P35236 (PTN7_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 129.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Tyrosine-protein phosphatase non-receptor type 7 EC=3.1.3.48 Alternative name(s): Hematopoietic protein-tyrosine phosphatase Short name=HEPTP Protein-tyrosine phosphatase LC-PTP | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 360 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Protein phosphatase that acts preferentially on tyrosine-phosphorylated MAPK1. Plays a role in the regulation of T and B-lymphocyte development and signal transduction. Ref.1 Ref.2 Ref.6 Ref.7 Ref.8 Ref.9 |
| Catalytic activity | Protein tyrosine phosphate + H2O = protein tyrosine + phosphate. |
| Enzyme regulation | Inhibited in cells after FCER1A triggering By similarity. |
| Subunit structure | Monomer. Interacts with MAPK1, MAPK3 and several other MAP kinases. Ref.6 Ref.7 Ref.8 Ref.9 Ref.15 |
| Subcellular location | Cytoplasm. Cytoplasm › cytoskeleton By similarity Ref.10. |
| Tissue specificity | |
| Post-translational modification | Phosphorylated on serine residues in resting T-cells. Phosphorylation increases upon exposure to stimuli that increase intracellular cAMP levels. Phosphorylation leads to dissociation of bound MAP kinases. Ref.7 Ref.8 Ref.10 Oxidized at active site cysteine. Treatment with pervanadate (vanadate and H2O2) or with antigen enhanced oxidation of active site cysteine By similarity. |
| Sequence similarities | Belongs to the protein-tyrosine phosphatase family. Non-receptor class subfamily. Contains 1 tyrosine-protein phosphatase domain. |
| Sequence caution | The sequence AAA59531.1 differs from that shown. Reason: Frameshift at position 5. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Cytoskeleton |
| Coding sequence diversity | Alternative splicing |
| Molecular function | Hydrolase Protein phosphatase |
| PTM | Oxidation Phosphoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | cytoskeleton Inferred from electronic annotation. Source: UniProtKB-SubCell cytosolInferred from direct assay PubMed 10940933. Source: BHF-UCL internal side of plasma membraneInferred from direct assay PubMed 10940933. Source: UniProtKB |
| Molecular_function | protein tyrosine phosphatase activity Traceable author statement Ref.2. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P35236-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P35236-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MGASFWPIRQAREQQRRALSFRQTSWLSEPPLGPAPHLSM |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 360 | 360 | Tyrosine-protein phosphatase non-receptor type 7 | PRO_0000094761 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 97 – 350 | 254 | Tyrosine-protein phosphatase | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 38 – 51 | 14 | Interaction with MAP kinases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 291 – 297 | 7 | Substrate binding | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 291 | 1 | Phosphocysteine intermediate Ref.6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 257 | 1 | Substrate | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 335 | 1 | Substrate | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 44 | 1 | Phosphoserine Ref.8 Ref.10 Ref.13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 66 | 1 | Phosphothreonine Ref.7 Ref.12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 93 | 1 | Phosphoserine Ref.7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 143 | 1 | Phosphoserine Ref.13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 291 | 1 | Cysteine sulfenic acid (-SOH) By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MGASFWPIRQAREQQRRALS FRQTSWLSEPPLGPAPHLSM in isoform 2. | VSP_026925 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 44 | 1 | S → A: Prevents dissociation of bound MAP kinase and enhances their dephosphorylation. Ref.10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 44 | 1 | S → D: Reduces binding of MAP kinase. Ref.10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 66 | 1 | T → A: Prevents dissociation of bound MAP kinase and enhances their dephosphorylation; when associated with A-93. Ref.7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 93 | 1 | S → A: Prevents dissociation of bound MAP kinase and enhances their dephosphorylation; when associated with A-66. Ref.7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 125 | 1 | Y → A: Strongly reduced catalytic activity. Ref.11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 257 | 1 | D → A: Loss of catalytic activity. Ref.11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 291 | 1 | C → S: Loss of catalytic activity. Ref.6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 335 | 1 | Q → A: Reduced catalytic activity. Ref.11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 235 – 236 | 2 | QL → HV in AAA59531. Ref.2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 337 | 1 | A → D in BAA01946. Ref.1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 38 – 41 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 67 – 77 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 81 – 83 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 84 – 89 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 94 – 103 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 111 – 113 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 119 – 122 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 132 – 134 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 135 – 137 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 149 – 155 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 158 – 160 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 164 – 169 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 173 – 175 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 176 – 185 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 190 – 194 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 199 – 201 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 210 – 215 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 218 – 227 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 229 – 240 | 12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 243 – 252 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 264 – 275 | 12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 281 – 283 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 287 – 295 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 296 – 314 | 19 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 315 – 317 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 319 – 329 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 337 – 353 | 17 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning and chromosomal mapping of a human protein-tyrosine phosphatase LC-PTP." Adachi M., Sekiya M., Isobe M., Kumura Y., Ogita Z.I., Hinoda Y., Imai K., Yachi A. Biochem. Biophys. Res. Commun. 186:1607-1615(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, FUNCTION. |
| [2] | "Cloning and expression of an inducible lymphoid-specific, protein tyrosine phosphatase (HePTPase)." Zanke B., Suzuki H., Kishihara K., Mizzen L., Minden M., Pawson A., Mak T.W. Eur. J. Immunol. 22:235-239(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY. Tissue: Lymphocyte. |
| [3] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [4] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Lymph. |
| [6] | "Negative regulation of T cell antigen receptor signal transduction by hematopoietic tyrosine phosphatase (HePTP)." Saxena M., Williams S., Gilman J., Mustelin T. J. Biol. Chem. 273:15340-15344(1998) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH MAPK1, ACTIVE SITE, MUTAGENESIS OF CYS-291. |
| [7] | "Inhibition of T cell signaling by mitogen-activated protein kinase-targeted hematopoietic tyrosine phosphatase (HePTP)." Saxena M., Williams S., Brockdorff J., Gilman J., Mustelin T. J. Biol. Chem. 274:11693-11700(1999) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH MAPK1 AND MAPK3, PHOSPHORYLATION AT THR-66 AND SER-93, MUTAGENESIS OF THR-66 AND SER-93. |
| [8] | "Crosstalk between cAMP-dependent kinase and MAP kinase through a protein tyrosine phosphatase." Saxena M., Williams S., Tasken K., Mustelin T. Nat. Cell Biol. 1:305-311(1999) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH MAPK1, PHOSPHORYLATION AT SER-44. |
| [9] | "The MAP-kinase ERK2 is a specific substrate of the protein tyrosine phosphatase HePTP." Pettiford S.M., Herbst R. Oncogene 19:858-869(2000) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH MAPK1 AND MAPK3. |
| [10] | "Haematopoietic protein tyrosine phosphatase (HePTP) phosphorylation by cAMP-dependent protein kinase in T-cells: dynamics and subcellular location." Nika K., Hyunh H., Williams S., Paul S., Bottini N., Tasken K., Lombroso P.J., Mustelin T. Biochem. J. 378:335-342(2004) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, PHOSPHORYLATION AT SER-44, MUTAGENESIS OF SER-44. |
| [11] | "Molecular determinants of substrate recognition in hematopoietic protein-tyrosine phosphatase." Huang Z., Zhou B., Zhang Z.-Y. J. Biol. Chem. 279:52150-52159(2004) [PubMed] [Europe PMC] [Abstract] Cited for: MUTAGENESIS OF TYR-125; ASP-257 AND GLN-335. |
| [12] | "Phosphoproteome of resting human platelets." Zahedi R.P., Lewandrowski U., Wiesner J., Wortelkamp S., Moebius J., Schuetz C., Walter U., Gambaryan S., Sickmann A. J. Proteome Res. 7:526-534(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-66, MASS SPECTROMETRY. Tissue: Platelet. |
| [13] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-44 AND SER-143, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [14] | "Structure of the hematopoietic tyrosine phosphatase (HePTP) catalytic domain: structure of a KIM phosphatase with phosphate bound at the active site." Mustelin T., Tautz L., Page R. J. Mol. Biol. 354:150-163(2005) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.85 ANGSTROMS) OF 65-360 OF MUTANT ASP-246 IN COMPLEX WITH SUBSTRATE ANALOG. |
| [15] | "Crystal structures and inhibitor identification for PTPN5, PTPRR and PTPN7: a family of human MAPK-specific protein tyrosine phosphatases." Eswaran J., von Kries J.P., Marsden B., Longman E., Debreczeni J.E., Ugochukwu E., Turnbull A., Lee W.H., Knapp S., Barr A.J. Biochem. J. 395:483-491(2006) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.55 ANGSTROMS) OF 65-358 IN COMPLEX WITH SUBSTRATE ANALOG, SUBUNIT. |
| [16] | "Docking interactions induce exposure of activation loop in the MAP kinase ERK2." Zhou T., Sun L., Humphreys J., Goldsmith E.J. Structure 14:1011-1019(2006) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.9 ANGSTROMS) OF 37-52 IN COMPLEX WITH MAPK1. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | D11327 mRNA. Translation: BAA01946.1. M64322 mRNA. Translation: AAA59531.1. Frameshift. BT009848 mRNA. Translation: AAP88850.1. AL592300 Genomic DNA. Translation: CAI13108.1. BC001746 mRNA. Translation: AAH01746.2. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00081833. IPI00946771. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | JH0692. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_542155.1. NM_080588.2. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.402773. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | P35236. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DIP | DIP-29118N. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | P35236. 1 interaction. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000356248. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | P35236. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PaxDb | P35236. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | P35236. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DNASU | 5778. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000308986; ENSP00000311133; ENSG00000143851. ENST00000367279; ENSP00000356248; ENSG00000143851. ENST00000495688; ENSP00000420506; ENSG00000143851. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 5778. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:5778. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc001gxl.2. human. uc001gxn.2. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 5778. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC01M202116. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| H-InvDB | HIX0001472. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:9659. PTPN7. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB009530. HPA019118. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 176889. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_P35236. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA34003. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | COG5599. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOGENOM | HOG000294188. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG001594. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InParanoid | P35236. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KO | K04458. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG4DJJWN. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| BRENDA | 3.1.3.48. 2681. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | cd8tcrdownstreampathway. Downstream signaling in naive CD8+ T cells. tcrraspathway. Ras signaling in the CD4+ TCR pathway. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | P35236. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | P35236. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_PTPN7. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | P35236. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000143851. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR000387. Tyr/Dual-sp_Pase. IPR016130. Tyr_Pase_AS. IPR008356. Tyr_Pase_KIM-con. IPR000242. Tyr_Pase_rcpt/non-rcpt. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00102. Y_phosphatase. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRINTS | PR01778. KIMPTPASE. PR00700. PRTYPHPHTASE. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00194. PTPc. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS00383. TYR_PHOSPHATASE_1. 1 hit. PS50056. TYR_PHOSPHATASE_2. 1 hit. PS50055. TYR_PHOSPHATASE_PTP. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| BindingDB | P35236. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ChEMBL | CHEMBL2219. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ChiTaRS | PTPN7. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | P35236. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 5778. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 22472. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | PTN7_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P35236 Secondary accession number(s): Q53XK4, Q5SXQ1, Q9BV05 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
