Reviewed,
UniProtKB/Swiss-Prot P35030 (TRY3_HUMAN)
Last modified
June 16, 2009.
Version 95.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Trypsin-3 EC=3.4.21.4 Alternative name(s): Trypsin III Brain trypsinogen Mesotrypsinogen Trypsin IV Serine protease 3 Serine protease 4 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 304 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Catalytic activity | Preferential cleavage: Arg-|-Xaa, Lys-|-Xaa. |
| Cofactor | Binds 1 calcium ion per subunit. |
| Subcellular location | |
| Tissue specificity | Pancreas and brain. |
| Sequence similarities | Belongs to the peptidase S1 family. Contains 1 peptidase S1 domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Digestion |
| Cellular component | Secreted |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Signal |
| Ligand | Calcium Metal-binding |
| Molecular function | Hydrolase Protease Serine protease |
| PTM | Disulfide bond Sulfation Zymogen |
| Technical term | 3D-structure |
| Gene Ontology (GO) | |
| Biological process | digestion Ref.2 Traceable author statement. Source: UniProtKB endothelial cell migrationInferred from mutant phenotype. Source: UniProtKB proteolysis Ref.1 Ref.2Inferred from direct assay. Source: UniProtKB zymogen activationInferred from direct assay. Source: UniProtKB |
| Cellular component | extracellular space Inferred from direct assay. Source: UniProtKB |
| Molecular function | calcium ion binding Inferred from direct assay. Source: UniProtKB protein bindingInferred from physical interaction. Source: UniProtKB serine-type endopeptidase activityInferred from direct assay. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform A (identifier: P35030-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform B (identifier: P35030-2) The sequence of this isoform differs from the canonical sequence as follows: 1-45: MCGPDDRCPARWPGPGRAVKCGKGLAAARPGRVERGGAQRGGAGL → M | ||||||
| Isoform C (identifier: P35030-3) The sequence of this isoform differs from the canonical sequence as follows: 1-70: MCGPDDRCPA...DADGCEALGT → MNPFLILAFVGAA |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – ? | Potential | |||||||||||||||||||||||||||||||||||||||||||||
| Propeptide | ? – 80 | Activation peptide | PRO_0000028201 | ||||||||||||||||||||||||||||||||||||||||||||
| Chain | 81 – 304 | 224 | Trypsin-3 | PRO_0000028202 | |||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 81 – 301 | 221 | Peptidase S1 | ||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 120 | 1 | Charge relay system | ||||||||||||||||||||||||||||||||||||||||||||
| Active site | 164 | 1 | Charge relay system | ||||||||||||||||||||||||||||||||||||||||||||
| Active site | 257 | 1 | Charge relay system | ||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 132 | 1 | Calcium | ||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 134 | 1 | Calcium; via carbonyl oxygen | ||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 137 | 1 | Calcium; via carbonyl oxygen | ||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 142 | 1 | Calcium | ||||||||||||||||||||||||||||||||||||||||||||
| Site | 251 | 1 | Required for specificity By similarity | ||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 211 | 1 | Sulfotyrosine By similarity | ||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 87 ↔ 217 | ||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 105 ↔ 121 | ||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 196 ↔ 263 | ||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 228 ↔ 242 | ||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 253 ↔ 277 | ||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 70 | 70 | MCGPD…EALGT → MNPFLILAFVGAA in isoform C. | VSP_005410 | |||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 45 | 45 | MCGPD…GGAGL → M in isoform B. | VSP_005409 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 188 | 1 | T → A: dbSNP rs855581. Ref.1 Ref.2 Ref.3 | VAR_046794 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 232 | 1 | Y → C: dbSNP rs1048379. Ref.2 | VAR_046795 | |||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 89 | 1 | Missing in CAA50484. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 224 – 225 | 2 | TQ → RE in CAA33527. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 253 – 254 | 2 | CQ → WK in CAA33527. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 95 – 109 | 15 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 111 – 117 | 7 | |||||||||||||||||||||||||||||||||||||||||||||
| Helix | 119 – 121 | 3 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 127 – 131 | 5 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 133 – 137 | 5 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 143 – 152 | 10 | |||||||||||||||||||||||||||||||||||||||||||||
| Turn | 158 – 160 | 3 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 166 – 172 | 7 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 195 – 201 | 7 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 206 – 208 | 3 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 216 – 222 | 7 | |||||||||||||||||||||||||||||||||||||||||||||
| Helix | 225 – 231 | 7 | |||||||||||||||||||||||||||||||||||||||||||||
| Turn | 233 – 235 | 3 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 240 – 244 | 5 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 260 – 263 | 4 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 266 – 273 | 8 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 275 – 279 | 5 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 284 – 288 | 5 | |||||||||||||||||||||||||||||||||||||||||||||
| Helix | 289 – 292 | 4 | |||||||||||||||||||||||||||||||||||||||||||||
| Helix | 293 – 301 | 9 | |||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning of the cDNA encoding human brain trypsinogen and characterization of its product." Wiegand U., Corbach S., Minn A., Kang J., Mueller-Hill B. Gene 136:167-175(1993) [PubMed: 8294000] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A AND B), VARIANT ALA-188. Tissue: Brain. |
| [2] | "Nucleotide sequence of the human pancreatic trypsinogen III cDNA." Tani T., Kawashima I., Mita K., Takiguchi Y. Nucleic Acids Res. 18:1631-1631(1990) [PubMed: 2326201] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM C), VARIANTS ALA-188 AND CYS-232. Tissue: Pancreas. |
| [3] | Fukuoka S. Submitted (FEB-1995) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM C), VARIANT ALA-188. |
| [4] | "DNA sequence and analysis of human chromosome 9." Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L. Dunham I.Nature 429:369-374(2004) [PubMed: 15164053] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "Crystal structure reveals basis for the inhibitor resistance of human brain trypsin." Katona G., Berglund G.I., Hajdu J., Graf L., Szilagyi L. J. Mol. Biol. 315:1209-1218(2002) [PubMed: 11827488] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.7 ANGSTROMS) (ISOFORM A). |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| X72781 mRNA. Translation: CAB58178.1. X71345 mRNA. Translation: CAA50484.1. X15505 mRNA. Translation: CAA33527.1. D45417 mRNA. Translation: BAA08257.1. AL356489, AL139113, AL358573 Genomic DNA. Translation: CAH69873.1. AL358573, AL139113, AL356489 Genomic DNA. Translation: CAI39515.1. AL139113, AL356489, AL358573 Genomic DNA. Translation: CAI39658.1. | |||||||||||||||||||
| IPI | IPI00015614. IPI00220839. IPI00843764. | ||||||||||||||||||
| PIR | S12764. S33496. | ||||||||||||||||||
| UniGene | Hs.654513 | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| |||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein family/group databases | |||||||||||||||||||
| MEROPS | S01.174. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PRIDE | P35030. | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENSG00000010438. Homo sapiens. [Contig view] | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| GeneCards | GC09P033740. | ||||||||||||||||||
| H-InvDB | HIX0034806. | ||||||||||||||||||
| HGNC | HGNC:9486. PRSS3. | ||||||||||||||||||
| PharmGKB | PA33838. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| HOGENOM | P35030. | ||||||||||||||||||
| HOVERGEN | P35030. | ||||||||||||||||||
| OMA | P35030. RCPARWP. | ||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||
| BRENDA | 3.4.21.4. 247. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | P35030. | ||||||||||||||||||
| Bgee | P35030. | ||||||||||||||||||
| CleanEx | HS_PRSS3. | ||||||||||||||||||
| GermOnline | ENSG00000010438. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR018114. Peptidase_S1/S6_AS. IPR001254. Peptidase_S1_S6. IPR001314. Peptidase_S1A. [Graphical view] | ||||||||||||||||||
| Pfam | PF00089. Trypsin. 1 hit. [Graphical view] | ||||||||||||||||||
| PRINTS | PR00722. CHYMOTRYPSIN. | ||||||||||||||||||
| SMART | SM00020. Tryp_SPc. 1 hit. [Graphical view] | ||||||||||||||||||
| PROSITE | PS50240. TRYPSIN_DOM. 1 hit. PS00134. TRYPSIN_HIS. 1 hit. PS00135. TRYPSIN_SER. False negative. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other Resources | |||||||||||||||||||
| NextBio | 21934. | ||||||||||||||||||
Entry information
| Entry name | TRY3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P35030 Secondary accession number(s): P15951 Q9UQV3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 9 Human chromosome 9: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| Peptidase families Classification of peptidase families and list of entries |
| SIMILARITY comments Index of protein domains and families |

Clusters with


