Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Profilin-2

Gene

PFN2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG.

GO - Molecular functioni

  • actin monomer binding Source: UniProtKB
  • ATPase activity Source: GO_Central
  • phosphatidylinositol-4,5-bisphosphate binding Source: UniProtKB

GO - Biological processi

Keywordsi

Molecular functionActin-binding

Enzyme and pathway databases

ReactomeiR-HSA-376176. Signaling by ROBO receptors.
R-HSA-5663220. RHO GTPases Activate Formins.

Names & Taxonomyi

Protein namesi
Recommended name:
Profilin-2
Alternative name(s):
Profilin II
Gene namesi
Name:PFN2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

EuPathDBiHostDB:ENSG00000070087.13.
HGNCiHGNC:8882. PFN2.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

Pathology & Biotechi

Organism-specific databases

DisGeNETi5217.
OpenTargetsiENSG00000070087.
PharmGKBiPA33220.

Chemistry databases

DrugBankiDB02580. 1-(2-Methoxy-Ethoxy)-2-{2-[2-(2-Methoxy-Ethoxy]-Ethoxy}-Ethane.
DB02078. 1-Methoxy-2-[2-(2-Methoxy-Ethoxy]-Ethane.

Polymorphism and mutation databases

BioMutaiPFN2.
DMDMi20178322.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedND:
ChainiPRO_00001995752 – 140Profilin-2Add BLAST139

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineND:1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiP35080.
MaxQBiP35080.
PaxDbiP35080.
PeptideAtlasiP35080.
PRIDEiP35080.

2D gel databases

REPRODUCTION-2DPAGEiP35080.

PTM databases

iPTMnetiP35080.
PhosphoSitePlusiP35080.

Expressioni

Tissue specificityi

Highly expressed in brain, skeletal muscle and kidney and less strongly in heart, placenta, lung and liver.

Gene expression databases

BgeeiENSG00000070087.
CleanExiHS_PFN2.
ExpressionAtlasiP35080. baseline and differential.
GenevisibleiP35080. HS.

Organism-specific databases

HPAiCAB037073.
HPA035611.

Interactioni

Subunit structurei

Occurs in many kinds of cells as a complex with monomeric actin in a 1:1 ratio (PubMed:7758455). Interacts with PFN2 (By similarity).HMP:1 Publication

Binary interactionsi

Show more details

GO - Molecular functioni

  • actin monomer binding Source: UniProtKB

Protein-protein interaction databases

BioGridi111238. 48 interactors.
CORUMiP35080.
IntActiP35080. 34 interactors.
MINTiMINT-1370857.
STRINGi9606.ENSP00000239940.

Structurei

Secondary structure

1140
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi5 – 11ND:7
Beta strandi17 – 24ND:8
Beta strandi26 – 28ND:3
Beta strandi30 – 34ND:5
Helixi40 – 42ND:3
Helixi45 – 52ND:8
Helixi58 – 62ND:5
Beta strandi64 – 66ND:3
Beta strandi69 – 80ND:12
Beta strandi85 – 90ND:6
Beta strandi93 – 95ND:3
Beta strandi100 – 105ND:6
Beta strandi107 – 115ND:9
Helixi121 – 137ND:17

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1D1JX-ray2.20A/B/C/D2-138[»]
ProteinModelPortaliP35080.
SMRiP35080.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP35080.

Family & Domainsi

Sequence similaritiesi

Belongs to the profilin family.IKR:

Phylogenomic databases

eggNOGiKOG1755. Eukaryota.
ENOG41126PD. LUCA.
GeneTreeiENSGT00390000010143.
HOGENOMiHOG000171592.
HOVERGENiHBG053683.
InParanoidiP35080.
KOiK05759.
OMAiVMGKEGT.
PhylomeDBiP35080.
TreeFamiTF331744.

Family and domain databases

CDDicd00148. PROF. 1 hit.
InterProiView protein in InterPro
IPR005455. PFN.
IPR029891. PFN2.
IPR036140. PFN_sf.
IPR005454. Profilin1/2/3_vertebrate.
IPR027310. Profilin_CS.
PANTHERiPTHR13936:SF15. PTHR13936:SF15. 1 hit.
PfamiView protein in Pfam
PF00235. Profilin. 1 hit.
PRINTSiPR00392. PROFILIN.
PR01639. PROFILINMAML.
SMARTiView protein in SMART
SM00392. PROF. 1 hit.
SUPFAMiSSF55770. SSF55770. 1 hit.
PROSITEiView protein in PROSITE
PS00414. PROFILIN. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform IIa (identifier: P35080-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAGWQSYVDN LMCDGCCQEA AIVGYCDAKY VWAATAGGVF QSITPIEIDM
60 70 80 90 100
IVGKDREGFF TNGLTLGAKK CSVIRDSLYV DGDCTMDIRT KSQGGEPTYN
110 120 130 140
VAVGRAGRVL VFVMGKEGVH GGGLNKKAYS MAKYLRDSGF
Length:140
Mass (Da):15,046
Last modified:January 23, 2007 - v3
Checksum:iF43884E1427C9A99
GO
Isoform IIb (identifier: P35080-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     109-140: VLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF → ALVIVMGKEGVHGGTLNKKAYELALYLRRSDV

Show »
Length:140
Mass (Da):15,088
Checksum:iB4CAC8A1ED8C658B
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti65T → A in AAH18049 (PubMed:15489334).IKR:1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_005217109 – 140VLVFV…RDSGF → ALVIVMGKEGVHGGTLNKKA YELALYLRRSDV in isoform IIb. IBD:Add BLAST32

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L10678 mRNA. Translation: AAA03022.1.
AF228738 mRNA. Translation: AAG24949.1.
AK311780 mRNA. Translation: BAG34723.1.
AK311782 mRNA. Translation: BAG34725.1.
CH471052 Genomic DNA. Translation: EAW78850.1.
BC002964 mRNA. No translation available.
CH471052 Genomic DNA. Translation: EAW78852.1.
BC018049 mRNA. Translation: AAH18049.1.
BC043646 mRNA. Translation: AAH43646.1.
BC095444 mRNA. Translation: AAH95444.1.
CCDSiCCDS3148.1. [P35080-1]
CCDS46934.1. [P35080-2]
PIRiS36804.
RefSeqiNP_002619.1. NM_002628.4. [P35080-2]
NP_444252.1. NM_053024.3. [P35080-1]
UniGeneiHs.91747.

Genome annotation databases

EnsembliENST00000239940; ENSP00000239940; ENSG00000070087. [P35080-1]
ENST00000452853; ENSP00000410464; ENSG00000070087. [P35080-2]
GeneIDi5217.
KEGGihsa:5217.
UCSCiuc003ext.3. human. [P35080-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiPROF2_HUMAN
AccessioniPrimary (citable) accession number: P35080
Secondary accession number(s): B2R4C8
, D3DNI4, Q4VBQ4, Q8WVF9, Q9HBK2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: January 23, 2007
Last modified: November 22, 2017
This is version 181 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families