Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P35030

- TRY3_HUMAN

UniProt

P35030 - TRY3_HUMAN

Protein

Trypsin-3

Gene

PRSS3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 150 (01 Oct 2014)
      Sequence version 2 (14 Oct 2008)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Digestive protease specialized for the degradation of trypsin inhibitors. In the ileum, may be involved in defensin processing, including DEFA5.2 Publications

    Catalytic activityi

    Preferential cleavage: Arg-|-Xaa, Lys-|-Xaa.

    Cofactori

    Binds 1 calcium ion per subunit.

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei120 – 1201Charge relay system
    Metal bindingi132 – 1321Calcium
    Metal bindingi134 – 1341Calcium; via carbonyl oxygen
    Metal bindingi137 – 1371Calcium; via carbonyl oxygen
    Metal bindingi142 – 1421Calcium
    Active sitei164 – 1641Charge relay system
    Sitei251 – 2511Required for specificityBy similarity
    Active sitei257 – 2571Charge relay system

    GO - Molecular functioni

    1. calcium ion binding Source: UniProtKB
    2. protein binding Source: UniProtKB
    3. serine-type endopeptidase activity Source: UniProtKB
    4. serine-type peptidase activity Source: UniProtKB

    GO - Biological processi

    1. cobalamin metabolic process Source: Reactome
    2. digestion Source: UniProtKB
    3. endothelial cell migration Source: UniProtKB
    4. innate immune response Source: Reactome
    5. proteolysis Source: GOC
    6. small molecule metabolic process Source: Reactome
    7. vitamin metabolic process Source: Reactome
    8. water-soluble vitamin metabolic process Source: Reactome
    9. zymogen activation Source: UniProtKB

    Keywords - Molecular functioni

    Hydrolase, Protease, Serine protease

    Keywords - Biological processi

    Digestion

    Keywords - Ligandi

    Calcium, Metal-binding

    Enzyme and pathway databases

    ReactomeiREACT_115574. Alpha-defensins.
    REACT_163862. Cobalamin (Cbl, vitamin B12) transport and metabolism.

    Protein family/group databases

    MEROPSiS01.174.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Trypsin-3 (EC:3.4.21.4)
    Alternative name(s):
    Brain trypsinogen
    Mesotrypsinogen
    Serine protease 3
    Serine protease 4
    Trypsin III
    Trypsin IV
    Gene namesi
    Name:PRSS3
    Synonyms:PRSS4, TRY3, TRY4
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 9

    Organism-specific databases

    HGNCiHGNC:9486. PRSS3.

    Subcellular locationi

    GO - Cellular componenti

    1. extracellular region Source: Reactome
    2. extracellular space Source: UniProtKB
    3. extracellular vesicular exosome Source: UniProt

    Keywords - Cellular componenti

    Secreted

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA33838.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Propeptidei? – 80Activation peptidePRO_0000028201
    Signal peptidei1 – ?Sequence Analysis
    Chaini81 – 304224Trypsin-3PRO_0000028202Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi87 ↔ 217
    Disulfide bondi105 ↔ 121
    Disulfide bondi196 ↔ 263
    Modified residuei211 – 2111SulfotyrosineBy similarity
    Disulfide bondi228 ↔ 242
    Disulfide bondi253 ↔ 277

    Keywords - PTMi

    Disulfide bond, Sulfation, Zymogen

    Proteomic databases

    MaxQBiP35030.
    PaxDbiP35030.
    PRIDEiP35030.

    PTM databases

    PhosphoSiteiP35030.

    Expressioni

    Tissue specificityi

    Expressed in pancreas and brain. Also expressed in Paneth cells, at the base of small intestinal crypts.1 Publication

    Gene expression databases

    ArrayExpressiP35030.
    BgeeiP35030.
    CleanExiHS_PRSS3.
    GenevestigatoriP35030.

    Interactioni

    Protein-protein interaction databases

    BioGridi111628. 4 interactions.
    IntActiP35030. 4 interactions.
    STRINGi9606.ENSP00000354280.

    Structurei

    Secondary structure

    1
    304
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi89 – 913
    Beta strandi95 – 11117
    Beta strandi114 – 1174
    Helixi119 – 1213
    Beta strandi127 – 1315
    Beta strandi133 – 1375
    Beta strandi143 – 15210
    Turni158 – 1603
    Beta strandi166 – 1727
    Beta strandi177 – 1804
    Beta strandi195 – 2017
    Beta strandi206 – 2083
    Beta strandi216 – 2227
    Helixi225 – 2317
    Turni233 – 2353
    Beta strandi240 – 2445
    Beta strandi246 – 2494
    Turni254 – 2585
    Beta strandi260 – 2634
    Beta strandi266 – 2738
    Beta strandi275 – 2784
    Beta strandi284 – 2885
    Helixi289 – 2924
    Helixi293 – 30210

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1H4WX-ray1.70A81-304[»]
    2R9PX-ray1.40A/B/C/D81-304[»]
    3L33X-ray2.48A/B/C/D81-304[»]
    3L3TX-ray2.38A/B/C/D81-304[»]
    3P92X-ray1.60A81-304[»]
    3P95X-ray1.30A81-304[»]
    4DG4X-ray1.40A/B/D/G81-304[»]
    ProteinModelPortaliP35030.
    SMRiP35030. Positions 81-304.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiP35030.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini81 – 301221Peptidase S1PROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Belongs to the peptidase S1 family.PROSITE-ProRule annotation
    Contains 1 peptidase S1 domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Signal

    Phylogenomic databases

    eggNOGiCOG5640.
    HOGENOMiHOG000251820.
    HOVERGENiHBG013304.
    InParanoidiP35030.
    KOiK01312.
    OMAiWIQATID.
    OrthoDBiEOG75B84T.
    PhylomeDBiP35030.
    TreeFamiTF331065.

    Family and domain databases

    InterProiIPR001254. Peptidase_S1.
    IPR018114. Peptidase_S1_AS.
    IPR001314. Peptidase_S1A.
    IPR009003. Trypsin-like_Pept_dom.
    [Graphical view]
    PfamiPF00089. Trypsin. 1 hit.
    [Graphical view]
    PRINTSiPR00722. CHYMOTRYPSIN.
    SMARTiSM00020. Tryp_SPc. 1 hit.
    [Graphical view]
    SUPFAMiSSF50494. SSF50494. 1 hit.
    PROSITEiPS50240. TRYPSIN_DOM. 1 hit.
    PS00134. TRYPSIN_HIS. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P35030-1) [UniParc]FASTAAdd to Basket

    Also known as: A

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MCGPDDRCPA RWPGPGRAVK CGKGLAAARP GRVERGGAQR GGAGLELHPL    50
    LGGRTWRAAR DADGCEALGT VAVPFDDDDK IVGGYTCEEN SLPYQVSLNS 100
    GSHFCGGSLI SEQWVVSAAH CYKTRIQVRL GEHNIKVLEG NEQFINAAKI 150
    IRHPKYNRDT LDNDIMLIKL SSPAVINARV STISLPTTPP AAGTECLISG 200
    WGNTLSFGAD YPDELKCLDA PVLTQAECKA SYPGKITNSM FCVGFLEGGK 250
    DSCQRDSGGP VVCNGQLQGV VSWGHGCAWK NRPGVYTKVY NYVDWIKDTI 300
    AANS 304
    Length:304
    Mass (Da):32,529
    Last modified:October 14, 2008 - v2
    Checksum:i4C4303C310B7BFFC
    GO
    Isoform 2 (identifier: P35030-2) [UniParc]FASTAAdd to Basket

    Also known as: B

    The sequence of this isoform differs from the canonical sequence as follows:
         1-45: MCGPDDRCPARWPGPGRAVKCGKGLAAARPGRVERGGAQRGGAGL → M

    Show »
    Length:260
    Mass (Da):28,161
    Checksum:iCD8AA6E8072BCE56
    GO
    Isoform 3 (identifier: P35030-3) [UniParc]FASTAAdd to Basket

    Also known as: C

    The sequence of this isoform differs from the canonical sequence as follows:
         1-70: MCGPDDRCPA...DADGCEALGT → MNPFLILAFVGAA

    Show »
    Length:247
    Mass (Da):26,727
    Checksum:i01563656780A6607
    GO
    Isoform 4 (identifier: P35030-4) [UniParc]FASTAAdd to Basket

    Also known as: D

    The sequence of this isoform differs from the canonical sequence as follows:
         1-71: MCGPDDRCPA...ADGCEALGTV → MHMRETSGFTLKKGRSAPLVFHPPDALI

    Show »
    Length:261
    Mass (Da):28,402
    Checksum:i5908225118767A4A
    GO
    Isoform 5 (identifier: P35030-5) [UniParc]FASTAAdd to Basket

    Also known as: E

    The sequence of this isoform differs from the canonical sequence as follows:
         1-70: MCGPDDRCPA...DADGCEALGT → MGPAGE

    Show »
    Length:240
    Mass (Da):25,924
    Checksum:iE8DF46CFF536DB74
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti89 – 891Missing in CAA50484. (PubMed:8294000)Curated
    Sequence conflicti224 – 2252TQ → RE in CAA33527. (PubMed:2326201)Curated
    Sequence conflicti253 – 2542CQ → WK in CAA33527. (PubMed:2326201)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti174 – 1741A → V.
    Corresponds to variant rs11547028 [ dbSNP | Ensembl ].
    VAR_067459
    Natural varianti188 – 1881T → A.7 Publications
    Corresponds to variant rs855581 [ dbSNP | Ensembl ].
    VAR_046794
    Natural varianti224 – 2241T → S.
    Corresponds to variant rs1063273 [ dbSNP | Ensembl ].
    VAR_059788
    Natural varianti232 – 2321Y → C.1 Publication
    Corresponds to variant rs1048379 [ dbSNP | Ensembl ].
    VAR_046795

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 7171MCGPD…ALGTV → MHMRETSGFTLKKGRSAPLV FHPPDALI in isoform 4. CuratedVSP_005409Add
    BLAST
    Alternative sequencei1 – 7070MCGPD…EALGT → MNPFLILAFVGAA in isoform 3. 3 PublicationsVSP_005410Add
    BLAST
    Alternative sequencei1 – 7070MCGPD…EALGT → MGPAGE in isoform 5. 1 PublicationVSP_053779Add
    BLAST
    Alternative sequencei1 – 4545MCGPD…GGAGL → M in isoform 2. 1 PublicationVSP_042074Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X72781 mRNA. Translation: CAB58178.1.
    X71345 mRNA. Translation: CAA50484.1.
    X15505 mRNA. Translation: CAA33527.1.
    D45417 mRNA. Translation: BAA08257.1.
    AF029308 Genomic DNA. Translation: AAC13322.1.
    AB298285 mRNA. Translation: BAF80324.1.
    AB298286 mRNA. Translation: BAF80325.1.
    AL139113 Genomic DNA. No translation available.
    AL356489 Genomic DNA. No translation available.
    AL358573 Genomic DNA. No translation available.
    CH471071 Genomic DNA. Translation: EAW58482.1.
    CH471071 Genomic DNA. Translation: EAW58484.1.
    BC069476 mRNA. Translation: AAH69476.1.
    BC069494 mRNA. Translation: AAH69494.1.
    CCDSiCCDS47958.1. [P35030-1]
    CCDS56570.1. [P35030-5]
    CCDS56571.1. [P35030-4]
    CCDS6545.1. [P35030-3]
    PIRiS12764.
    S33496.
    RefSeqiNP_001184026.2. NM_001197097.2.
    NP_001184027.1. NM_001197098.1.
    NP_002762.2. NM_002771.3.
    NP_031369.2. NM_007343.3.
    UniGeneiHs.654513.

    Genome annotation databases

    EnsembliENST00000342836; ENSP00000340889; ENSG00000010438. [P35030-4]
    ENST00000361005; ENSP00000354280; ENSG00000010438. [P35030-1]
    ENST00000379405; ENSP00000368715; ENSG00000010438. [P35030-3]
    ENST00000429677; ENSP00000401828; ENSG00000010438. [P35030-5]
    GeneIDi5646.
    KEGGihsa:5646.
    UCSCiuc003zti.4. human. [P35030-4]
    uc003ztj.4. human. [P35030-1]
    uc003ztl.4. human.

    Polymorphism databases

    DMDMi209572698.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X72781 mRNA. Translation: CAB58178.1 .
    X71345 mRNA. Translation: CAA50484.1 .
    X15505 mRNA. Translation: CAA33527.1 .
    D45417 mRNA. Translation: BAA08257.1 .
    AF029308 Genomic DNA. Translation: AAC13322.1 .
    AB298285 mRNA. Translation: BAF80324.1 .
    AB298286 mRNA. Translation: BAF80325.1 .
    AL139113 Genomic DNA. No translation available.
    AL356489 Genomic DNA. No translation available.
    AL358573 Genomic DNA. No translation available.
    CH471071 Genomic DNA. Translation: EAW58482.1 .
    CH471071 Genomic DNA. Translation: EAW58484.1 .
    BC069476 mRNA. Translation: AAH69476.1 .
    BC069494 mRNA. Translation: AAH69494.1 .
    CCDSi CCDS47958.1. [P35030-1 ]
    CCDS56570.1. [P35030-5 ]
    CCDS56571.1. [P35030-4 ]
    CCDS6545.1. [P35030-3 ]
    PIRi S12764.
    S33496.
    RefSeqi NP_001184026.2. NM_001197097.2.
    NP_001184027.1. NM_001197098.1.
    NP_002762.2. NM_002771.3.
    NP_031369.2. NM_007343.3.
    UniGenei Hs.654513.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1H4W X-ray 1.70 A 81-304 [» ]
    2R9P X-ray 1.40 A/B/C/D 81-304 [» ]
    3L33 X-ray 2.48 A/B/C/D 81-304 [» ]
    3L3T X-ray 2.38 A/B/C/D 81-304 [» ]
    3P92 X-ray 1.60 A 81-304 [» ]
    3P95 X-ray 1.30 A 81-304 [» ]
    4DG4 X-ray 1.40 A/B/D/G 81-304 [» ]
    ProteinModelPortali P35030.
    SMRi P35030. Positions 81-304.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 111628. 4 interactions.
    IntActi P35030. 4 interactions.
    STRINGi 9606.ENSP00000354280.

    Chemistry

    BindingDBi P35030.
    ChEMBLi CHEMBL2095204.

    Protein family/group databases

    MEROPSi S01.174.

    PTM databases

    PhosphoSitei P35030.

    Polymorphism databases

    DMDMi 209572698.

    Proteomic databases

    MaxQBi P35030.
    PaxDbi P35030.
    PRIDEi P35030.

    Protocols and materials databases

    DNASUi 5646.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000342836 ; ENSP00000340889 ; ENSG00000010438 . [P35030-4 ]
    ENST00000361005 ; ENSP00000354280 ; ENSG00000010438 . [P35030-1 ]
    ENST00000379405 ; ENSP00000368715 ; ENSG00000010438 . [P35030-3 ]
    ENST00000429677 ; ENSP00000401828 ; ENSG00000010438 . [P35030-5 ]
    GeneIDi 5646.
    KEGGi hsa:5646.
    UCSCi uc003zti.4. human. [P35030-4 ]
    uc003ztj.4. human. [P35030-1 ]
    uc003ztl.4. human.

    Organism-specific databases

    CTDi 5646.
    GeneCardsi GC09P033750.
    H-InvDB HIX0035151.
    HGNCi HGNC:9486. PRSS3.
    MIMi 613578. gene.
    neXtProti NX_P35030.
    PharmGKBi PA33838.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5640.
    HOGENOMi HOG000251820.
    HOVERGENi HBG013304.
    InParanoidi P35030.
    KOi K01312.
    OMAi WIQATID.
    OrthoDBi EOG75B84T.
    PhylomeDBi P35030.
    TreeFami TF331065.

    Enzyme and pathway databases

    Reactomei REACT_115574. Alpha-defensins.
    REACT_163862. Cobalamin (Cbl, vitamin B12) transport and metabolism.

    Miscellaneous databases

    EvolutionaryTracei P35030.
    GenomeRNAii 5646.
    NextBioi 21934.
    PROi P35030.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P35030.
    Bgeei P35030.
    CleanExi HS_PRSS3.
    Genevestigatori P35030.

    Family and domain databases

    InterProi IPR001254. Peptidase_S1.
    IPR018114. Peptidase_S1_AS.
    IPR001314. Peptidase_S1A.
    IPR009003. Trypsin-like_Pept_dom.
    [Graphical view ]
    Pfami PF00089. Trypsin. 1 hit.
    [Graphical view ]
    PRINTSi PR00722. CHYMOTRYPSIN.
    SMARTi SM00020. Tryp_SPc. 1 hit.
    [Graphical view ]
    SUPFAMi SSF50494. SSF50494. 1 hit.
    PROSITEi PS50240. TRYPSIN_DOM. 1 hit.
    PS00134. TRYPSIN_HIS. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning of the cDNA encoding human brain trypsinogen and characterization of its product."
      Wiegand U., Corbach S., Minn A., Kang J., Mueller-Hill B.
      Gene 136:167-175(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), VARIANT ALA-188.
      Tissue: Brain.
    2. "Nucleotide sequence of the human pancreatic trypsinogen III cDNA."
      Tani T., Kawashima I., Mita K., Takiguchi Y.
      Nucleic Acids Res. 18:1631-1631(1990) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), VARIANTS ALA-188 AND CYS-232.
      Tissue: Pancreas.
    3. Fukuoka S.
      Submitted (FEB-1995) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), VARIANT ALA-188.
    4. "Sequence of a large duplication from human chromosome 7 to chromosome 9 containing a portion of the T cell receptor beta locus and trypsinogen locus."
      Rowen L., Trask B., Boysen C., Qin S., Wang K., Ahearn M.E., Hood L.
      Submitted (OCT-1997) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 3), VARIANT ALA-188.
    5. "Keratinocytes synthesize enteropeptidase and multiple forms of trypsinogen during terminal differentiation."
      Nakanishi J., Yamamoto M., Koyama J., Sato J., Hibino T.
      J. Invest. Dermatol. 130:944-952(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 5), VARIANT ALA-188.
    6. "DNA sequence and analysis of human chromosome 9."
      Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
      , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
      Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT ALA-188.
    8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), VARIANT ALA-188.
    9. "Paneth cell trypsin is the processing enzyme for human defensin-5."
      Ghosh D., Porter E., Shen B., Lee S.K., Wilk D., Drazba J., Yadav S.P., Crabb J.W., Ganz T., Bevins C.L.
      Nat. Immunol. 3:583-590(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, TISSUE SPECIFICITY.
    10. "Human mesotrypsin is a unique digestive protease specialized for the degradation of trypsin inhibitors."
      Szmola R., Kukor Z., Sahin-Toth M.
      J. Biol. Chem. 278:48580-48589(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.
    11. "Crystal structure reveals basis for the inhibitor resistance of human brain trypsin."
      Katona G., Berglund G.I., Hajdu J., Graf L., Szilagyi L.
      J. Mol. Biol. 315:1209-1218(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (1.7 ANGSTROMS) (ISOFORM A).

    Entry informationi

    Entry nameiTRY3_HUMAN
    AccessioniPrimary (citable) accession number: P35030
    Secondary accession number(s): A8CED1
    , A8CED3, A9Z1Y4, E7ES07, F8W7P3, P15951, Q15665, Q5VXV0, Q6ISJ4, Q9UQV3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 1, 1994
    Last sequence update: October 14, 2008
    Last modified: October 1, 2014
    This is version 150 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 9
      Human chromosome 9: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. Peptidase families
      Classification of peptidase families and list of entries
    7. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3