Reviewed,
UniProtKB/Swiss-Prot P35316 (ATC_ARTSF)
Last modified
February 9, 2010.
Version 73.
History...
Clusters with 100%,
90%,
50% identity |
Documents (1) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin · Protein attributes · General annotation (Comments) · Ontologies · Alternative products · Sequence annotation (Features) · Sequences · References · Cross-references · Entry information · Relevant documents
Names and origin
| Protein names | Recommended name: Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type EC=3.6.3.8 Alternative name(s): Calcium pump |
| Organism | Artemia sanfranciscana (Brine shrimp) (Artemia franciscana) |
| Taxonomic identifier | 6661 [NCBI] |
| Taxonomic lineage | Eukaryota › Metazoa › Arthropoda › Crustacea › Branchiopoda › Anostraca › Artemiidae › Artemia |
Protein attributes
| Sequence length | 1003 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of the calcium. |
| Catalytic activity | ATP + H2O + Ca2+(Cis) = ADP + phosphate + Ca2+(Trans). |
| Subcellular location | Sarcoplasmic reticulum membrane; Multi-pass membrane protein. |
| Developmental stage | Isoform 2 (long form) is expressed only in early stages of embryonic development (cysts), while isoform 1 (short form) is also found in later embryonic stages and adults. |
| Sequence similarities | Belongs to the cation transport ATPase (P-type) family. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P35316-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P35316-2) The sequence of this isoform differs from the canonical sequence as follows: 998-1003: EFSFIK → GMPLSSYFVDAWGLVLAWALFFGVIFYSPL | ||||||
| Note: Presents an extension, a potential transmembrane domain, which may have an important functional role. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1003 | 1003 | Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type | PRO_0000046226 | |||||
Regions | |||||||||
| Topological domain | 1 – 59 | 59 | Cytoplasmic Potential | ||||||
| Transmembrane | 60 – 78 | 19 | Potential | ||||||
| Topological domain | 79 – 89 | 11 | Extracellular Potential | ||||||
| Transmembrane | 90 – 110 | 21 | Potential | ||||||
| Topological domain | 111 – 262 | 152 | Cytoplasmic Potential | ||||||
| Transmembrane | 263 – 282 | 20 | Potential | ||||||
| Topological domain | 283 – 300 | 18 | Extracellular Potential | ||||||
| Transmembrane | 301 – 318 | 18 | Potential | ||||||
| Topological domain | 319 – 775 | 457 | Cytoplasmic Potential | ||||||
| Transmembrane | 776 – 799 | 24 | Potential | ||||||
| Topological domain | 800 – 840 | 41 | Extracellular Potential | ||||||
| Transmembrane | 841 – 863 | 23 | Potential | ||||||
| Topological domain | 864 – 898 | 35 | Cytoplasmic Potential | ||||||
| Transmembrane | 899 – 917 | 19 | Potential | ||||||
| Topological domain | 918 – 934 | 17 | Extracellular Potential | ||||||
| Transmembrane | 935 – 954 | 20 | Potential | ||||||
| Topological domain | 955 – 1003 | 49 | Cytoplasmic Potential | ||||||
Sites | |||||||||
| Active site | 354 | 1 | 4-aspartylphosphate intermediate By similarity | ||||||
| Binding site | 519 | 1 | ATP By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 998 – 1003 | 6 | EFSFIK → GMPLSSYFVDAWGLVLAWAL FFGVIFYSPL in isoform 2. | VSP_000412 | |||||
Experimental info | |||||||||
| Sequence conflict | 481 | 1 | T → A in CAA51262. Ref.2 | ||||||
| Sequence conflict | 793 | 1 | P → Q in CAA51262. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "Complementary DNA cloning of a protein highly homologous to mammalian sarcoplasmic reticulum Ca-ATPase from the crustacean Artemia." Palmero I., Sastre L. J. Mol. Biol. 210:737-748(1989) [PubMed: 2533270] [Abstract] Cited for: NUCLEOTIDE SEQUENCE. |
| [2] | "Similar alternative splicing events generate two sarcoplasmic or endoplasmic reticulum Ca-ATPase isoforms in the crustacean Artemia franciscana and in vertebrates." Escalante R., Sastre L. J. Biol. Chem. 268:14090-14095(1993) [PubMed: 8314776] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 354-1003. Tissue: Embryo. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X51674 mRNA. Translation: CAA35980.1. X72713 Genomic DNA. Translation: CAA51262.1. |
| PIR | S07526. S32230. |
3D structure databases | |
| ModBase | Search... |
Family and domain databases | |
| InterPro | IPR008250. ATPase_P-typ_ATPase-assoc-dom. IPR005782. ATPase_P-typ_Ca-transp. IPR006068. ATPase_P-typ_cation-transptr_C. IPR004014. ATPase_P-typ_cation-transptr_N. IPR001757. ATPase_P-typ_ion-transptr. IPR018303. ATPase_P-typ_P_site. IPR005834. Dehalogen-like_hydro. [Graphical view] |
| PANTHER | PTHR11939. ATPase_P. 1 hit. |
| Pfam | PF00689. Cation_ATPase_C. 1 hit. PF00690. Cation_ATPase_N. 1 hit. PF00122. E1-E2_ATPase. 1 hit. PF00702. Hydrolase. 1 hit. [Graphical view] |
| PRINTS | PR00119. CATATPASE. |
| SMART | SM00831. Cation_ATPase_N. 1 hit. [Graphical view] |
| TIGRFAMs | TIGR01116. ATPase-IIA1_Ca. 1 hit. TIGR01494. ATPase_P-type. 4 hits. |
| PROSITE | PS00154. ATPASE_E1_E2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Entry information
| Entry name | ATC_ARTSF | ||||||||
| Accession | Primary (citable) accession number: P35316 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||

Clusters with


