Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Trypsin-3

Gene

PRSS3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Digestive protease specialized for the degradation of trypsin inhibitors. In the ileum, may be involved in defensin processing, including DEFA5.2 Publications

Catalytic activityi

Preferential cleavage: Arg-|-Xaa, Lys-|-Xaa.

Cofactori

Ca2+Note: Binds 1 Ca2+ ion per subunit.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei120 – 1201Charge relay system
Metal bindingi132 – 1321Calcium
Metal bindingi134 – 1341Calcium; via carbonyl oxygen
Metal bindingi137 – 1371Calcium; via carbonyl oxygen
Metal bindingi142 – 1421Calcium
Active sitei164 – 1641Charge relay system
Sitei251 – 2511Required for specificityBy similarity
Active sitei257 – 2571Charge relay system

GO - Molecular functioni

  1. calcium ion binding Source: UniProtKB
  2. serine-type endopeptidase activity Source: UniProtKB
  3. serine-type peptidase activity Source: UniProtKB

GO - Biological processi

  1. cobalamin metabolic process Source: Reactome
  2. digestion Source: UniProtKB
  3. endothelial cell migration Source: UniProtKB
  4. innate immune response Source: Reactome
  5. proteolysis Source: GOC
  6. small molecule metabolic process Source: Reactome
  7. vitamin metabolic process Source: Reactome
  8. water-soluble vitamin metabolic process Source: Reactome
  9. zymogen activation Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protease, Serine protease

Keywords - Biological processi

Digestion

Keywords - Ligandi

Calcium, Metal-binding

Enzyme and pathway databases

ReactomeiREACT_115574. Alpha-defensins.
REACT_163862. Cobalamin (Cbl, vitamin B12) transport and metabolism.

Protein family/group databases

MEROPSiS01.174.

Names & Taxonomyi

Protein namesi
Recommended name:
Trypsin-3 (EC:3.4.21.4)
Alternative name(s):
Brain trypsinogen
Mesotrypsinogen
Serine protease 3
Serine protease 4
Trypsin III
Trypsin IV
Gene namesi
Name:PRSS3
Synonyms:PRSS4, TRY3, TRY4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 9

Organism-specific databases

HGNCiHGNC:9486. PRSS3.

Subcellular locationi

GO - Cellular componenti

  1. extracellular region Source: Reactome
  2. extracellular space Source: UniProtKB
  3. extracellular vesicular exosome Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA33838.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Propeptidei? – 80Activation peptidePRO_0000028201
Signal peptidei1 – ?Sequence Analysis
Chaini81 – 304224Trypsin-3PRO_0000028202Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi87 ↔ 217
Disulfide bondi105 ↔ 121
Disulfide bondi196 ↔ 263
Modified residuei211 – 2111SulfotyrosineBy similarity
Disulfide bondi228 ↔ 242
Disulfide bondi253 ↔ 277

Keywords - PTMi

Disulfide bond, Sulfation, Zymogen

Proteomic databases

MaxQBiP35030.
PaxDbiP35030.
PRIDEiP35030.

PTM databases

PhosphoSiteiP35030.

Expressioni

Tissue specificityi

Expressed in pancreas and brain. Also expressed in Paneth cells, at the base of small intestinal crypts.1 Publication

Gene expression databases

BgeeiP35030.
CleanExiHS_PRSS3.
ExpressionAtlasiP35030. baseline and differential.
GenevestigatoriP35030.

Interactioni

Protein-protein interaction databases

BioGridi111628. 4 interactions.
IntActiP35030. 4 interactions.
STRINGi9606.ENSP00000354280.

Structurei

Secondary structure

1
304
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi89 – 913Combined sources
Beta strandi95 – 11117Combined sources
Beta strandi114 – 1174Combined sources
Helixi119 – 1213Combined sources
Beta strandi127 – 1315Combined sources
Beta strandi133 – 1375Combined sources
Beta strandi143 – 15210Combined sources
Turni158 – 1603Combined sources
Beta strandi166 – 1727Combined sources
Beta strandi177 – 1804Combined sources
Beta strandi195 – 2017Combined sources
Beta strandi206 – 2083Combined sources
Beta strandi216 – 2227Combined sources
Helixi225 – 2317Combined sources
Turni233 – 2353Combined sources
Beta strandi240 – 2445Combined sources
Beta strandi246 – 2494Combined sources
Turni254 – 2585Combined sources
Beta strandi260 – 2634Combined sources
Beta strandi266 – 2738Combined sources
Beta strandi275 – 2784Combined sources
Beta strandi284 – 2885Combined sources
Helixi289 – 2924Combined sources
Helixi293 – 30210Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1H4WX-ray1.70A81-304[»]
2R9PX-ray1.40A/B/C/D81-304[»]
3L33X-ray2.48A/B/C/D81-304[»]
3L3TX-ray2.38A/B/C/D81-304[»]
3P92X-ray1.60A81-304[»]
3P95X-ray1.30A81-304[»]
4DG4X-ray1.40A/B/D/G81-304[»]
4U30X-ray2.50A/B/C/D81-304[»]
4U32X-ray1.65A81-304[»]
ProteinModelPortaliP35030.
SMRiP35030. Positions 81-304.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP35030.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini81 – 301221Peptidase S1PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the peptidase S1 family.PROSITE-ProRule annotation
Contains 1 peptidase S1 domain.PROSITE-ProRule annotation

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiCOG5640.
GeneTreeiENSGT00760000118862.
HOGENOMiHOG000251820.
HOVERGENiHBG013304.
InParanoidiP35030.
KOiK01312.
OMAiWIQATID.
OrthoDBiEOG75B84T.
PhylomeDBiP35030.
TreeFamiTF331065.

Family and domain databases

InterProiIPR001254. Peptidase_S1.
IPR018114. Peptidase_S1_AS.
IPR001314. Peptidase_S1A.
IPR009003. Trypsin-like_Pept_dom.
[Graphical view]
PfamiPF00089. Trypsin. 1 hit.
[Graphical view]
PRINTSiPR00722. CHYMOTRYPSIN.
SMARTiSM00020. Tryp_SPc. 1 hit.
[Graphical view]
SUPFAMiSSF50494. SSF50494. 1 hit.
PROSITEiPS50240. TRYPSIN_DOM. 1 hit.
PS00134. TRYPSIN_HIS. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P35030-1) [UniParc]FASTAAdd to Basket

Also known as: A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MCGPDDRCPA RWPGPGRAVK CGKGLAAARP GRVERGGAQR GGAGLELHPL
60 70 80 90 100
LGGRTWRAAR DADGCEALGT VAVPFDDDDK IVGGYTCEEN SLPYQVSLNS
110 120 130 140 150
GSHFCGGSLI SEQWVVSAAH CYKTRIQVRL GEHNIKVLEG NEQFINAAKI
160 170 180 190 200
IRHPKYNRDT LDNDIMLIKL SSPAVINARV STISLPTTPP AAGTECLISG
210 220 230 240 250
WGNTLSFGAD YPDELKCLDA PVLTQAECKA SYPGKITNSM FCVGFLEGGK
260 270 280 290 300
DSCQRDSGGP VVCNGQLQGV VSWGHGCAWK NRPGVYTKVY NYVDWIKDTI

AANS
Length:304
Mass (Da):32,529
Last modified:October 14, 2008 - v2
Checksum:i4C4303C310B7BFFC
GO
Isoform 2 (identifier: P35030-2) [UniParc]FASTAAdd to Basket

Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     1-45: MCGPDDRCPARWPGPGRAVKCGKGLAAARPGRVERGGAQRGGAGL → M

Show »
Length:260
Mass (Da):28,161
Checksum:iCD8AA6E8072BCE56
GO
Isoform 3 (identifier: P35030-3) [UniParc]FASTAAdd to Basket

Also known as: C

The sequence of this isoform differs from the canonical sequence as follows:
     1-70: MCGPDDRCPA...DADGCEALGT → MNPFLILAFVGAA

Show »
Length:247
Mass (Da):26,727
Checksum:i01563656780A6607
GO
Isoform 4 (identifier: P35030-4) [UniParc]FASTAAdd to Basket

Also known as: D

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: MCGPDDRCPA...ADGCEALGTV → MHMRETSGFTLKKGRSAPLVFHPPDALI

Show »
Length:261
Mass (Da):28,402
Checksum:i5908225118767A4A
GO
Isoform 5 (identifier: P35030-5) [UniParc]FASTAAdd to Basket

Also known as: E

The sequence of this isoform differs from the canonical sequence as follows:
     1-70: MCGPDDRCPA...DADGCEALGT → MGPAGE

Show »
Length:240
Mass (Da):25,924
Checksum:iE8DF46CFF536DB74
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti89 – 891Missing in CAA50484. (PubMed:8294000)Curated
Sequence conflicti224 – 2252TQ → RE in CAA33527. (PubMed:2326201)Curated
Sequence conflicti253 – 2542CQ → WK in CAA33527. (PubMed:2326201)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti174 – 1741A → V.
Corresponds to variant rs11547028 [ dbSNP | Ensembl ].
VAR_067459
Natural varianti188 – 1881T → A.7 Publications
Corresponds to variant rs855581 [ dbSNP | Ensembl ].
VAR_046794
Natural varianti224 – 2241T → S.
Corresponds to variant rs1063273 [ dbSNP | Ensembl ].
VAR_059788
Natural varianti232 – 2321Y → C.1 Publication
Corresponds to variant rs1048379 [ dbSNP | Ensembl ].
VAR_046795

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 7171MCGPD…ALGTV → MHMRETSGFTLKKGRSAPLV FHPPDALI in isoform 4. CuratedVSP_005409Add
BLAST
Alternative sequencei1 – 7070MCGPD…EALGT → MNPFLILAFVGAA in isoform 3. 3 PublicationsVSP_005410Add
BLAST
Alternative sequencei1 – 7070MCGPD…EALGT → MGPAGE in isoform 5. 1 PublicationVSP_053779Add
BLAST
Alternative sequencei1 – 4545MCGPD…GGAGL → M in isoform 2. 1 PublicationVSP_042074Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X72781 mRNA. Translation: CAB58178.1.
X71345 mRNA. Translation: CAA50484.1.
X15505 mRNA. Translation: CAA33527.1.
D45417 mRNA. Translation: BAA08257.1.
AF029308 Genomic DNA. Translation: AAC13322.1.
AB298285 mRNA. Translation: BAF80324.1.
AB298286 mRNA. Translation: BAF80325.1.
AL139113 Genomic DNA. No translation available.
AL356489 Genomic DNA. No translation available.
AL358573 Genomic DNA. No translation available.
CH471071 Genomic DNA. Translation: EAW58482.1.
CH471071 Genomic DNA. Translation: EAW58484.1.
BC069476 mRNA. Translation: AAH69476.1.
BC069494 mRNA. Translation: AAH69494.1.
CCDSiCCDS47958.1. [P35030-1]
CCDS56570.1. [P35030-5]
CCDS56571.1. [P35030-4]
CCDS6545.1. [P35030-3]
PIRiS12764.
S33496.
RefSeqiNP_001184026.2. NM_001197097.2.
NP_001184027.1. NM_001197098.1.
NP_002762.2. NM_002771.3.
NP_031369.2. NM_007343.3.
UniGeneiHs.654513.

Genome annotation databases

EnsembliENST00000342836; ENSP00000340889; ENSG00000010438. [P35030-4]
ENST00000361005; ENSP00000354280; ENSG00000010438. [P35030-1]
ENST00000379405; ENSP00000368715; ENSG00000010438. [P35030-3]
ENST00000429677; ENSP00000401828; ENSG00000010438. [P35030-5]
GeneIDi5646.
KEGGihsa:5646.
UCSCiuc003zti.4. human. [P35030-4]
uc003ztj.4. human. [P35030-1]
uc003ztl.4. human.

Polymorphism databases

DMDMi209572698.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X72781 mRNA. Translation: CAB58178.1.
X71345 mRNA. Translation: CAA50484.1.
X15505 mRNA. Translation: CAA33527.1.
D45417 mRNA. Translation: BAA08257.1.
AF029308 Genomic DNA. Translation: AAC13322.1.
AB298285 mRNA. Translation: BAF80324.1.
AB298286 mRNA. Translation: BAF80325.1.
AL139113 Genomic DNA. No translation available.
AL356489 Genomic DNA. No translation available.
AL358573 Genomic DNA. No translation available.
CH471071 Genomic DNA. Translation: EAW58482.1.
CH471071 Genomic DNA. Translation: EAW58484.1.
BC069476 mRNA. Translation: AAH69476.1.
BC069494 mRNA. Translation: AAH69494.1.
CCDSiCCDS47958.1. [P35030-1]
CCDS56570.1. [P35030-5]
CCDS56571.1. [P35030-4]
CCDS6545.1. [P35030-3]
PIRiS12764.
S33496.
RefSeqiNP_001184026.2. NM_001197097.2.
NP_001184027.1. NM_001197098.1.
NP_002762.2. NM_002771.3.
NP_031369.2. NM_007343.3.
UniGeneiHs.654513.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1H4WX-ray1.70A81-304[»]
2R9PX-ray1.40A/B/C/D81-304[»]
3L33X-ray2.48A/B/C/D81-304[»]
3L3TX-ray2.38A/B/C/D81-304[»]
3P92X-ray1.60A81-304[»]
3P95X-ray1.30A81-304[»]
4DG4X-ray1.40A/B/D/G81-304[»]
4U30X-ray2.50A/B/C/D81-304[»]
4U32X-ray1.65A81-304[»]
ProteinModelPortaliP35030.
SMRiP35030. Positions 81-304.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111628. 4 interactions.
IntActiP35030. 4 interactions.
STRINGi9606.ENSP00000354280.

Chemistry

BindingDBiP35030.
ChEMBLiCHEMBL2095204.

Protein family/group databases

MEROPSiS01.174.

PTM databases

PhosphoSiteiP35030.

Polymorphism databases

DMDMi209572698.

Proteomic databases

MaxQBiP35030.
PaxDbiP35030.
PRIDEiP35030.

Protocols and materials databases

DNASUi5646.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000342836; ENSP00000340889; ENSG00000010438. [P35030-4]
ENST00000361005; ENSP00000354280; ENSG00000010438. [P35030-1]
ENST00000379405; ENSP00000368715; ENSG00000010438. [P35030-3]
ENST00000429677; ENSP00000401828; ENSG00000010438. [P35030-5]
GeneIDi5646.
KEGGihsa:5646.
UCSCiuc003zti.4. human. [P35030-4]
uc003ztj.4. human. [P35030-1]
uc003ztl.4. human.

Organism-specific databases

CTDi5646.
GeneCardsiGC09P033750.
H-InvDBHIX0035151.
HGNCiHGNC:9486. PRSS3.
MIMi613578. gene.
neXtProtiNX_P35030.
PharmGKBiPA33838.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiCOG5640.
GeneTreeiENSGT00760000118862.
HOGENOMiHOG000251820.
HOVERGENiHBG013304.
InParanoidiP35030.
KOiK01312.
OMAiWIQATID.
OrthoDBiEOG75B84T.
PhylomeDBiP35030.
TreeFamiTF331065.

Enzyme and pathway databases

ReactomeiREACT_115574. Alpha-defensins.
REACT_163862. Cobalamin (Cbl, vitamin B12) transport and metabolism.

Miscellaneous databases

EvolutionaryTraceiP35030.
GenomeRNAii5646.
NextBioi21934.
PROiP35030.
SOURCEiSearch...

Gene expression databases

BgeeiP35030.
CleanExiHS_PRSS3.
ExpressionAtlasiP35030. baseline and differential.
GenevestigatoriP35030.

Family and domain databases

InterProiIPR001254. Peptidase_S1.
IPR018114. Peptidase_S1_AS.
IPR001314. Peptidase_S1A.
IPR009003. Trypsin-like_Pept_dom.
[Graphical view]
PfamiPF00089. Trypsin. 1 hit.
[Graphical view]
PRINTSiPR00722. CHYMOTRYPSIN.
SMARTiSM00020. Tryp_SPc. 1 hit.
[Graphical view]
SUPFAMiSSF50494. SSF50494. 1 hit.
PROSITEiPS50240. TRYPSIN_DOM. 1 hit.
PS00134. TRYPSIN_HIS. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning of the cDNA encoding human brain trypsinogen and characterization of its product."
    Wiegand U., Corbach S., Minn A., Kang J., Mueller-Hill B.
    Gene 136:167-175(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), VARIANT ALA-188.
    Tissue: Brain.
  2. "Nucleotide sequence of the human pancreatic trypsinogen III cDNA."
    Tani T., Kawashima I., Mita K., Takiguchi Y.
    Nucleic Acids Res. 18:1631-1631(1990) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), VARIANTS ALA-188 AND CYS-232.
    Tissue: Pancreas.
  3. Fukuoka S.
    Submitted (FEB-1995) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), VARIANT ALA-188.
  4. "Sequence of a large duplication from human chromosome 7 to chromosome 9 containing a portion of the T cell receptor beta locus and trypsinogen locus."
    Rowen L., Trask B., Boysen C., Qin S., Wang K., Ahearn M.E., Hood L.
    Submitted (OCT-1997) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 3), VARIANT ALA-188.
  5. "Keratinocytes synthesize enteropeptidase and multiple forms of trypsinogen during terminal differentiation."
    Nakanishi J., Yamamoto M., Koyama J., Sato J., Hibino T.
    J. Invest. Dermatol. 130:944-952(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 5), VARIANT ALA-188.
  6. "DNA sequence and analysis of human chromosome 9."
    Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
    , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
    Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT ALA-188.
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), VARIANT ALA-188.
  9. "Paneth cell trypsin is the processing enzyme for human defensin-5."
    Ghosh D., Porter E., Shen B., Lee S.K., Wilk D., Drazba J., Yadav S.P., Crabb J.W., Ganz T., Bevins C.L.
    Nat. Immunol. 3:583-590(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TISSUE SPECIFICITY.
  10. "Human mesotrypsin is a unique digestive protease specialized for the degradation of trypsin inhibitors."
    Szmola R., Kukor Z., Sahin-Toth M.
    J. Biol. Chem. 278:48580-48589(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  11. "Crystal structure reveals basis for the inhibitor resistance of human brain trypsin."
    Katona G., Berglund G.I., Hajdu J., Graf L., Szilagyi L.
    J. Mol. Biol. 315:1209-1218(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (1.7 ANGSTROMS) (ISOFORM A).

Entry informationi

Entry nameiTRY3_HUMAN
AccessioniPrimary (citable) accession number: P35030
Secondary accession number(s): A8CED1
, A8CED3, A9Z1Y4, E7ES07, F8W7P3, P15951, Q15665, Q5VXV0, Q6ISJ4, Q9UQV3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: October 14, 2008
Last modified: January 7, 2015
This is version 153 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Peptidase families
    Classification of peptidase families and list of entries
  7. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.