Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Profilin-2

Gene

PFN2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG.

GO - Molecular functioni

  • actin monomer binding Source: UniProtKB
  • adenyl-nucleotide exchange factor activity Source: UniProtKB
  • phosphatidylinositol-4,5-bisphosphate binding Source: UniProtKB

GO - Biological processi

  • actin cytoskeleton organization Source: InterPro
  • negative regulation of actin filament polymerization Source: UniProtKB
  • negative regulation of epithelial cell migration Source: UniProtKB
  • negative regulation of ruffle assembly Source: UniProtKB
  • positive regulation of actin filament bundle assembly Source: UniProtKB
  • positive regulation of actin filament polymerization Source: UniProtKB
  • positive regulation of ATPase activity Source: UniProtKB
  • positive regulation of peptidyl-serine phosphorylation Source: UniProtKB
  • positive regulation of stress fiber assembly Source: UniProtKB
  • protein stabilization Source: UniProtKB
  • regulation of synaptic vesicle exocytosis Source: Ensembl
Complete GO annotation...

Keywords - Ligandi

Actin-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000070087-MONOMER.
ReactomeiR-HSA-376176. Signaling by Robo receptor.
R-HSA-5663220. RHO GTPases Activate Formins.

Names & Taxonomyi

Protein namesi
Recommended name:
Profilin-2
Alternative name(s):
Profilin II
Gene namesi
Name:PFN2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:8882. PFN2.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: GO_Central
  • cytoskeleton Source: UniProtKB-SubCell
  • extracellular exosome Source: UniProtKB
  • terminal bouton Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

Pathology & Biotechi

Organism-specific databases

DisGeNETi5217.
OpenTargetsiENSG00000070087.
PharmGKBiPA33220.

Polymorphism and mutation databases

BioMutaiPFN2.
DMDMi20178322.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00001995752 – 140Profilin-2Add BLAST139

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiP35080.
MaxQBiP35080.
PaxDbiP35080.
PeptideAtlasiP35080.
PRIDEiP35080.

2D gel databases

REPRODUCTION-2DPAGEP35080.

PTM databases

iPTMnetiP35080.
PhosphoSitePlusiP35080.

Expressioni

Tissue specificityi

Highly expressed in brain, skeletal muscle and kidney and less strongly in heart, placenta, lung and liver.

Gene expression databases

BgeeiENSG00000070087.
CleanExiHS_PFN2.
ExpressionAtlasiP35080. baseline and differential.
GenevisibleiP35080. HS.

Organism-specific databases

HPAiCAB037073.
HPA035611.

Interactioni

Subunit structurei

Occurs in many kinds of cells as a complex with monomeric actin in a 1:1 ratio (PubMed:7758455). Interacts with PFN2 (By similarity).By similarity1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
GOLGB1Q147892EBI-473138,EBI-709973
HTTP428584EBI-473138,EBI-466029
WaslO088163EBI-473138,EBI-6142604From a different organism.

GO - Molecular functioni

  • actin monomer binding Source: UniProtKB

Protein-protein interaction databases

BioGridi111238. 42 interactors.
IntActiP35080. 33 interactors.
MINTiMINT-1370857.
STRINGi9606.ENSP00000239940.

Structurei

Secondary structure

1140
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi5 – 11Combined sources7
Beta strandi17 – 24Combined sources8
Beta strandi26 – 28Combined sources3
Beta strandi30 – 34Combined sources5
Helixi40 – 42Combined sources3
Helixi45 – 52Combined sources8
Helixi58 – 62Combined sources5
Beta strandi64 – 66Combined sources3
Beta strandi69 – 80Combined sources12
Beta strandi85 – 90Combined sources6
Beta strandi93 – 95Combined sources3
Beta strandi100 – 105Combined sources6
Beta strandi107 – 115Combined sources9
Helixi121 – 137Combined sources17

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1D1JX-ray2.20A/B/C/D2-138[»]
ProteinModelPortaliP35080.
SMRiP35080.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP35080.

Family & Domainsi

Sequence similaritiesi

Belongs to the profilin family.Curated

Phylogenomic databases

eggNOGiKOG1755. Eukaryota.
ENOG41126PD. LUCA.
GeneTreeiENSGT00390000010143.
HOGENOMiHOG000171592.
HOVERGENiHBG053683.
InParanoidiP35080.
KOiK05759.
OMAiFFHMCSV.
PhylomeDBiP35080.
TreeFamiTF331744.

Family and domain databases

CDDicd00148. PROF. 1 hit.
InterProiIPR005455. PFN.
IPR029891. PFN2.
IPR005454. Profilin1/2/3_vertebrate.
IPR027310. Profilin_CS.
[Graphical view]
PANTHERiPTHR13936:SF15. PTHR13936:SF15. 1 hit.
PfamiPF00235. Profilin. 1 hit.
[Graphical view]
PRINTSiPR00392. PROFILIN.
PR01639. PROFILINMAML.
SMARTiSM00392. PROF. 1 hit.
[Graphical view]
SUPFAMiSSF55770. SSF55770. 1 hit.
PROSITEiPS00414. PROFILIN. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform IIa (identifier: P35080-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAGWQSYVDN LMCDGCCQEA AIVGYCDAKY VWAATAGGVF QSITPIEIDM
60 70 80 90 100
IVGKDREGFF TNGLTLGAKK CSVIRDSLYV DGDCTMDIRT KSQGGEPTYN
110 120 130 140
VAVGRAGRVL VFVMGKEGVH GGGLNKKAYS MAKYLRDSGF
Length:140
Mass (Da):15,046
Last modified:January 23, 2007 - v3
Checksum:iF43884E1427C9A99
GO
Isoform IIb (identifier: P35080-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     109-140: VLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF → ALVIVMGKEGVHGGTLNKKAYELALYLRRSDV

Show »
Length:140
Mass (Da):15,088
Checksum:iB4CAC8A1ED8C658B
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti65T → A in AAH18049 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_005217109 – 140VLVFV…RDSGF → ALVIVMGKEGVHGGTLNKKA YELALYLRRSDV in isoform IIb. 3 PublicationsAdd BLAST32

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L10678 mRNA. Translation: AAA03022.1.
AF228738 mRNA. Translation: AAG24949.1.
AK311780 mRNA. Translation: BAG34723.1.
AK311782 mRNA. Translation: BAG34725.1.
CH471052 Genomic DNA. Translation: EAW78850.1.
BC002964 mRNA. No translation available.
CH471052 Genomic DNA. Translation: EAW78852.1.
BC018049 mRNA. Translation: AAH18049.1.
BC043646 mRNA. Translation: AAH43646.1.
BC095444 mRNA. Translation: AAH95444.1.
CCDSiCCDS3148.1. [P35080-1]
CCDS46934.1. [P35080-2]
PIRiS36804.
RefSeqiNP_002619.1. NM_002628.4. [P35080-2]
NP_444252.1. NM_053024.3. [P35080-1]
UniGeneiHs.91747.

Genome annotation databases

EnsembliENST00000239940; ENSP00000239940; ENSG00000070087. [P35080-1]
ENST00000452853; ENSP00000410464; ENSG00000070087. [P35080-2]
GeneIDi5217.
KEGGihsa:5217.
UCSCiuc003ext.3. human. [P35080-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L10678 mRNA. Translation: AAA03022.1.
AF228738 mRNA. Translation: AAG24949.1.
AK311780 mRNA. Translation: BAG34723.1.
AK311782 mRNA. Translation: BAG34725.1.
CH471052 Genomic DNA. Translation: EAW78850.1.
BC002964 mRNA. No translation available.
CH471052 Genomic DNA. Translation: EAW78852.1.
BC018049 mRNA. Translation: AAH18049.1.
BC043646 mRNA. Translation: AAH43646.1.
BC095444 mRNA. Translation: AAH95444.1.
CCDSiCCDS3148.1. [P35080-1]
CCDS46934.1. [P35080-2]
PIRiS36804.
RefSeqiNP_002619.1. NM_002628.4. [P35080-2]
NP_444252.1. NM_053024.3. [P35080-1]
UniGeneiHs.91747.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1D1JX-ray2.20A/B/C/D2-138[»]
ProteinModelPortaliP35080.
SMRiP35080.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111238. 42 interactors.
IntActiP35080. 33 interactors.
MINTiMINT-1370857.
STRINGi9606.ENSP00000239940.

PTM databases

iPTMnetiP35080.
PhosphoSitePlusiP35080.

Polymorphism and mutation databases

BioMutaiPFN2.
DMDMi20178322.

2D gel databases

REPRODUCTION-2DPAGEP35080.

Proteomic databases

EPDiP35080.
MaxQBiP35080.
PaxDbiP35080.
PeptideAtlasiP35080.
PRIDEiP35080.

Protocols and materials databases

DNASUi5217.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000239940; ENSP00000239940; ENSG00000070087. [P35080-1]
ENST00000452853; ENSP00000410464; ENSG00000070087. [P35080-2]
GeneIDi5217.
KEGGihsa:5217.
UCSCiuc003ext.3. human. [P35080-1]

Organism-specific databases

CTDi5217.
DisGeNETi5217.
GeneCardsiPFN2.
HGNCiHGNC:8882. PFN2.
HPAiCAB037073.
HPA035611.
MIMi176590. gene.
neXtProtiNX_P35080.
OpenTargetsiENSG00000070087.
PharmGKBiPA33220.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1755. Eukaryota.
ENOG41126PD. LUCA.
GeneTreeiENSGT00390000010143.
HOGENOMiHOG000171592.
HOVERGENiHBG053683.
InParanoidiP35080.
KOiK05759.
OMAiFFHMCSV.
PhylomeDBiP35080.
TreeFamiTF331744.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000070087-MONOMER.
ReactomeiR-HSA-376176. Signaling by Robo receptor.
R-HSA-5663220. RHO GTPases Activate Formins.

Miscellaneous databases

ChiTaRSiPFN2. human.
EvolutionaryTraceiP35080.
GeneWikiiPFN2.
GenomeRNAii5217.
PROiP35080.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000070087.
CleanExiHS_PFN2.
ExpressionAtlasiP35080. baseline and differential.
GenevisibleiP35080. HS.

Family and domain databases

CDDicd00148. PROF. 1 hit.
InterProiIPR005455. PFN.
IPR029891. PFN2.
IPR005454. Profilin1/2/3_vertebrate.
IPR027310. Profilin_CS.
[Graphical view]
PANTHERiPTHR13936:SF15. PTHR13936:SF15. 1 hit.
PfamiPF00235. Profilin. 1 hit.
[Graphical view]
PRINTSiPR00392. PROFILIN.
PR01639. PROFILINMAML.
SMARTiSM00392. PROF. 1 hit.
[Graphical view]
SUPFAMiSSF55770. SSF55770. 1 hit.
PROSITEiPS00414. PROFILIN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPROF2_HUMAN
AccessioniPrimary (citable) accession number: P35080
Secondary accession number(s): B2R4C8
, D3DNI4, Q4VBQ4, Q8WVF9, Q9HBK2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: January 23, 2007
Last modified: November 30, 2016
This is version 173 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.