SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P35030

- TRY3_HUMAN

UniProt

P35030 - TRY3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Trypsin-3
Gene
PRSS3, PRSS4, TRY3, TRY4
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Digestive protease specialized for the degradation of trypsin inhibitors. In the ileum, may be involved in defensin processing, including DEFA5.2 Publications

Catalytic activityi

Preferential cleavage: Arg-|-Xaa, Lys-|-Xaa.

Cofactori

Binds 1 calcium ion per subunit.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei120 – 1201Charge relay system
Metal bindingi132 – 1321Calcium
Metal bindingi134 – 1341Calcium; via carbonyl oxygen
Metal bindingi137 – 1371Calcium; via carbonyl oxygen
Metal bindingi142 – 1421Calcium
Active sitei164 – 1641Charge relay system
Sitei251 – 2511Required for specificity By similarity
Active sitei257 – 2571Charge relay system

GO - Molecular functioni

  1. calcium ion binding Source: UniProtKB
  2. protein binding Source: UniProtKB
  3. serine-type endopeptidase activity Source: UniProtKB
  4. serine-type peptidase activity Source: UniProtKB

GO - Biological processi

  1. cobalamin metabolic process Source: Reactome
  2. digestion Source: UniProtKB
  3. endothelial cell migration Source: UniProtKB
  4. innate immune response Source: Reactome
  5. proteolysis Source: GOC
  6. small molecule metabolic process Source: Reactome
  7. vitamin metabolic process Source: Reactome
  8. water-soluble vitamin metabolic process Source: Reactome
  9. zymogen activation Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protease, Serine protease

Keywords - Biological processi

Digestion

Keywords - Ligandi

Calcium, Metal-binding

Enzyme and pathway databases

ReactomeiREACT_115574. Alpha-defensins.
REACT_163862. Cobalamin (Cbl, vitamin B12) transport and metabolism.

Protein family/group databases

MEROPSiS01.174.

Names & Taxonomyi

Protein namesi
Recommended name:
Trypsin-3 (EC:3.4.21.4)
Alternative name(s):
Brain trypsinogen
Mesotrypsinogen
Serine protease 3
Serine protease 4
Trypsin III
Trypsin IV
Gene namesi
Name:PRSS3
Synonyms:PRSS4, TRY3, TRY4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 9

Organism-specific databases

HGNCiHGNC:9486. PRSS3.

Subcellular locationi

GO - Cellular componenti

  1. extracellular region Source: Reactome
  2. extracellular space Source: UniProtKB
  3. extracellular vesicular exosome Source: UniProt
Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA33838.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Propeptidei? – 80Activation peptidePRO_0000028201
Signal peptidei1 – ? Reviewed prediction
Chaini81 – 304224Trypsin-3
PRO_0000028202Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi87 ↔ 217
Disulfide bondi105 ↔ 121
Disulfide bondi196 ↔ 263
Modified residuei211 – 2111Sulfotyrosine By similarity
Disulfide bondi228 ↔ 242
Disulfide bondi253 ↔ 277

Keywords - PTMi

Disulfide bond, Sulfation, Zymogen

Proteomic databases

MaxQBiP35030.
PaxDbiP35030.
PRIDEiP35030.

PTM databases

PhosphoSiteiP35030.

Expressioni

Tissue specificityi

Expressed in pancreas and brain. Also expressed in Paneth cells, at the base of small intestinal crypts.1 Publication

Gene expression databases

ArrayExpressiP35030.
BgeeiP35030.
CleanExiHS_PRSS3.
GenevestigatoriP35030.

Interactioni

Protein-protein interaction databases

BioGridi111628. 4 interactions.
IntActiP35030. 4 interactions.
STRINGi9606.ENSP00000354280.

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi89 – 913
Beta strandi95 – 11117
Beta strandi114 – 1174
Helixi119 – 1213
Beta strandi127 – 1315
Beta strandi133 – 1375
Beta strandi143 – 15210
Turni158 – 1603
Beta strandi166 – 1727
Beta strandi177 – 1804
Beta strandi195 – 2017
Beta strandi206 – 2083
Beta strandi216 – 2227
Helixi225 – 2317
Turni233 – 2353
Beta strandi240 – 2445
Beta strandi246 – 2494
Turni254 – 2585
Beta strandi260 – 2634
Beta strandi266 – 2738
Beta strandi275 – 2784
Beta strandi284 – 2885
Helixi289 – 2924
Helixi293 – 30210

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1H4WX-ray1.70A81-304[»]
2R9PX-ray1.40A/B/C/D81-304[»]
3L33X-ray2.48A/B/C/D81-304[»]
3L3TX-ray2.38A/B/C/D81-304[»]
3P92X-ray1.60A81-304[»]
3P95X-ray1.30A81-304[»]
4DG4X-ray1.40A/B/D/G81-304[»]
ProteinModelPortaliP35030.
SMRiP35030. Positions 81-304.

Miscellaneous databases

EvolutionaryTraceiP35030.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini81 – 301221Peptidase S1
Add
BLAST

Sequence similaritiesi

Belongs to the peptidase S1 family.

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiCOG5640.
HOGENOMiHOG000251820.
HOVERGENiHBG013304.
InParanoidiP35030.
KOiK01312.
OMAiWIQATID.
OrthoDBiEOG75B84T.
PhylomeDBiP35030.
TreeFamiTF331065.

Family and domain databases

InterProiIPR001254. Peptidase_S1.
IPR018114. Peptidase_S1_AS.
IPR001314. Peptidase_S1A.
IPR009003. Trypsin-like_Pept_dom.
[Graphical view]
PfamiPF00089. Trypsin. 1 hit.
[Graphical view]
PRINTSiPR00722. CHYMOTRYPSIN.
SMARTiSM00020. Tryp_SPc. 1 hit.
[Graphical view]
SUPFAMiSSF50494. SSF50494. 1 hit.
PROSITEiPS50240. TRYPSIN_DOM. 1 hit.
PS00134. TRYPSIN_HIS. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P35030-1) [UniParc]FASTAAdd to Basket

Also known as: A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MCGPDDRCPA RWPGPGRAVK CGKGLAAARP GRVERGGAQR GGAGLELHPL    50
LGGRTWRAAR DADGCEALGT VAVPFDDDDK IVGGYTCEEN SLPYQVSLNS 100
GSHFCGGSLI SEQWVVSAAH CYKTRIQVRL GEHNIKVLEG NEQFINAAKI 150
IRHPKYNRDT LDNDIMLIKL SSPAVINARV STISLPTTPP AAGTECLISG 200
WGNTLSFGAD YPDELKCLDA PVLTQAECKA SYPGKITNSM FCVGFLEGGK 250
DSCQRDSGGP VVCNGQLQGV VSWGHGCAWK NRPGVYTKVY NYVDWIKDTI 300
AANS 304
Length:304
Mass (Da):32,529
Last modified:October 14, 2008 - v2
Checksum:i4C4303C310B7BFFC
GO
Isoform 2 (identifier: P35030-2) [UniParc]FASTAAdd to Basket

Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     1-45: MCGPDDRCPARWPGPGRAVKCGKGLAAARPGRVERGGAQRGGAGL → M

Show »
Length:260
Mass (Da):28,161
Checksum:iCD8AA6E8072BCE56
GO
Isoform 3 (identifier: P35030-3) [UniParc]FASTAAdd to Basket

Also known as: C

The sequence of this isoform differs from the canonical sequence as follows:
     1-70: MCGPDDRCPA...DADGCEALGT → MNPFLILAFVGAA

Show »
Length:247
Mass (Da):26,727
Checksum:i01563656780A6607
GO
Isoform 4 (identifier: P35030-4) [UniParc]FASTAAdd to Basket

Also known as: D

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: MCGPDDRCPA...ADGCEALGTV → MHMRETSGFTLKKGRSAPLVFHPPDALI

Show »
Length:261
Mass (Da):28,402
Checksum:i5908225118767A4A
GO
Isoform 5 (identifier: P35030-5) [UniParc]FASTAAdd to Basket

Also known as: E

The sequence of this isoform differs from the canonical sequence as follows:
     1-70: MCGPDDRCPA...DADGCEALGT → MGPAGE

Show »
Length:240
Mass (Da):25,924
Checksum:iE8DF46CFF536DB74
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti174 – 1741A → V.
Corresponds to variant rs11547028 [ dbSNP | Ensembl ].
VAR_067459
Natural varianti188 – 1881T → A.7 Publications
Corresponds to variant rs855581 [ dbSNP | Ensembl ].
VAR_046794
Natural varianti224 – 2241T → S.
Corresponds to variant rs1063273 [ dbSNP | Ensembl ].
VAR_059788
Natural varianti232 – 2321Y → C.1 Publication
Corresponds to variant rs1048379 [ dbSNP | Ensembl ].
VAR_046795

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 7171MCGPD…ALGTV → MHMRETSGFTLKKGRSAPLV FHPPDALI in isoform 4.
VSP_005409Add
BLAST
Alternative sequencei1 – 7070MCGPD…EALGT → MNPFLILAFVGAA in isoform 3.
VSP_005410Add
BLAST
Alternative sequencei1 – 7070MCGPD…EALGT → MGPAGE in isoform 5.
VSP_053779Add
BLAST
Alternative sequencei1 – 4545MCGPD…GGAGL → M in isoform 2.
VSP_042074Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti89 – 891Missing in CAA50484. 1 Publication
Sequence conflicti224 – 2252TQ → RE in CAA33527. 1 Publication
Sequence conflicti253 – 2542CQ → WK in CAA33527. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X72781 mRNA. Translation: CAB58178.1.
X71345 mRNA. Translation: CAA50484.1.
X15505 mRNA. Translation: CAA33527.1.
D45417 mRNA. Translation: BAA08257.1.
AF029308 Genomic DNA. Translation: AAC13322.1.
AB298285 mRNA. Translation: BAF80324.1.
AB298286 mRNA. Translation: BAF80325.1.
AL139113 Genomic DNA. No translation available.
AL356489 Genomic DNA. No translation available.
AL358573 Genomic DNA. No translation available.
CH471071 Genomic DNA. Translation: EAW58482.1.
CH471071 Genomic DNA. Translation: EAW58484.1.
BC069476 mRNA. Translation: AAH69476.1.
BC069494 mRNA. Translation: AAH69494.1.
CCDSiCCDS47958.1. [P35030-1]
CCDS56570.1. [P35030-5]
CCDS56571.1. [P35030-4]
CCDS6545.1. [P35030-3]
PIRiS12764.
S33496.
RefSeqiNP_001184026.2. NM_001197097.2.
NP_001184027.1. NM_001197098.1.
NP_002762.2. NM_002771.3.
NP_031369.2. NM_007343.3.
UniGeneiHs.654513.

Genome annotation databases

EnsembliENST00000342836; ENSP00000340889; ENSG00000010438. [P35030-4]
ENST00000361005; ENSP00000354280; ENSG00000010438. [P35030-1]
ENST00000379405; ENSP00000368715; ENSG00000010438. [P35030-3]
ENST00000429677; ENSP00000401828; ENSG00000010438.
GeneIDi5646.
KEGGihsa:5646.
UCSCiuc003zti.4. human. [P35030-4]
uc003ztj.4. human. [P35030-1]
uc003ztl.4. human.

Polymorphism databases

DMDMi209572698.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X72781 mRNA. Translation: CAB58178.1 .
X71345 mRNA. Translation: CAA50484.1 .
X15505 mRNA. Translation: CAA33527.1 .
D45417 mRNA. Translation: BAA08257.1 .
AF029308 Genomic DNA. Translation: AAC13322.1 .
AB298285 mRNA. Translation: BAF80324.1 .
AB298286 mRNA. Translation: BAF80325.1 .
AL139113 Genomic DNA. No translation available.
AL356489 Genomic DNA. No translation available.
AL358573 Genomic DNA. No translation available.
CH471071 Genomic DNA. Translation: EAW58482.1 .
CH471071 Genomic DNA. Translation: EAW58484.1 .
BC069476 mRNA. Translation: AAH69476.1 .
BC069494 mRNA. Translation: AAH69494.1 .
CCDSi CCDS47958.1. [P35030-1 ]
CCDS56570.1. [P35030-5 ]
CCDS56571.1. [P35030-4 ]
CCDS6545.1. [P35030-3 ]
PIRi S12764.
S33496.
RefSeqi NP_001184026.2. NM_001197097.2.
NP_001184027.1. NM_001197098.1.
NP_002762.2. NM_002771.3.
NP_031369.2. NM_007343.3.
UniGenei Hs.654513.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1H4W X-ray 1.70 A 81-304 [» ]
2R9P X-ray 1.40 A/B/C/D 81-304 [» ]
3L33 X-ray 2.48 A/B/C/D 81-304 [» ]
3L3T X-ray 2.38 A/B/C/D 81-304 [» ]
3P92 X-ray 1.60 A 81-304 [» ]
3P95 X-ray 1.30 A 81-304 [» ]
4DG4 X-ray 1.40 A/B/D/G 81-304 [» ]
ProteinModelPortali P35030.
SMRi P35030. Positions 81-304.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 111628. 4 interactions.
IntActi P35030. 4 interactions.
STRINGi 9606.ENSP00000354280.

Chemistry

BindingDBi P35030.
ChEMBLi CHEMBL2095204.

Protein family/group databases

MEROPSi S01.174.

PTM databases

PhosphoSitei P35030.

Polymorphism databases

DMDMi 209572698.

Proteomic databases

MaxQBi P35030.
PaxDbi P35030.
PRIDEi P35030.

Protocols and materials databases

DNASUi 5646.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000342836 ; ENSP00000340889 ; ENSG00000010438 . [P35030-4 ]
ENST00000361005 ; ENSP00000354280 ; ENSG00000010438 . [P35030-1 ]
ENST00000379405 ; ENSP00000368715 ; ENSG00000010438 . [P35030-3 ]
ENST00000429677 ; ENSP00000401828 ; ENSG00000010438 .
GeneIDi 5646.
KEGGi hsa:5646.
UCSCi uc003zti.4. human. [P35030-4 ]
uc003ztj.4. human. [P35030-1 ]
uc003ztl.4. human.

Organism-specific databases

CTDi 5646.
GeneCardsi GC09P033750.
H-InvDB HIX0035151.
HGNCi HGNC:9486. PRSS3.
MIMi 613578. gene.
neXtProti NX_P35030.
PharmGKBi PA33838.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5640.
HOGENOMi HOG000251820.
HOVERGENi HBG013304.
InParanoidi P35030.
KOi K01312.
OMAi WIQATID.
OrthoDBi EOG75B84T.
PhylomeDBi P35030.
TreeFami TF331065.

Enzyme and pathway databases

Reactomei REACT_115574. Alpha-defensins.
REACT_163862. Cobalamin (Cbl, vitamin B12) transport and metabolism.

Miscellaneous databases

EvolutionaryTracei P35030.
GenomeRNAii 5646.
NextBioi 21934.
PROi P35030.
SOURCEi Search...

Gene expression databases

ArrayExpressi P35030.
Bgeei P35030.
CleanExi HS_PRSS3.
Genevestigatori P35030.

Family and domain databases

InterProi IPR001254. Peptidase_S1.
IPR018114. Peptidase_S1_AS.
IPR001314. Peptidase_S1A.
IPR009003. Trypsin-like_Pept_dom.
[Graphical view ]
Pfami PF00089. Trypsin. 1 hit.
[Graphical view ]
PRINTSi PR00722. CHYMOTRYPSIN.
SMARTi SM00020. Tryp_SPc. 1 hit.
[Graphical view ]
SUPFAMi SSF50494. SSF50494. 1 hit.
PROSITEi PS50240. TRYPSIN_DOM. 1 hit.
PS00134. TRYPSIN_HIS. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning of the cDNA encoding human brain trypsinogen and characterization of its product."
    Wiegand U., Corbach S., Minn A., Kang J., Mueller-Hill B.
    Gene 136:167-175(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), VARIANT ALA-188.
    Tissue: Brain.
  2. "Nucleotide sequence of the human pancreatic trypsinogen III cDNA."
    Tani T., Kawashima I., Mita K., Takiguchi Y.
    Nucleic Acids Res. 18:1631-1631(1990) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), VARIANTS ALA-188 AND CYS-232.
    Tissue: Pancreas.
  3. Fukuoka S.
    Submitted (FEB-1995) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), VARIANT ALA-188.
  4. "Sequence of a large duplication from human chromosome 7 to chromosome 9 containing a portion of the T cell receptor beta locus and trypsinogen locus."
    Rowen L., Trask B., Boysen C., Qin S., Wang K., Ahearn M.E., Hood L.
    Submitted (OCT-1997) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 3), VARIANT ALA-188.
  5. "Keratinocytes synthesize enteropeptidase and multiple forms of trypsinogen during terminal differentiation."
    Nakanishi J., Yamamoto M., Koyama J., Sato J., Hibino T.
    J. Invest. Dermatol. 130:944-952(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 5), VARIANT ALA-188.
  6. "DNA sequence and analysis of human chromosome 9."
    Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
    , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
    Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT ALA-188.
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), VARIANT ALA-188.
  9. "Paneth cell trypsin is the processing enzyme for human defensin-5."
    Ghosh D., Porter E., Shen B., Lee S.K., Wilk D., Drazba J., Yadav S.P., Crabb J.W., Ganz T., Bevins C.L.
    Nat. Immunol. 3:583-590(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TISSUE SPECIFICITY.
  10. "Human mesotrypsin is a unique digestive protease specialized for the degradation of trypsin inhibitors."
    Szmola R., Kukor Z., Sahin-Toth M.
    J. Biol. Chem. 278:48580-48589(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  11. "Crystal structure reveals basis for the inhibitor resistance of human brain trypsin."
    Katona G., Berglund G.I., Hajdu J., Graf L., Szilagyi L.
    J. Mol. Biol. 315:1209-1218(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (1.7 ANGSTROMS) (ISOFORM A).

Entry informationi

Entry nameiTRY3_HUMAN
AccessioniPrimary (citable) accession number: P35030
Secondary accession number(s): A8CED1
, A8CED3, A9Z1Y4, E7ES07, F8W7P3, P15951, Q15665, Q5VXV0, Q6ISJ4, Q9UQV3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: October 14, 2008
Last modified: September 3, 2014
This is version 149 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Peptidase families
    Classification of peptidase families and list of entries
  7. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi