Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P35080

- PROF2_HUMAN

UniProt

P35080 - PROF2_HUMAN

Protein

Profilin-2

Gene

PFN2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
  1. Functioni

    Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG.

    GO - Molecular functioni

    1. actin monomer binding Source: UniProt
    2. adenyl-nucleotide exchange factor activity Source: UniProt
    3. phosphatidylinositol-4,5-bisphosphate binding Source: UniProt
    4. protein binding Source: IntAct

    GO - Biological processi

    1. actin cytoskeleton organization Source: InterPro
    2. negative regulation of actin filament polymerization Source: UniProt
    3. negative regulation of epithelial cell migration Source: UniProt
    4. negative regulation of ruffle assembly Source: UniProt
    5. positive regulation of actin filament bundle assembly Source: UniProt
    6. positive regulation of actin filament polymerization Source: UniProt
    7. positive regulation of ATPase activity Source: UniProt
    8. positive regulation of peptidyl-serine phosphorylation Source: UniProt
    9. positive regulation of stress fiber assembly Source: UniProt
    10. regulation of synaptic vesicle exocytosis Source: Ensembl

    Keywords - Ligandi

    Actin-binding

    Enzyme and pathway databases

    ReactomeiREACT_19351. Signaling by Robo receptor.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Profilin-2
    Alternative name(s):
    Profilin II
    Gene namesi
    Name:PFN2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 3

    Organism-specific databases

    HGNCiHGNC:8882. PFN2.

    Subcellular locationi

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB-KW
    2. cytoskeleton Source: UniProtKB-SubCell
    3. extracellular vesicular exosome Source: UniProt
    4. terminal bouton Source: Ensembl

    Keywords - Cellular componenti

    Cytoplasm, Cytoskeleton

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA33220.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Initiator methioninei1 – 11Removed1 Publication
    Chaini2 – 140139Profilin-2PRO_0000199575Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei2 – 21N-acetylalanine1 Publication

    Keywords - PTMi

    Acetylation

    Proteomic databases

    MaxQBiP35080.
    PaxDbiP35080.
    PRIDEiP35080.

    2D gel databases

    REPRODUCTION-2DPAGEP35080.

    PTM databases

    PhosphoSiteiP35080.

    Expressioni

    Tissue specificityi

    Highly expressed in brain, skeletal muscle and kidney and less strongly in heart, placenta, lung and liver.

    Gene expression databases

    ArrayExpressiP35080.
    BgeeiP35080.
    CleanExiHS_PFN2.
    GenevestigatoriP35080.

    Organism-specific databases

    HPAiCAB037073.
    HPA035611.

    Interactioni

    Subunit structurei

    Occurs in many kinds of cells as a complex with monomeric actin in a 1:1 ratio.

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    GOLGB1Q147892EBI-473138,EBI-709973
    HTTP428584EBI-473138,EBI-466029
    WaslO088163EBI-473138,EBI-6142604From a different organism.

    Protein-protein interaction databases

    BioGridi111238. 32 interactions.
    IntActiP35080. 26 interactions.
    MINTiMINT-1370857.
    STRINGi9606.ENSP00000239940.

    Structurei

    Secondary structure

    1
    140
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi5 – 117
    Beta strandi17 – 248
    Beta strandi26 – 283
    Beta strandi30 – 345
    Helixi40 – 423
    Helixi45 – 528
    Helixi58 – 625
    Beta strandi64 – 663
    Beta strandi69 – 8012
    Beta strandi85 – 906
    Beta strandi93 – 953
    Beta strandi100 – 1056
    Beta strandi107 – 1159
    Helixi121 – 13717

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1D1JX-ray2.20A/B/C/D2-138[»]
    ProteinModelPortaliP35080.
    SMRiP35080. Positions 2-140.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiP35080.

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the profilin family.Curated

    Phylogenomic databases

    eggNOGiNOG295243.
    HOGENOMiHOG000171592.
    HOVERGENiHBG053683.
    InParanoidiP35080.
    KOiK05759.
    OMAiLAYHVAC.
    OrthoDBiEOG7JMGGT.
    PhylomeDBiP35080.
    TreeFamiTF331744.

    Family and domain databases

    InterProiIPR005454. Profilin_chordates.
    IPR027310. Profilin_CS.
    IPR005455. Profilin_eukaryotes/bac.
    [Graphical view]
    PfamiPF00235. Profilin. 1 hit.
    [Graphical view]
    PRINTSiPR00392. PROFILIN.
    PR01639. PROFILINMAML.
    SMARTiSM00392. PROF. 1 hit.
    [Graphical view]
    SUPFAMiSSF55770. SSF55770. 1 hit.
    PROSITEiPS00414. PROFILIN. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform IIa (identifier: P35080-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAGWQSYVDN LMCDGCCQEA AIVGYCDAKY VWAATAGGVF QSITPIEIDM    50
    IVGKDREGFF TNGLTLGAKK CSVIRDSLYV DGDCTMDIRT KSQGGEPTYN 100
    VAVGRAGRVL VFVMGKEGVH GGGLNKKAYS MAKYLRDSGF 140
    Length:140
    Mass (Da):15,046
    Last modified:January 23, 2007 - v3
    Checksum:iF43884E1427C9A99
    GO
    Isoform IIb (identifier: P35080-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         109-140: VLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF → ALVIVMGKEGVHGGTLNKKAYELALYLRRSDV

    Show »
    Length:140
    Mass (Da):15,088
    Checksum:iB4CAC8A1ED8C658B
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti65 – 651T → A in AAH18049. (PubMed:15489334)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei109 – 14032VLVFV…RDSGF → ALVIVMGKEGVHGGTLNKKA YELALYLRRSDV in isoform IIb. 3 PublicationsVSP_005217Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L10678 mRNA. Translation: AAA03022.1.
    AF228738 mRNA. Translation: AAG24949.1.
    AK311780 mRNA. Translation: BAG34723.1.
    AK311782 mRNA. Translation: BAG34725.1.
    CH471052 Genomic DNA. Translation: EAW78850.1.
    BC002964 mRNA. No translation available.
    CH471052 Genomic DNA. Translation: EAW78852.1.
    BC018049 mRNA. Translation: AAH18049.1.
    BC043646 mRNA. Translation: AAH43646.1.
    BC095444 mRNA. Translation: AAH95444.1.
    CCDSiCCDS3148.1. [P35080-1]
    CCDS46934.1. [P35080-2]
    PIRiS36804.
    RefSeqiNP_002619.1. NM_002628.4. [P35080-2]
    NP_444252.1. NM_053024.3. [P35080-1]
    UniGeneiHs.91747.

    Genome annotation databases

    EnsembliENST00000239940; ENSP00000239940; ENSG00000070087. [P35080-1]
    ENST00000452853; ENSP00000410464; ENSG00000070087. [P35080-2]
    GeneIDi5217.
    KEGGihsa:5217.
    UCSCiuc003ext.1. human. [P35080-1]
    uc003exu.1. human. [P35080-2]

    Polymorphism databases

    DMDMi20178322.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L10678 mRNA. Translation: AAA03022.1 .
    AF228738 mRNA. Translation: AAG24949.1 .
    AK311780 mRNA. Translation: BAG34723.1 .
    AK311782 mRNA. Translation: BAG34725.1 .
    CH471052 Genomic DNA. Translation: EAW78850.1 .
    BC002964 mRNA. No translation available.
    CH471052 Genomic DNA. Translation: EAW78852.1 .
    BC018049 mRNA. Translation: AAH18049.1 .
    BC043646 mRNA. Translation: AAH43646.1 .
    BC095444 mRNA. Translation: AAH95444.1 .
    CCDSi CCDS3148.1. [P35080-1 ]
    CCDS46934.1. [P35080-2 ]
    PIRi S36804.
    RefSeqi NP_002619.1. NM_002628.4. [P35080-2 ]
    NP_444252.1. NM_053024.3. [P35080-1 ]
    UniGenei Hs.91747.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1D1J X-ray 2.20 A/B/C/D 2-138 [» ]
    ProteinModelPortali P35080.
    SMRi P35080. Positions 2-140.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 111238. 32 interactions.
    IntActi P35080. 26 interactions.
    MINTi MINT-1370857.
    STRINGi 9606.ENSP00000239940.

    PTM databases

    PhosphoSitei P35080.

    Polymorphism databases

    DMDMi 20178322.

    2D gel databases

    REPRODUCTION-2DPAGE P35080.

    Proteomic databases

    MaxQBi P35080.
    PaxDbi P35080.
    PRIDEi P35080.

    Protocols and materials databases

    DNASUi 5217.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000239940 ; ENSP00000239940 ; ENSG00000070087 . [P35080-1 ]
    ENST00000452853 ; ENSP00000410464 ; ENSG00000070087 . [P35080-2 ]
    GeneIDi 5217.
    KEGGi hsa:5217.
    UCSCi uc003ext.1. human. [P35080-1 ]
    uc003exu.1. human. [P35080-2 ]

    Organism-specific databases

    CTDi 5217.
    GeneCardsi GC03M149682.
    HGNCi HGNC:8882. PFN2.
    HPAi CAB037073.
    HPA035611.
    MIMi 176590. gene.
    neXtProti NX_P35080.
    PharmGKBi PA33220.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG295243.
    HOGENOMi HOG000171592.
    HOVERGENi HBG053683.
    InParanoidi P35080.
    KOi K05759.
    OMAi LAYHVAC.
    OrthoDBi EOG7JMGGT.
    PhylomeDBi P35080.
    TreeFami TF331744.

    Enzyme and pathway databases

    Reactomei REACT_19351. Signaling by Robo receptor.

    Miscellaneous databases

    ChiTaRSi PFN2. human.
    EvolutionaryTracei P35080.
    GeneWikii PFN2.
    GenomeRNAii 5217.
    NextBioi 20176.
    PROi P35080.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P35080.
    Bgeei P35080.
    CleanExi HS_PFN2.
    Genevestigatori P35080.

    Family and domain databases

    InterProi IPR005454. Profilin_chordates.
    IPR027310. Profilin_CS.
    IPR005455. Profilin_eukaryotes/bac.
    [Graphical view ]
    Pfami PF00235. Profilin. 1 hit.
    [Graphical view ]
    PRINTSi PR00392. PROFILIN.
    PR01639. PROFILINMAML.
    SMARTi SM00392. PROF. 1 hit.
    [Graphical view ]
    SUPFAMi SSF55770. SSF55770. 1 hit.
    PROSITEi PS00414. PROFILIN. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and expression of a novel human profilin variant, profilin II."
      Honore B., Madsen P.S., Andersen A.H., Leffers H.
      FEBS Lett. 330:151-155(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM IIB).
      Tissue: Epithelium.
    2. "Profilin II is alternatively spliced, resulting in profilin isoforms that are differentially expressed and have distinct biochemical properties."
      Lambrechts A., Braun A., Jonckheere V., Aszodi A., Lanier L.M., Robbens J., Van Colen I., Vandekerckhove J., Faessler R., Ampe C.
      Mol. Cell. Biol. 20:8209-8219(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM IIA).
      Tissue: Brain.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS IIA AND IIB).
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS IIA AND IIB).
      Tissue: Brain, Lung and Spinal cord.
    6. Lubec G., Chen W.-Q., Sun Y.
      Submitted (DEC-2008) to UniProtKB
      Cited for: PROTEIN SEQUENCE OF 30-69; 76-89; 92-105 AND 109-116, IDENTIFICATION BY MASS SPECTROMETRY.
      Tissue: Fetal brain cortex.
    7. "Distinct biochemical characteristics of the two human profilin isoforms."
      Gieselmann R., Kwiatkowski D.J., Janmey P.A., Witke W.
      Eur. J. Biochem. 229:621-628(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: CHARACTERIZATION.
    8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    9. "Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features."
      Bienvenut W.V., Sumpton D., Martinez A., Lilla S., Espagne C., Meinnel T., Giglione C.
      Mol. Cell. Proteomics 11:M111.015131-M111.015131(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].
    10. "X-ray structure determination of human profilin II: a comparative structural analysis of human profilins."
      Nodelman I.M., Bowman G.D., Lindberg U., Schutt C.E.
      J. Mol. Biol. 294:1271-1285(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (2.2 ANGSTROMS).

    Entry informationi

    Entry nameiPROF2_HUMAN
    AccessioniPrimary (citable) accession number: P35080
    Secondary accession number(s): B2R4C8
    , D3DNI4, Q4VBQ4, Q8WVF9, Q9HBK2
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 1, 1994
    Last sequence update: January 23, 2007
    Last modified: October 1, 2014
    This is version 152 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human chromosome 3
      Human chromosome 3: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3