Reviewed,
UniProtKB/Swiss-Prot P35240 (MERL_HUMAN)
Last modified
June 16, 2009.
Version 117.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Merlin Alternative name(s): Moesin-ezrin-radixin-like protein Neurofibromin-2 Schwannomin Schwannomerlin | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 595 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Probably acts as a membrane stabilizing protein. May inhibit PI3 kinase by binding to AGAP2 and impairing its stimulating activity. |
| Subunit structure | Interacts with SLC9A3R1, HGS and AGAP2. Interacts with LAYN By similarity. Interacts with SGSM3. |
| Subcellular location | Isoform 1: Cell projection › filopodium membrane; Peripheral membrane protein; Cytoplasmic side. Cell projection › ruffle membrane; Peripheral membrane protein; Cytoplasmic side. Note: In a fibroblastic cell line, isoform 1 is found homogeneously distributed over the entire cell, with a particularly strong staining in ruffling membranes and filopodia. Ref.4 Isoform 7: Cytoplasm › perinuclear region. Cytoplasmic granule. Note: Observed in cytoplasmic granules concentrated in a perinuclear location. Isoform 7 is absent from ruffling membranes and filopodia. Ref.4 Isoform 9: Cytoplasm › perinuclear region. Cytoplasmic granule. Note: Observed in cytoplasmic granules concentrated in a perinuclear location. Isoform 9 is absent from ruffling membranes and filopodia. Ref.4 Isoform 10: Nucleus. Cell projection › filopodium membrane; Peripheral membrane protein; Cytoplasmic side. Cell projection › ruffle membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm › perinuclear region. Cytoplasmic granule. Cytoplasm › cytoskeleton. Note: In a fibroblastic cell line, isoform 10 is found homogeneously distributed over the entire cell, with a particularly strong staining in ruffling membranes and filopodia. Ref.4 |
| Tissue specificity | Widely expressed. Isoforms 1 and 3 are predominant, isoforms 4, 5 and 6 are expressed moderately, isoform 8 is found at low frequency. Isoforms 7, 9 and 10 are not expressed in adult tissues, with the exception of adult retina expressing isoform 10. Isoform 9 is faintly expressed in fetal brain, heart, lung, skeletal muscle and spleen. Fetal thymus expresses isoforms 1, 7, 9 and 10 at similar levels. |
| Involvement in disease | Defects in NF2 are the cause of neurofibromatosis 2 (NF2) [MIM:101000]; also known as central neurofibromatosis. NF2 is a genetic disorder characterized by bilateral vestibular schwannomas (formerly called acoustic neuromas), schwannomas of other cranial and peripheral nerves, meningiomas, and ependymomas. It is inherited in an autosomal dominant fashion with full penetrance. Affected individuals generally develop symptoms of eighth-nerve dysfunction in early adulthood, including deafness and balance disorder. Although the tumors of NF2 are histologically benign, their anatomic location makes management difficult, and patients suffer great morbidity and mortality. Ref.16 Ref.17 Ref.20 Ref.23 Ref.24 Ref.25 Ref.27 Ref.28 Ref.30 Ref.31 Ref.32 Defects in NF2 are a cause of schwannomatosis [MIM:162091]; also called congenital cutaneous neurilemmomatosis. Schwannomas are benign tumors of the peripheral nerve sheath that usually occur singly in otherwise normal individuals. Multiple schwannomas in the same individual suggest an underlying tumor-predisposition syndrome. The most common such syndrome is NF2. The hallmark of NF2 is the development of bilateral vestibular-nerve schwannomas; but two-thirds or more of all NF2-affected individuals develop schwannomas in other locations, and dermal schwannomas may precede vestibular tumors in NF2-affected children. There have been several reports of individuals with multiple schwannomas who do not show evidence of vestibular schwannoma. Clinical report suggests that schwannomatosis is a clinical entity distinct from other forms of neurofibromatosis. Ref.34 |
| Sequence similarities | Contains 1 FERM domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| GTPBP4 | Q9BZE4 | 4 | EBI-1014472,EBI-1056249 | |
| MED28 | Q9H204 | 2 | EBI-1014472,EBI-514199 | |
| MED28 | Q9H204 | 1 | EBI-1014509,EBI-514199 | |
| MED28 | Q9H204 | 1 | EBI-1014505,EBI-514199 | |
| MED28 | Q9H204 | 2 | EBI-1014500,EBI-514199 | |
| Ppp1r12a | Q10728 | 2 | EBI-1014472,EBI-918263 | From a different organism. |
| SCHIP1 | Q9P0W5 | 1 | EBI-1014472,EBI-1397509 | |
| SCHIP1 | Q9P0W5-1 | 1 | EBI-1014514,EBI-1397518 | |
| SCHIP1 | Q9P0W5-1 | 1 | EBI-1014472,EBI-1397518 | |
| Schip1 | Q3TI53 | 1 | EBI-1014472,EBI-1397475 | From a different organism. |
Alternative products
| This entry describes 10 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P35240-1) Also known as: I; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: In a fibroblastic cell line, isoform 1 is found homogeneously distributed over the entire cell, with a particularly strong staining in ruffling membranes and filopodia. Ref.4 | ||||||
| Isoform 2 (identifier: P35240-2) The sequence of this isoform differs from the canonical sequence as follows: 580-595: LTLQSAKSRVAFFEEL → SSPRQKTYLHLSPQSRLFPGTLYVVMLYVVMVLPSVILTRA | ||||||
| Isoform 3 (identifier: P35240-3) Also known as: II; The sequence of this isoform differs from the canonical sequence as follows: 580-590: LTLQSAKSRVA → PQAQGRRPICI 591-595: Missing. | ||||||
| Isoform 4 (identifier: P35240-4) Also known as: delE2/3; The sequence of this isoform differs from the canonical sequence as follows: 39-121: Missing. 580-590: LTLQSAKSRVA → PQAQGRRPICI 591-595: Missing. | ||||||
| Isoform 5 (identifier: P35240-5) Also known as: delE3; The sequence of this isoform differs from the canonical sequence as follows: 81-121: Missing. 580-590: LTLQSAKSRVA → PQAQGRRPICI 591-595: Missing. | ||||||
| Isoform 6 (identifier: P35240-6) Also known as: delE2; The sequence of this isoform differs from the canonical sequence as follows: 39-80: Missing. 580-590: LTLQSAKSRVA → PQAQGRRPICI 591-595: Missing. | ||||||
| Isoform 7 (identifier: P35240-7) Also known as: MER150; The sequence of this isoform differs from the canonical sequence as follows: 259-259: N → R 260-595: Missing. | ||||||
| Note: Observed in cytoplasmic granules concentrated in a perinuclear location. Isoform 7 is absent from ruffling membranes and filopodia. Ref.4 | ||||||
| Isoform 8 (identifier: P35240-8) The sequence of this isoform differs from the canonical sequence as follows: 335-363: Missing. 580-590: LTLQSAKSRVA → PQAQGRRPICI 591-595: Missing. | ||||||
| Isoform 9 (identifier: P35240-9) Also known as: MER162; The sequence of this isoform differs from the canonical sequence as follows: 150-579: Missing. | ||||||
| Note: Observed in cytoplasmic granules concentrated in a perinuclear location. Isoform 9 is absent from ruffling membranes and filopodia. Ref.4 | ||||||
| Isoform 10 (identifier: P35240-10) Also known as: MER151; The sequence of this isoform differs from the canonical sequence as follows: 39-121: Missing. 150-225: Missing. 334-379: MERQRLAREK...ANEALMRSEE → GQRGRSAEAG...HEPNSSTVAS 380-595: Missing. | ||||||
| Note: In a fibroblastic cell line, isoform 10 is found homogeneously distributed over the entire cell, with a particularly strong staining in ruffling membranes and filopodia. Ref.4 |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 595 | 595 | Merlin | PRO_0000219412 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 22 – 311 | 290 | FERM | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Compositional bias | 327 – 465 | 139 | Glu-rich | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 518 | 1 | Phosphoserine Ref.13 Ref.14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 39 – 121 | 83 | Missing in isoform 4 and isoform 10. | VSP_007041 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 39 – 80 | 42 | Missing in isoform 6. | VSP_007040 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 81 – 121 | 41 | Missing in isoform 5. | VSP_007042 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 150 – 579 | 430 | Missing in isoform 9. | VSP_007044 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 150 – 225 | 76 | Missing in isoform 10. | VSP_007043 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 259 | 1 | N → R in isoform 7. | VSP_007045 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 260 – 595 | 336 | Missing in isoform 7. | VSP_007046 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 334 – 379 | 46 | MERQR…MRSEE → GQRGRSAEAGPAGSTRGGAK SQAEAPGDCHQAHVPAHEPN SSTVAS in isoform 10. | VSP_007047 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 335 – 363 | 29 | Missing in isoform 8. | VSP_007048 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 380 – 595 | 216 | Missing in isoform 10. | VSP_007049 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 580 – 595 | 16 | LTLQS…FFEEL → SSPRQKTYLHLSPQSRLFPG TLYVVMLYVVMVLPSVILTR A in isoform 2. | VSP_000492 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 580 – 590 | 11 | LTLQSAKSRVA → PQAQGRRPICI in isoform 3, isoform 4, isoform 5, isoform 6 and isoform 8. | VSP_007050 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 591 – 595 | 5 | Missing in isoform 3, isoform 4, isoform 5, isoform 6 and isoform 8. | VSP_007051 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 46 | 1 | L → R in vestibular schwannoma. Ref.18 | VAR_000809 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 62 | 1 | F → S in NF2. Ref.20 Ref.28 Ref.31 | VAR_000810 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 77 | 1 | M → V in NF2. Ref.28 | VAR_043011 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 79 | 1 | K → E in vestibular schwannoma. Ref.21 | VAR_000811 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 96 | 1 | Missing in NF2 and in sporadic meningioma. | VAR_000812 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 106 | 1 | E → G in NF2. Ref.20 Ref.28 | VAR_000813 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 117 | 1 | L → I in sporadic meningioma. | VAR_000814 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 119 | 1 | Missing in sporadic meningioma. | VAR_000815 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 122 – 129 | 8 | Missing in sporadic meningioma. | VAR_000816 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 141 | 1 | L → P in NF2. Ref.32 | VAR_043012 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 197 | 1 | G → C in NF2. Ref.27 | VAR_043013 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 219 | 1 | V → M in vestibular schwannoma. Ref.19 | VAR_000817 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 220 | 1 | N → Y in NF2. Ref.16 | VAR_000818 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 234 | 1 | L → R in NF2 and in retinal hamartoma; severe. | VAR_009123 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 273 | 1 | I → F in breast ductal carcinoma. Ref.22 | VAR_000819 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 339 | 1 | L → F in sporadic meningioma. | VAR_000820 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 344 | 1 | Q → H: dbSNP rs2229064. | VAR_048358 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 351 | 1 | R → H Ref.21 | VAR_029041 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 352 | 1 | T → M in NF2. Ref.20 Ref.28 | VAR_000821 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 360 | 1 | L → P in NF2. | VAR_000822 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 364 | 1 | K → I in melanoma. Ref.22 | VAR_000823 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 413 | 1 | K → E in NF2. Ref.23 Ref.28 | VAR_043014 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 418 | 1 | R → C in vestibular schwannoma. Ref.19 | VAR_000824 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 463 | 1 | E → K in a breast cancer sample; somatic mutation. Ref.33 | VAR_035848 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 533 | 1 | K → T in NF2. Ref.31 | VAR_043015 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 535 | 1 | L → P in NF2; late onset. Ref.23 Ref.24 Ref.28 | VAR_000825 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 538 | 1 | Q → P in NF2; mild. Ref.25 | VAR_000826 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 539 | 1 | L → H in NF2. Ref.27 | VAR_043016 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 579 | 1 | K → M in NF2. Ref.31 | VAR_043017 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 64 | 1 | L → P: Abolishes binding to AGAP2. Ref.12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 77 | 1 | M → I in AAH20257. Ref.7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 581 | 1 | T → P in AAK54160. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 581 | 1 | T → P in AAK54162. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 21 – 27 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 32 – 38 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 43 – 54 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 59 – 61 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 62 – 68 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 71 – 74 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 81 – 83 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 89 – 100 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 105 – 108 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 112 – 127 | 16 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 135 – 150 | 16 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 155 – 157 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 160 – 165 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 171 – 174 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 181 – 193 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 194 – 197 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 200 – 211 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 215 – 218 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 220 – 226 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 231 – 236 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 238 – 244 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 249 – 251 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 253 – 257 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 258 – 260 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 261 – 267 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 270 – 277 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 283 – 286 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 290 – 310 | 21 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A novel moesin-, ezrin-, radixin-like gene is a candidate for the neurofibromatosis 2 tumor suppressor." Trofatter J.A., Maccollin M.M., Rutter J.L., Murrell J.R., Duyao M.P., Parry D.N., Eldridge R., Kley N., Menon A.G., Pulaski K., Haase V.H., Ambrose C.M., Munroe D., Bove C., Haines J.L., Martuza R.L., Macdonald M.E., Seizinger B.R. Gusella J.F.Cell 72:791-800(1993) [PubMed: 8453669] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Alteration in a new gene encoding a putative membrane-organizing protein causes neuro-fibromatosis type 2." Rouleau G.A., Merel P., Lutchman M., Sanson M., Zucman J., Marineau C., Hoang-Xuan K., Demczuk S., Desmaze C., Plougastel B., Pulst S., Lenoir G., Bijlsma E., Fashold R., Dumanski J.P., de Jong P., Parry D., Eldrige R. Thomas G.Nature 363:515-521(1993) [PubMed: 8379998] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [3] | "NF2 gene in neurofibromatosis type 2 patients." Zucman-Rossi J., Legoix P., Der Sarjussian H., Cheret G., Sor F., Bernardi A., Cazes L., Giraud S., Lenoir G., Thomas G. Hum. Mol. Genet. 7:2095-2101(1998) [PubMed: 9817927] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1 AND 2). |
| [4] | "Novel alternatively spliced isoforms of the neurofibromatosis type 2 tumor suppressor are targeted to the nucleus and cytoplasmic granules." Schmucker B., Tang Y., Kressel M. Hum. Mol. Genet. 8:1561-1570(1999) [PubMed: 10401006] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 7; 9 AND 10), SUBCELLULAR LOCATION. |
| [5] | "Multiple transcription initiation sites, alternative splicing, and differential polyadenylation contribute to the complexity of human neurofibromatosis 2 transcripts." Chang L.-S., Akhmametyeva E.M., Wu Y., Zhu L., Welling D.B. Genomics 79:63-76(2002) [PubMed: 11827459] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 3; 4; 5; 6 AND 8). |
| [6] | "A genome annotation-driven approach to cloning the human ORFeome." Collins J.E., Wright C.L., Edwards C.A., Davis M.P., Grinham J.A., Cole C.G., Goward M.E., Aguado B., Mallya M., Mokrab Y., Huckle E.J., Beare D.M., Dunham I. Genome Biol. 5:RESEARCH84.1-RESEARCH84.11(2004) [PubMed: 15461802] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4). Tissue: Lung and Skin. |
| [8] | "The gene of neurofibromatosis type 2." Marineau C., Merel P., Rouleau G.A., Thomas G. Medecine/Sciences 11:35-42(1995) Cited for: REVIEW. |
| [9] | "NHE-RF, a regulatory cofactor for Na(+)-H+ exchange, is a common interactor for merlin and ERM (MERM) proteins." Murthy A., Gonzalez-Agosti C., Cordero E., Pinney D., Candia C., Solomon F., Gusella J., Ramesh V. J. Biol. Chem. 273:1273-1276(1998) [PubMed: 9430655] [Abstract] Cited for: INTERACTION WITH SLC9A3R1. |
| [10] | "The neurofibromatosis 2 tumor suppressor protein interacts with hepatocyte growth factor-regulated tyrosine kinase substrate." Scoles D.R., Huynh D.P., Chen M.S., Burke S.P., Gutmann D.H., Pulst S.-M. Hum. Mol. Genet. 9:1567-1574(2000) [PubMed: 10861283] [Abstract] Cited for: INTERACTION WITH HGS. |
| [11] | "MAP, a protein interacting with a tumor suppressor, merlin, through the run domain." Lee I.K., Kim K.-S., Kim H., Lee J.Y., Ryu C.H., Chun H.J., Lee K.-U., Lim Y., Kim Y.H., Huh P.-W., Lee K.-H., Han S.-I., Jun T.-Y., Rha H.K. Biochem. Biophys. Res. Commun. 325:774-783(2004) [PubMed: 15541357] [Abstract] Cited for: INTERACTION WITH SGSM3. |
| [12] | "Neurofibromatosis 2 (NF2) tumor suppressor merlin inhibits phosphatidylinositol 3-kinase through binding to PIKE-L." Rong R., Tang X., Gutmann D.H., Ye K. Proc. Natl. Acad. Sci. U.S.A. 101:18200-18205(2004) [PubMed: 15598747] [Abstract] Cited for: INTERACTION WITH AGAP2, MUTAGENESIS OF LEU-64. |
| [13] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed: 17081983] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-518, MASS SPECTROMETRY. Tissue: Epithelium. |
| [14] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-518, MASS SPECTROMETRY. |
| [15] | "The structure of the FERM domain of merlin, the neurofibromatosis type 2 gene product." Kang B.S., Cooper D.R., Devedjiev Y., Derewenda U., Derewenda Z.S. Acta Crystallogr. D 58:381-391(2002) [PubMed: 11856822] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.8 ANGSTROMS) OF 1-313. |
| [16] | "DNA diagnosis of neurofibromatosis 2. Altered coding sequence of the merlin tumor suppressor in an extended pedigree." Maccollin M.M., Mohney T., Trofatter J.A., Wertelecki W., Ramesh V., Gusella J.F. JAMA 270:2316-2320(1993) [PubMed: 8230593] [Abstract] Cited for: VARIANT NF2 TYR-220. |
| [17] | "Mutational analysis of patients with neurofibromatosis 2." Maccollin M.M., Ramesh V., Jacoby L.B., Louis D.N., Rubio M.-P., Pulaski K., Trofatter J.A., Short M.P., Bove C., Eldridge R., Parry D.M., Gusella J.F. Am. J. Hum. Genet. 55:314-320(1994) [PubMed: 7913580] [Abstract] Cited for: VARIANT NF2 PHE-96 DEL. |
| [18] | "Somatic NF2 gene mutations in familial and non-familial vestibular schwannoma." Irving R.M., Moffat D.A., Hardy D.G., Barton D.E., Xuereb J.H., Maher E.R. Hum. Mol. Genet. 3:347-350(1994) [PubMed: 8004107] [Abstract] Cited for: VARIANT ARG-46. |
| [19] | "Exon scanning for mutation of the NF2 gene in schwannomas." Jacoby L.B., Maccollin M.M., Louis D.N., Mohney T., Rubio M.-P., Pulaski K., Trofatter J.A., Kley N., Seizinger B.R., Ramesh V., Gusella J.F. Hum. Mol. Genet. 3:413-419(1994) [PubMed: 8012353] [Abstract] Cited for: VARIANTS MET-219 AND CYS-418. |
| [20] | "Germline mutations in the neurofibromatosis type 2 tumour suppressor gene." Bourn D., Carter S.A., Mason S., Gareth D., Evans R., Strachan T. Hum. Mol. Genet. 3:813-816(1994) [PubMed: 8081368] [Abstract] Cited for: VARIANTS NF2 SER-62; GLY-106 AND MET-352. |
| [21] | "Mutations of the neurofibromatosis type 2 gene and lack of the gene product in vestibular schwannomas." Sainz J., Huynh D.P., Figueroa K., Ragge N.K., Baser M.E., Pulst S.M. Hum. Mol. Genet. 3:885-891(1994) [PubMed: 7951231] [Abstract] Cited for: VARIANTS GLU-79 AND HIS-351. |
| [22] | "Mutations in transcript isoforms of the neurofibromatosis 2 gene in multiple human tumour types." Bianchi A.B., Hara T., Ramesh V., Gao J., Klein Szanto A.J., Morin F., Menon A.G., Trofatter J.A., Gusella J.F., Seizinger B.R., Kley N. Nat. Genet. 6:185-192(1994) [PubMed: 8162073] [Abstract] Cited for: VARIANTS PHE-273 AND ILE-364. |
| [23] | "Eleven novel mutations in the NF2 tumour suppressor gene." Bourn D., Evans G., Mason S., Tekes S., Trueman L., Strachan T. Hum. Genet. 95:572-574(1995) [PubMed: 7759081] [Abstract] Cited for: VARIANTS NF2 PHE-119 DEL; GLU-413 AND PRO-535. |
| [24] | "Diagnostic issues in a family with late onset type 2 neurofibromatosis." Evans D.G.R., Bourn D., Wallace A., Ramsden R.T., Mitchell J.D., Strachan T. J. Med. Genet. 32:470-474(1995) [PubMed: 7666400] [Abstract] Cited for: VARIANT NF2 PRO-535. |
| [25] | "A missense mutation in the NF2 gene results in moderate and mild clinical phenotypes of neurofibromatosis type 2." Kluwe L., Mautner V.-F. Hum. Genet. 97:224-227(1996) [PubMed: 8566958] [Abstract] Cited for: VARIANT NF2 PRO-538. |
| [26] | "Screening for mutations in the neurofibromatosis type 2 (NF2) gene in sporadic meningiomas." de Vitis L.R., Tedde A., Vitelli F., Ammannati F., Mennonna P., Bigozzi U., Montali E., Papi L. Hum. Genet. 97:632-637(1996) [PubMed: 8655144] [Abstract] Cited for: VARIANTS PHE-96 DEL; ILE-117; PHE-119 DEL; 122-VAL--GLU-129 DEL AND PHE-339. |
| [27] | "Mutational spectrum in the neurofibromatosis type 2 gene in sporadic and familial schwannomas." Welling D.B., Guida M., Goll F., Pearl D.K., Glasscock M.E., Pappas D.G., Linthicum F.H., Rogers D., Prior T.W. Hum. Genet. 98:189-193(1996) [PubMed: 8698340] [Abstract] Cited for: VARIANTS NF2 CYS-197 AND HIS-539. |
| [28] | "Genotype/phenotype correlations in type 2 neurofibromatosis (NF2): evidence for more severe disease associated with truncating mutations." Evans D.G.R., Trueman L., Wallace A., Collins S., Strachan T. J. Med. Genet. 35:450-455(1998) [PubMed: 9643284] [Abstract] Cited for: VARIANTS NF2 SER-62; VAL-77; GLY-106; MET-352; GLU-413 AND PRO-535. |
| [29] | Erratum Evans D.G., Trueman L., Wallace A., Collins S., Strachan T. J. Med. Genet. 36:87-87(1999) |
| [30] | "Germ-line NF2 mutations and disease severity in neurofibromatosis type 2 patients with retinal abnormalities." Baser M.E., Kluwe L., Mautner V.-F. Am. J. Hum. Genet. 64:1230-1233(1999) [PubMed: 10090912] [Abstract] Cited for: VARIANT NF2 ARG-234. |
| [31] | "Detection of novel NF2 mutations by an RNA mismatch cleavage method." Faudoa R., Xue Z., Lee F., Baser M.E., Hung G. Hum. Mutat. 15:474-478(2000) [PubMed: 10790209] [Abstract] Cited for: VARIANTS NF2 SER-62; THR-533 AND MET-579. |
| [32] | "Preimplantation diagnosis for neurofibromatosis." Verlinsky Y., Rechitsky S., Verlinsky O., Chistokhina A., Sharapova T., Masciangelo C., Levy M., Kaplan B., Lederer K., Kuliev A. Reprod. BioMed. Online 4:218-222(2002) [PubMed: 12709270] [Abstract] Cited for: VARIANT NF2 PRO-141. |
| [33] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed: 16959974] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] LYS-463. |
| [34] | "Evidence of a four-hit mechanism involving SMARCB1 and NF2 in schwannomatosis-associated schwannomas." Sestini R., Bacci C., Provenzano A., Genuardi M., Papi L. Hum. Mutat. 29:227-231(2008) [PubMed: 18072270] [Abstract] Cited for: INVOLVEMENT IN SCHWANNOMATOSIS. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| L11353 mRNA. Translation: AAA36212.1. X72655 X72670 Genomic DNA. Translation: CAA51220.1. Z22664 mRNA. Translation: CAA80377.1. Y18000 Genomic DNA. Translation: CAA76992.1. Y18000 Genomic DNA. Translation: CAA76993.1. AF122827 mRNA. Translation: AAD48752.1. AF122828 mRNA. Translation: AAD48753.1. AF123570 mRNA. Translation: AAD48754.1. AF369657 mRNA. Translation: AAK54160.1. AF369658 mRNA. Translation: AAK54161.1. AF369661 mRNA. Translation: AAK54162.1. AF369662 mRNA. Translation: AAK54163.1. AF369663 mRNA. Translation: AAK54164.1. AF369664 mRNA. Translation: AAK54165.1. AF369665 mRNA. Translation: AAK54166.1. AF369700 mRNA. Translation: AAK54195.1. AF369701 mRNA. Translation: AAK54196.1. CR456530 mRNA. Translation: CAG30416.1. BC003112 mRNA. Translation: AAH03112.2. BC020257 mRNA. Translation: AAH20257.1. | |||||||||||||
| IPI | IPI00216128. IPI00220308. IPI00220310. IPI00220311. IPI00220312. IPI00220314. IPI00220315. IPI00304755. IPI00414202. IPI00414431. | ||||||||||||
| PIR | S33809. | ||||||||||||
| RefSeq | NP_000259.1. NP_057502.2. NP_861546.1. NP_861966.1. NP_861967.1. NP_861968.1. NP_861969.1. NP_861971.1. | ||||||||||||
| UniGene | Hs.187898 | ||||||||||||
3D structure databases | |||||||||||||
| |||||||||||||
| SMR | P35240. Positions 18-340. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | P35240. 12 interactions. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | P35240. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | P35240. | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENSG00000186575. Homo sapiens. [Contig view] | ||||||||||||
| GeneID | 4771. | ||||||||||||
| KEGG | hsa:4771. | ||||||||||||
Organism-specific databases | |||||||||||||
| GeneCards | GC22P028324. | ||||||||||||
| H-InvDB | HIX0016355. | ||||||||||||
| HGNC | HGNC:7773. NF2. | ||||||||||||
| HPA | CAB005385. HPA003097. | ||||||||||||
| MIM | 101000. phenotype. 162091. phenotype. 607379. gene. | ||||||||||||
| Orphanet | 2495. Meningioma. 637. Neurofibromatosis type 2. 93920. Schwannomatosis VIII. | ||||||||||||
| PharmGKB | PA25629. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| HOVERGEN | P35240. | ||||||||||||
| OMA | P35240. PPDIPSF. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | P35240. | ||||||||||||
| Bgee | P35240. | ||||||||||||
| GermOnline | ENSG00000186575. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR015788. Band_4.1_merlin. IPR019749. Band_41_domain. IPR019750. Band_41_sg. IPR011174. ERM. IPR011259. ERM_C. IPR000798. Ez/rad/moesin. IPR014352. FERM/acyl-CoA_bd_prot_3-hlx. IPR019748. FERM_central. IPR019747. FERM_CS. IPR000299. FERM_domain. IPR018979. FERM_N. IPR018980. FERM_PH-like_C. [Graphical view] | ||||||||||||
| Gene3D | G3DSA:1.20.80.10. ACBP. 1 hit. | ||||||||||||
| PANTHER | PTHR23281:SF4. Band_4.1_merlin. 1 hit. | ||||||||||||
| Pfam | PF00769. ERM. 1 hit. PF09380. FERM_C. 1 hit. PF00373. FERM_M. 1 hit. PF09379. FERM_N. 1 hit. [Graphical view] | ||||||||||||
| PIRSF | PIRSF002305. ERM. 1 hit. | ||||||||||||
| PRINTS | PR00935. BAND41. PR00661. ERMFAMILY. | ||||||||||||
| SMART | SM00295. B41. 1 hit. [Graphical view] | ||||||||||||
| PROSITE | PS00660. FERM_1. 1 hit. PS00661. FERM_2. 1 hit. PS50057. FERM_3. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other Resources | |||||||||||||
| NextBio | 18368. | ||||||||||||
| PMAP-CutDB | P35240. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | MERL_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P35240 Secondary accession number(s): O95683 Q9UNH4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 22 Human chromosome 22: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


