Reviewed,
UniProtKB/Swiss-Prot P35348 (ADA1A_HUMAN)
Last modified
June 16, 2009.
Version 94.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Alpha-1A adrenergic receptor Alternative name(s): Alpha 1A-adrenoreceptor Alpha 1A-adrenoceptor Alpha-1C adrenergic receptor Alpha-adrenergic receptor 1c | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 466 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | This alpha-adrenergic receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Its effect is mediated by G(q) and G(11) proteins. |
| Subcellular location | |
| Tissue specificity | Heart, brain, liver and prostate, but not in kidney, lung, adrenal, aorta and pituitary. Isoform 4 is the most abundant isoform expressed in the prostate with high levels also detected in liver and heart. Ref.6 Ref.7 |
| Post-translational modification | Carboxyl-terminal Ser or Thr residues may be phosphorylated By similarity. |
| Sequence similarities | Belongs to the G-protein coupled receptor 1 family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transmembrane |
| Molecular function | G-protein coupled receptor Receptor Transducer |
| PTM | Disulfide bond Glycoprotein Lipoprotein Palmitate Phosphoprotein |
| Gene Ontology (GO) | |
| Biological process | G-protein coupled receptor protein signaling pathway Traceable author statement. Source: ProtInc apoptosisTraceable author statement. Source: ProtInc cell-cell signaling Ref.1Traceable author statement. Source: ProtInc negative regulation of cell proliferationTraceable author statement. Source: ProtInc protein kinase cascadeTraceable author statement. Source: ProtInc smooth muscle contraction Ref.3Traceable author statement. Source: ProtInc |
| Cellular component | integral to plasma membrane Ref.1 Traceable author statement. Source: ProtInc |
| Molecular function | alpha1-adrenergic receptor activity Ref.6 Ref.7 Traceable author statement. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 9 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P35348-1) Also known as: Alpha 1c-1; Alpha(1A-1); This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P35348-2) Also known as: Alpha 1c-2; Alpha(1A-2); The sequence of this isoform differs from the canonical sequence as follows: 424-466: VRSKSFLQVC...ISLSENGEEV → TKSRSVTRLE...GQDDLDLLTS | ||||||
| Isoform 3 (identifier: P35348-3) Also known as: Alpha 1c-3; Alpha(1A-3); The sequence of this isoform differs from the canonical sequence as follows: 424-429: VRSKSF → GHTPMT 430-466: Missing. | ||||||
| Isoform 4 (identifier: P35348-4) Also known as: Alpha(1A-4); The sequence of this isoform differs from the canonical sequence as follows: 424-466: VRSKSFLQVCCCVGPSTPSLDKNHQVPTIKVHTISLSENGEEV → RGMDCRYFTKNCREHIKHVNFMMPPWRKGLEC | ||||||
| Isoform 5 (identifier: P35348-5) The sequence of this isoform differs from the canonical sequence as follows: 296-297: SF → KS 298-466: Missing. | ||||||
| Isoform 6 (identifier: P35348-6) The sequence of this isoform differs from the canonical sequence as follows: 295-342: GSFFPDFKPS...FKKAFQNVLR → DEETEAQQGK...VSRKDTCGVW 343-466: Missing. | ||||||
| Isoform 2b/3b (identifier: P35348-7) The sequence of this isoform differs from the canonical sequence as follows: 296-324: SFFPDFKPSETVFKIVFWLGYLNSCINPI → TYILKYDVLFWRKGLSVCTRLRERKEIKN 325-466: Missing. | ||||||
| Isoform 2c (identifier: P35348-8) The sequence of this isoform differs from the canonical sequence as follows: 295-466: GSFFPDFKPS...ISLSENGEEV → DEVSLCHQAG...GQDDLDLLTS | ||||||
| Isoform 3c (identifier: P35348-9) The sequence of this isoform differs from the canonical sequence as follows: 296-466: SFFPDFKPSE...ISLSENGEEV → THTHDMKPAS...TVTDTGKTVT |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 466 | 466 | Alpha-1A adrenergic receptor | PRO_0000069063 | |||||||
Regions | |||||||||||
| Topological domain | 1 – 27 | 27 | Extracellular By similarity | ||||||||
| Transmembrane | 28 – 51 | 24 | 1 By similarity | ||||||||
| Topological domain | 52 – 64 | 13 | Cytoplasmic By similarity | ||||||||
| Transmembrane | 65 – 88 | 24 | 2 By similarity | ||||||||
| Topological domain | 89 – 99 | 11 | Extracellular By similarity | ||||||||
| Transmembrane | 100 – 122 | 23 | 3 By similarity | ||||||||
| Topological domain | 123 – 143 | 21 | Cytoplasmic By similarity | ||||||||
| Transmembrane | 144 – 167 | 24 | 4 By similarity | ||||||||
| Topological domain | 168 – 181 | 14 | Extracellular By similarity | ||||||||
| Transmembrane | 182 – 205 | 24 | 5 By similarity | ||||||||
| Topological domain | 206 – 273 | 68 | Cytoplasmic By similarity | ||||||||
| Transmembrane | 274 – 297 | 24 | 6 By similarity | ||||||||
| Topological domain | 298 – 305 | 8 | Extracellular By similarity | ||||||||
| Transmembrane | 306 – 329 | 24 | 7 By similarity | ||||||||
| Topological domain | 330 – 466 | 137 | Cytoplasmic By similarity | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 215 | 1 | Phosphoserine; by PKA Potential | ||||||||
| Lipidation | 345 | 1 | S-palmitoyl cysteine Potential | ||||||||
| Glycosylation | 7 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 13 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 22 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 99 ↔ 176 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 295 – 466 | 172 | GSFFP…NGEEV → DEVSLCHQAGVQWHDLGSLQ PPPPGFKRFSCLSLPSSWDY RDVPPGRRHQAQLIFVFLVE TGFHHVGQDDLDLLTS in isoform 2c. | VSP_011046 | |||||||
| Alternative sequence | 295 – 342 | 48 | GSFFP…QNVLR → DEETEAQQGKNDSPSFKQPV HHAAVLGLEVMEKENLEGVS RKDTCGVW in isoform 6. | VSP_011053 | |||||||
| Alternative sequence | 296 – 466 | 171 | SFFPD…NGEEV → THTHDMKPASRPRLLSLLPK EGEHETHHWSCDPLSLESTP GAQEPCLTLGFTSLSSIHLT KAQIQHVTVTDTGKTVT in isoform 3c. | VSP_011049 | |||||||
| Alternative sequence | 296 – 324 | 29 | SFFPD…CINPI → TYILKYDVLFWRKGLSVCTR LRERKEIKN in isoform 2b/3b. | VSP_011047 | |||||||
| Alternative sequence | 296 – 297 | 2 | SF → KS in isoform 5. | VSP_011051 | |||||||
| Alternative sequence | 298 – 466 | 169 | Missing in isoform 5. | VSP_011052 | |||||||
| Alternative sequence | 325 – 466 | 142 | Missing in isoform 2b/3b. | VSP_011048 | |||||||
| Alternative sequence | 343 – 466 | 124 | Missing in isoform 6. | VSP_011054 | |||||||
| Alternative sequence | 424 – 466 | 43 | VRSKS…NGEEV → TKSRSVTRLECSGMILAHCN LRLPGSRDSPASASQAAGTT GDVPPGRRHQAQLIFVFLVE TGFHHVGQDDLDLLTS in isoform 2. | VSP_011055 | |||||||
| Alternative sequence | 424 – 466 | 43 | VRSKS…NGEEV → RGMDCRYFTKNCREHIKHVN FMMPPWRKGLEC in isoform 4. | VSP_011050 | |||||||
| Alternative sequence | 424 – 429 | 6 | VRSKSF → GHTPMT in isoform 3. | VSP_011044 | |||||||
| Alternative sequence | 430 – 466 | 37 | Missing in isoform 3. | VSP_011045 | |||||||
| Natural variant | 40 | 1 | G → W in a breast cancer sample; somatic mutation. Ref.14 | VAR_035756 | |||||||
| Natural variant | 200 | 1 | I → S: dbSNP rs2229125. | VAR_049370 | |||||||
| Natural variant | 347 | 1 | C → R Frequent polymorphism. dbSNP rs1048101. Ref.6 Ref.1 Ref.2 Ref.4 Ref.5 Ref.12 Ref.13 | VAR_019509 | |||||||
| Natural variant | 414 | 1 | K → R: dbSNP rs3730247. | VAR_049371 | |||||||
| Natural variant | 465 | 1 | E → D: dbSNP rs2229126. | VAR_049372 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 43 | 1 | G → C in AAA93114. Ref.4 | ||||||||
| Sequence conflict | 129 | 1 | S → T in AAA93114. Ref.4 | ||||||||
| Sequence conflict | 338 | 1 | Q → C Ref.2 | ||||||||
| Sequence conflict | 359 | 1 | T → P in AAA93114. Ref.4 | ||||||||
| Sequence conflict | 431 | 1 | Q → E in BAA04960. Ref.1 | ||||||||
| Sequence conflict | 442 | 1 | S → C in AAA93114. Ref.4 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning, functional expression and tissue distribution of human cDNA for the alpha 1C-adrenergic receptor." Hirasawa A., Horie K., Tanaka T., Takagaki K., Murai M., Yano J., Tsujimoto G. Biochem. Biophys. Res. Commun. 195:902-909(1993) [PubMed: 8396931] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1), VARIANT ARG-347. Tissue: Prostate. |
| [2] | "Cloning, expression and characterization of human alpha adrenergic receptors alpha 1a, alpha 1b and alpha 1c." Weinberg D.H., Trivedi P., Tan C.P., Mitra S., Perkins-Barrow A., Borkowski D., Strader C.D., Bayne M. Biochem. Biophys. Res. Commun. 201:1296-1304(1994) [PubMed: 8024574] [Abstract] Cited for: NUCLEOTIDE SEQUENCE (ISOFORM 1), VARIANT ARG-347. Tissue: Heart. |
| [3] | "The alpha 1-adrenergic receptor that mediates smooth muscle contraction in human prostate has the pharmacological properties of the cloned human alpha 1c subtype." Forray C., Bard J.A., Wetzel J.M., Chiu G., Shapiro E., Tang R., Lepor H., Hartig P.R., Weinshank R.L., Branchek T.A., Gluchowski C. Mol. Pharmacol. 45:703-708(1994) [PubMed: 8183249] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1). Tissue: Hippocampus and Lymphocyte. |
| [4] | "The alpha 1C-adrenoceptor in human prostate: cloning, functional expression, and localization to specific prostatic cell types." Tseng-Crank J., Kost T., Goetz A., Hazum S., Roberson K.M., Haizlip J., Godinot N., Robertson C.N., Saussy D. Br. J. Pharmacol. 115:1475-1485(1995) [PubMed: 8564208] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ARG-347. |
| [5] | "Cloning and pharmacological characterization of human alpha-1 adrenergic receptors: sequence corrections and direct comparison with other species homologues." Schwinn D.A., Johnston G.I., Page S.O., Mosley M.J., Wilson K.H., Worman N.P., Campbell S., Fidock M.D., Furness L.M., Parry-Smith D.J., Peter B., Bailey D.S. J. Pharmacol. Exp. Ther. 272:134-142(1995) [PubMed: 7815325] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ARG-347. |
| [6] | "Cloning, functional expression and tissue distribution of human alpha 1c-adrenoceptor splice variants." Hirasawa A., Shibata K., Horie K., Takei Y., Obika K., Tanaka T., Muramoto N., Takagaki K., Yano J., Tsujimoto G. FEBS Lett. 363:256-260(1995) [PubMed: 7737411] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), VARIANT ARG-347, TISSUE SPECIFICITY. Tissue: Prostate. |
| [7] | "Molecular cloning, genomic characterization and expression of novel human alpha1A-adrenoceptor isoforms." Chang D.J., Chang T.K., Yamanishi S.S., Salazar F.H.R., Kosaka A.H., Khare R., Bhakta S., Jasper J.R., Shieh I.-S., Lesnick J.D., Ford A.P.D.W., Daniels D.V., Clarke D.E., Bach C.T., Chan H.W. FEBS Lett. 422:279-283(1998) [PubMed: 9490024] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), TISSUE SPECIFICITY. Tissue: Prostate. |
| [8] | "Truncated isoforms inhibit [3H]prazosin binding and cellular trafficking of native human alpha1A-adrenoceptors." Coge F., Guenin S.P., Renouard-Try A., Rique H., Ouvry C., Fabry N., Beauverger P., Nicolas J.P., Galizzi J.-P., Boutin J.A., Canet E. Biochem. J. 343:231-239(1999) [PubMed: 10493934] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2B/3B; 2C; 3C; 5 AND 6). Tissue: Liver. |
| [9] | "Genome-wide discovery and analysis of human seven transmembrane helix receptor genes." Suwa M., Sato T., Okouchi I., Arita M., Futami K., Matsumoto S., Tsutsumi S., Aburatani H., Asai K., Akiyama Y. Submitted (JUL-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [10] | "cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org)." Kopatz S.A., Aronstam R.S., Sharma S.V. Submitted (SEP-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [11] | NHLBI resequencing and genotyping service (RS&G) Submitted (DEC-2007) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [12] | "Alpha 1a-adrenoceptor polymorphism: pharmacological characterization and association with benign prostatic hypertrophy." Shibata K., Hirasawa A., Moriyama N., Kawabe K., Ogawa S., Tsujimoto G. Br. J. Pharmacol. 118:1403-1408(1996) [PubMed: 8832064] [Abstract] Cited for: VARIANT ARG-347. |
| [13] | "Alpha 1A-adrenergic receptor polymorphism and vascular response." Sofowora G.G., Dishy V., Landau R., Xie H.G., Prasad H.C., Byrne D.W., Smiley R.M., Kim R.B., Wood A.J., Stein C.M. Clin. Pharmacol. Ther. 75:539-545(2004) [PubMed: 15179408] [Abstract] Cited for: VARIANT ARG-347. |
| [14] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed: 16959974] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] TRP-40. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| D25235 mRNA. Translation: BAA04960.1. U03866 Genomic DNA. Translation: AAB60353.1. U02569 mRNA. Translation: AAA93114.1. L31774 mRNA. Translation: AAB59486.1. D32201 mRNA. Translation: BAA06900.1. D32202 mRNA. Translation: BAA06901.1. AF013261 mRNA. Translation: AAC06138.1. AY491775 mRNA. Translation: AAR84644.1. AY491776 mRNA. Translation: AAR84645.1. AY491777 mRNA. Translation: AAR84646.1. AY491778 mRNA. Translation: AAR84647.1. AY491779 mRNA. Translation: AAR84648.1. AY491780 mRNA. Translation: AAR84649.1. AY491781 mRNA. Translation: AAR84650.1. AB065703 Genomic DNA. Translation: BAC05926.1. AY389505 Genomic DNA. Translation: AAQ91331.1. EU326301 Genomic DNA. Translation: ACA05904.1. EU326301 Genomic DNA. Translation: ACA05905.1. EU326301 Genomic DNA. Translation: ACA05906.1. EU326301 Genomic DNA. Translation: ACA05907.1. | |
| IPI | IPI00430195. IPI00430196. IPI00430197. IPI00430199. IPI00430201. IPI00430202. IPI00430203. IPI00430204. IPI00430205. |
| PIR | JN0765. S65656. S65657. |
| RefSeq | NP_000671.2. NP_150645.2. NP_150646.3. NP_150647.2. |
| UniGene | Hs.709175 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P35348. 3 interactions. |
Protein family/group databases | |
| GPCRDB | Search... |
PTM databases | |
| PhosphoSite | P35348. |
Proteomic databases | |
| PRIDE | P35348. |
Genome annotation databases | |
| Ensembl | ENSG00000120907. Homo sapiens. [Contig view] |
| GeneID | 148. |
| KEGG | hsa:148. |
Organism-specific databases | |
| GeneCards | GC08M026661. |
| H-InvDB | HIX0034243. |
| HGNC | HGNC:277. ADRA1A. |
| MIM | 104221. gene. |
| PharmGKB | PA34. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | P35348. |
| OMA | P35348. IFEILGY. |
Gene expression databases | |
| ArrayExpress | P35348. |
| Bgee | P35348. |
| CleanEx | HS_ADRA1A. |
| GermOnline | ENSG00000120907. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR000276. 7TM_GPCR_Rhodpsn. IPR001004. Adrene_rcpt_A1Cs. IPR002233. Adrnrgc_rcpt. IPR017452. GPCR_Rhodpsn_supfam. [Graphical view] |
| PANTHER | PTHR19266:SF89. Adrene_rcpt_A1Cs. 1 hit. |
| Pfam | PF00001. 7tm_1. 1 hit. [Graphical view] |
| PRINTS | PR01103. ADRENERGICR. PR00557. ADRENRGCA1AR. PR00237. GPCRRHODOPSN. |
| PROSITE | PS00237. G_PROTEIN_RECEP_F1_1. 1 hit. PS50262. G_PROTEIN_RECEP_F1_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| DrugBank | DB00346. Alfuzosin. DB01118. Amiodarone. DB00182. Amphetamine. DB00865. Benzphetamine. DB00217. Bethanidine. DB01136. Carvedilol. DB00298. Dapiprazole. DB04840. Debrisoquin. DB01576. Dextroamphetamine. DB00590. Doxazosin. DB00751. Epinastine. DB00668. Epinephrine. DB00696. Ergotamine. DB00875. Flupenthixol. DB00226. Guanadrel Sulfate. DB01170. Guanethidine. DB00598. Labetalol. DB01255. Lisdexamfetamine. DB00934. Maprotiline. DB01365. Mephentermine. DB00610. Metaraminol. DB01577. Methamphetamine. DB01403. Methotrimeprazine. DB00723. Methoxamine. DB00211. Midodrine. DB01149. Nefazodone. DB00699. Nicergoline. DB00665. Nilutamide. DB00368. Norepinephrine. DB00506. Norgestrel. DB00935. Oxymetazoline. DB00850. Perphenazine. DB01579. Phendimetrazine. DB00925. Phenoxybenzamine. DB00388. Phenylephrine. DB00397. Phenylpropanolamine. DB00457. Prazosin. DB00420. Promazine. DB01069. Promethazine. DB01608. Propericiazine. DB00777. Propiomazine. DB00852. Pseudoephedrine. DB00734. Risperidone. DB06144. Sertindole. DB00706. Tamsulosin. DB01162. Terazosin. DB00679. Thioridazine. DB00797. Tolazoline. DB00656. Trazodone. DB00831. Trifluoperazine. DB00246. Ziprasidone. |
| NextBio | 585. |
| SOURCE | Search... |
Entry information
| Entry name | ADA1A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P35348 Secondary accession number(s): B0ZBD1 Q9UD63 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| 7-transmembrane G-linked receptors List of 7-transmembrane G-linked receptor entries |
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


