321. Amitriptyline.
DB00543. Amoxapine.
DB00182. Amphetamine.
DB00964. Apraclonidine.
DB01238. Aripiprazole.
DB06216. Asenapine.
DB00865. Benzphetamine.
DB01295. Bevantolol.
DB01200. Bromocriptine.
DB00248. Cabergoline.
DB01136. Carvedilol.
DB00477. Chlorpromazine.
DB00215. Citalopram.
DB00575. Clonidine.
DB00363. Clozapine.
DB00298. Dapiprazole.
DB01151. Desipramine.
DB01576. Dextroamphetamine.
DB00449. Dipivefrin.
DB00590. Doxazosin.
DB01142. Doxepin.
DB04855. Dronedarone.
DB00450. Droperidol.
DB06262. Droxidopa.
DB01364. Ephedrine.
DB00751. Epinastine.
DB00668. Epinephrine.
DB01049. Ergoloid mesylate.
DB01253. Ergonovine.
DB00696. Ergotamine.
DB01175. Escitalopram.
DB00800. Fenoldopam.
DB00875. Flupentixol.
DB04946. Iloperidone.
DB00458. Imipramine.
DB06706. Isometheptene.
DB00598. Labetalol.
DB06707. Levonordefrin.
DB00408. Loxapine.
DB00934. Maprotiline.
DB01365. Mephentermine.
DB00610. Metaraminol.
DB01403. Methotrimeprazine.
DB00723. Methoxamine.
DB06148. Mianserin.
DB00211. Midodrine.
DB00370. Mirtazapine.
DB06711. Naphazoline.
DB01149. Nefazodone.
DB00622. Nicardipine.
DB00699. Nicergoline.
DB00368. Norepinephrine.
DB00540. Nortriptyline.
DB00334. Olanzapine.
DB00935. Oxymetazoline.
DB01267. Paliperidone.
DB01186. Pergolide.
DB01579. Phendimetrazine.
DB00925. Phenoxybenzamine.
DB00692. Phentolamine.
DB00388. Phenylephrine.
DB00397. Phenylpropanolamine.
DB00457. Prazosin.
DB00420. Promazine.
DB01069. Promethazine.
DB00777. Propiomazine.
DB00852. Pseudoephedrine.
DB01224. Quetiapine.
DB00734. Risperidone.
DB06144. Sertindole.
DB06207. Silodosin.
DB00706. Tamsulosin.
DB01162. Terazosin.
DB06764. Tetryzoline.
DB01622. Thioproperazine.
DB00679. Thioridazine.
DB00797. Tolazoline.
DB00656. Trazodone.
DB00831. Trifluoperazine.
DB00726. Trimipramine.
DB06694. Xylometazoline.
DB00246. Ziprasidone.
DB01624. Zuclopenthixol.
GuidetoPHARMACOLOGYi22.

Protein family/group databases

GPCRDBiSearch...

PTM databases

iPTMnetiP35348.
PhosphoSitePlusiP35348.

Polymorphism and mutation databases

BioMutaiADRA1A.
DMDMi1168246.

Proteomic databases

PaxDbiP35348.
PeptideAtlasiP35348.
PRIDEiP35348.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000276393; ENSP00000276393; ENSG00000120907. [P35348-1]
ENST00000354550; ENSP00000346557; ENSG00000120907. [P35348-4]
ENST00000380572; ENSP00000369946; ENSG00000120907. [P35348-6]
ENST00000380573; ENSP00000369947; ENSG00000120907. [P35348-1]
ENST00000380582; ENSP00000369956; ENSG00000120907. [P35348-3]
ENST00000380586; ENSP00000369960; ENSG00000120907. [P35348-2]
ENST00000519096; ENSP00000431073; ENSG00000120907. [P35348-7]
ENST00000521711; ENSP00000430414; ENSG00000120907. [P35348-7]
GeneIDi148.
KEGGihsa:148.
UCSCiuc003xfc.1. human. [P35348-1]

Organism-specific databases

CTDi148.
DisGeNETi148.
GeneCardsiADRA1A.
HGNCiHGNC:277. ADRA1A.
HPAiHPA029678.
HPA029679.
MIMi104221. gene.
neXtProtiNX_P35348.
OpenTargetsiENSG00000120907.
PharmGKBiPA34.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3656. Eukaryota.
ENOG410XRW9. LUCA.
GeneTreeiENSGT00760000118795.
HOVERGENiHBG106962.
InParanoidiP35348.
KOiK04135.
OMAiETFYRIS.
PhylomeDBiP35348.
TreeFamiTF331895.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000120907-MONOMER.
ReactomeiR-HSA-390696. Adrenoceptors.
R-HSA-416476. G alpha (q) signalling events.
R-HSA-416482. G alpha (12/13) signalling events.
SignaLinkiP35348.
SIGNORiP35348.

Miscellaneous databases

GeneWikiiAlpha-1A_adrenergic_receptor.
GenomeRNAii148.
PROiP35348.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000120907.
CleanExiHS_ADRA1A.
ExpressionAtlasiP35348. baseline and differential.
GenevisibleiP35348. HS.

Family and domain databases

InterProiIPR002233. ADR_fam.
IPR001004. ADRA1A_rcpt.
IPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
[Graphical view]
PfamiPF00001. 7tm_1. 1 hit.
[Graphical view]
PRINTSiPR01103. ADRENERGICR.
PR00557. ADRENRGCA1AR.
PR00237. GPCRRHODOPSN.
SMARTiSM01381. 7TM_GPCR_Srsx. 1 hit.
[Graphical view]
PROSITEiPS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiADA1A_HUMAN
AccessioniPrimary (citable) accession number: P35348
Secondary accession number(s): A8K0I3
, B0ZBD1, B0ZBD2, B0ZBD4, B0ZBD5, B0ZBD6, B0ZBD8, B0ZBD9, O60451, Q13675, Q13729, Q4VBM7, Q6RUJ4, Q6RUJ5, Q6RUJ7, Q6RUJ8, Q6RUJ9, Q96RE8, Q9UD63, Q9UD67
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 1, 1994
Last sequence update: November 1, 1995
Last modified: November 2, 2016
This is version 172 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.