Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Profilin-2

Gene

PFN2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG.

GO - Molecular functioni

  1. actin monomer binding Source: UniProtKB
  2. adenyl-nucleotide exchange factor activity Source: UniProtKB
  3. phosphatidylinositol-4,5-bisphosphate binding Source: UniProtKB

GO - Biological processi

  1. actin cytoskeleton organization Source: InterPro
  2. negative regulation of actin filament polymerization Source: UniProtKB
  3. negative regulation of epithelial cell migration Source: UniProtKB
  4. negative regulation of ruffle assembly Source: UniProtKB
  5. positive regulation of actin filament bundle assembly Source: UniProtKB
  6. positive regulation of actin filament polymerization Source: UniProtKB
  7. positive regulation of ATPase activity Source: UniProtKB
  8. positive regulation of peptidyl-serine phosphorylation Source: UniProtKB
  9. positive regulation of stress fiber assembly Source: UniProtKB
  10. regulation of synaptic vesicle exocytosis Source: Ensembl
Complete GO annotation...

Keywords - Ligandi

Actin-binding

Enzyme and pathway databases

ReactomeiREACT_19351. Signaling by Robo receptor.

Names & Taxonomyi

Protein namesi
Recommended name:
Profilin-2
Alternative name(s):
Profilin II
Gene namesi
Name:PFN2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 3

Organism-specific databases

HGNCiHGNC:8882. PFN2.

Subcellular locationi

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB-KW
  2. cytoskeleton Source: UniProtKB-SubCell
  3. extracellular vesicular exosome Source: UniProtKB
  4. terminal bouton Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA33220.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11Removed1 Publication
Chaini2 – 140139Profilin-2PRO_0000199575Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylalanine1 Publication

Keywords - PTMi

Acetylation

Proteomic databases

MaxQBiP35080.
PaxDbiP35080.
PRIDEiP35080.

2D gel databases

REPRODUCTION-2DPAGEP35080.

PTM databases

PhosphoSiteiP35080.

Expressioni

Tissue specificityi

Highly expressed in brain, skeletal muscle and kidney and less strongly in heart, placenta, lung and liver.

Gene expression databases

BgeeiP35080.
CleanExiHS_PFN2.
ExpressionAtlasiP35080. baseline and differential.
GenevestigatoriP35080.

Organism-specific databases

HPAiCAB037073.
HPA035611.

Interactioni

Subunit structurei

Occurs in many kinds of cells as a complex with monomeric actin in a 1:1 ratio.

Binary interactionsi

WithEntry#Exp.IntActNotes
GOLGB1Q147892EBI-473138,EBI-709973
HTTP428584EBI-473138,EBI-466029
WaslO088163EBI-473138,EBI-6142604From a different organism.

Protein-protein interaction databases

BioGridi111238. 33 interactions.
IntActiP35080. 27 interactions.
MINTiMINT-1370857.
STRINGi9606.ENSP00000239940.

Structurei

Secondary structure

1
140
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi5 – 117Combined sources
Beta strandi17 – 248Combined sources
Beta strandi26 – 283Combined sources
Beta strandi30 – 345Combined sources
Helixi40 – 423Combined sources
Helixi45 – 528Combined sources
Helixi58 – 625Combined sources
Beta strandi64 – 663Combined sources
Beta strandi69 – 8012Combined sources
Beta strandi85 – 906Combined sources
Beta strandi93 – 953Combined sources
Beta strandi100 – 1056Combined sources
Beta strandi107 – 1159Combined sources
Helixi121 – 13717Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1D1JX-ray2.20A/B/C/D2-138[»]
ProteinModelPortaliP35080.
SMRiP35080. Positions 2-140.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP35080.

Family & Domainsi

Sequence similaritiesi

Belongs to the profilin family.Curated

Phylogenomic databases

eggNOGiNOG295243.
GeneTreeiENSGT00390000010143.
HOGENOMiHOG000171592.
HOVERGENiHBG053683.
InParanoidiP35080.
KOiK05759.
OMAiNITIGRA.
OrthoDBiEOG7JMGGT.
PhylomeDBiP35080.
TreeFamiTF331744.

Family and domain databases

InterProiIPR005455. PFN.
IPR029891. PFN2.
IPR005454. Profilin1/2/3_vertebrate.
IPR027310. Profilin_CS.
[Graphical view]
PANTHERiPTHR13936:SF13. PTHR13936:SF13. 1 hit.
PfamiPF00235. Profilin. 1 hit.
[Graphical view]
PRINTSiPR00392. PROFILIN.
PR01639. PROFILINMAML.
SMARTiSM00392. PROF. 1 hit.
[Graphical view]
SUPFAMiSSF55770. SSF55770. 1 hit.
PROSITEiPS00414. PROFILIN. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform IIa (identifier: P35080-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAGWQSYVDN LMCDGCCQEA AIVGYCDAKY VWAATAGGVF QSITPIEIDM
60 70 80 90 100
IVGKDREGFF TNGLTLGAKK CSVIRDSLYV DGDCTMDIRT KSQGGEPTYN
110 120 130 140
VAVGRAGRVL VFVMGKEGVH GGGLNKKAYS MAKYLRDSGF
Length:140
Mass (Da):15,046
Last modified:January 23, 2007 - v3
Checksum:iF43884E1427C9A99
GO
Isoform IIb (identifier: P35080-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     109-140: VLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF → ALVIVMGKEGVHGGTLNKKAYELALYLRRSDV

Show »
Length:140
Mass (Da):15,088
Checksum:iB4CAC8A1ED8C658B
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti65 – 651T → A in AAH18049 (PubMed:15489334).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei109 – 14032VLVFV…RDSGF → ALVIVMGKEGVHGGTLNKKA YELALYLRRSDV in isoform IIb. 3 PublicationsVSP_005217Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L10678 mRNA. Translation: AAA03022.1.
AF228738 mRNA. Translation: AAG24949.1.
AK311780 mRNA. Translation: BAG34723.1.
AK311782 mRNA. Translation: BAG34725.1.
CH471052 Genomic DNA. Translation: EAW78850.1.
BC002964 mRNA. No translation available.
CH471052 Genomic DNA. Translation: EAW78852.1.
BC018049 mRNA. Translation: AAH18049.1.
BC043646 mRNA. Translation: AAH43646.1.
BC095444 mRNA. Translation: AAH95444.1.
CCDSiCCDS3148.1. [P35080-1]
CCDS46934.1. [P35080-2]
PIRiS36804.
RefSeqiNP_002619.1. NM_002628.4. [P35080-2]
NP_444252.1. NM_053024.3. [P35080-1]
UniGeneiHs.91747.

Genome annotation databases

EnsembliENST00000239940; ENSP00000239940; ENSG00000070087. [P35080-1]
ENST00000452853; ENSP00000410464; ENSG00000070087. [P35080-2]
GeneIDi5217.
KEGGihsa:5217.
UCSCiuc003ext.1. human. [P35080-1]
uc003exu.1. human. [P35080-2]

Polymorphism databases

DMDMi20178322.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L10678 mRNA. Translation: AAA03022.1.
AF228738 mRNA. Translation: AAG24949.1.
AK311780 mRNA. Translation: BAG34723.1.
AK311782 mRNA. Translation: BAG34725.1.
CH471052 Genomic DNA. Translation: EAW78850.1.
BC002964 mRNA. No translation available.
CH471052 Genomic DNA. Translation: EAW78852.1.
BC018049 mRNA. Translation: AAH18049.1.
BC043646 mRNA. Translation: AAH43646.1.
BC095444 mRNA. Translation: AAH95444.1.
CCDSiCCDS3148.1. [P35080-1]
CCDS46934.1. [P35080-2]
PIRiS36804.
RefSeqiNP_002619.1. NM_002628.4. [P35080-2]
NP_444252.1. NM_053024.3. [P35080-1]
UniGeneiHs.91747.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1D1JX-ray2.20A/B/C/D2-138[»]
ProteinModelPortaliP35080.
SMRiP35080. Positions 2-140.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111238. 33 interactions.
IntActiP35080. 27 interactions.
MINTiMINT-1370857.
STRINGi9606.ENSP00000239940.

PTM databases

PhosphoSiteiP35080.

Polymorphism databases

DMDMi20178322.

2D gel databases

REPRODUCTION-2DPAGEP35080.

Proteomic databases

MaxQBiP35080.
PaxDbiP35080.
PRIDEiP35080.

Protocols and materials databases

DNASUi5217.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000239940; ENSP00000239940; ENSG00000070087. [P35080-1]
ENST00000452853; ENSP00000410464; ENSG00000070087. [P35080-2]
GeneIDi5217.
KEGGihsa:5217.
UCSCiuc003ext.1. human. [P35080-1]
uc003exu.1. human. [P35080-2]

Organism-specific databases

CTDi5217.
GeneCardsiGC03M149682.
HGNCiHGNC:8882. PFN2.
HPAiCAB037073.
HPA035611.
MIMi176590. gene.
neXtProtiNX_P35080.
PharmGKBiPA33220.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG295243.
GeneTreeiENSGT00390000010143.
HOGENOMiHOG000171592.
HOVERGENiHBG053683.
InParanoidiP35080.
KOiK05759.
OMAiNITIGRA.
OrthoDBiEOG7JMGGT.
PhylomeDBiP35080.
TreeFamiTF331744.

Enzyme and pathway databases

ReactomeiREACT_19351. Signaling by Robo receptor.

Miscellaneous databases

ChiTaRSiPFN2. human.
EvolutionaryTraceiP35080.
GeneWikiiPFN2.
GenomeRNAii5217.
NextBioi20176.
PROiP35080.
SOURCEiSearch...

Gene expression databases

BgeeiP35080.
CleanExiHS_PFN2.
ExpressionAtlasiP35080. baseline and differential.
GenevestigatoriP35080.

Family and domain databases

InterProiIPR005455. PFN.
IPR029891. PFN2.
IPR005454. Profilin1/2/3_vertebrate.
IPR027310. Profilin_CS.
[Graphical view]
PANTHERiPTHR13936:SF13. PTHR13936:SF13. 1 hit.
PfamiPF00235. Profilin. 1 hit.
[Graphical view]
PRINTSiPR00392. PROFILIN.
PR01639. PROFILINMAML.
SMARTiSM00392. PROF. 1 hit.
[Graphical view]
SUPFAMiSSF55770. SSF55770. 1 hit.
PROSITEiPS00414. PROFILIN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and expression of a novel human profilin variant, profilin II."
    Honore B., Madsen P.S., Andersen A.H., Leffers H.
    FEBS Lett. 330:151-155(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM IIB).
    Tissue: Epithelium.
  2. "Profilin II is alternatively spliced, resulting in profilin isoforms that are differentially expressed and have distinct biochemical properties."
    Lambrechts A., Braun A., Jonckheere V., Aszodi A., Lanier L.M., Robbens J., Van Colen I., Vandekerckhove J., Faessler R., Ampe C.
    Mol. Cell. Biol. 20:8209-8219(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM IIA).
    Tissue: Brain.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS IIA AND IIB).
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS IIA AND IIB).
    Tissue: Brain, Lung and Spinal cord.
  6. Lubec G., Chen W.-Q., Sun Y.
    Submitted (DEC-2008) to UniProtKB
    Cited for: PROTEIN SEQUENCE OF 30-69; 76-89; 92-105 AND 109-116, IDENTIFICATION BY MASS SPECTROMETRY.
    Tissue: Fetal brain cortex.
  7. "Distinct biochemical characteristics of the two human profilin isoforms."
    Gieselmann R., Kwiatkowski D.J., Janmey P.A., Witke W.
    Eur. J. Biochem. 229:621-628(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: CHARACTERIZATION.
  8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  9. "Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features."
    Bienvenut W.V., Sumpton D., Martinez A., Lilla S., Espagne C., Meinnel T., Giglione C.
    Mol. Cell. Proteomics 11:M111.015131-M111.015131(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].
  10. "X-ray structure determination of human profilin II: a comparative structural analysis of human profilins."
    Nodelman I.M., Bowman G.D., Lindberg U., Schutt C.E.
    J. Mol. Biol. 294:1271-1285(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.2 ANGSTROMS).

Entry informationi

Entry nameiPROF2_HUMAN
AccessioniPrimary (citable) accession number: P35080
Secondary accession number(s): B2R4C8
, D3DNI4, Q4VBQ4, Q8WVF9, Q9HBK2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: January 23, 2007
Last modified: March 4, 2015
This is version 156 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.