P35030 (TRY3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 136.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Trypsin-3 EC=3.4.21.4 Alternative name(s): Brain trypsinogen Mesotrypsinogen Serine protease 3 Serine protease 4 Trypsin III Trypsin IV | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 304 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Digestive protease specialized for the degradation of trypsin inhibitors. In the ileum, may be involved in defensin processing, including DEFA5. Ref.7 Ref.8 |
| Catalytic activity | Preferential cleavage: Arg-|-Xaa, Lys-|-Xaa. |
| Cofactor | Binds 1 calcium ion per subunit. |
| Subcellular location | |
| Tissue specificity | Expressed in pancreas and brain. Also expressed in Paneth cells, at the base of small intestinal crypts. Ref.7 |
| Sequence similarities | Belongs to the peptidase S1 family. Contains 1 peptidase S1 domain. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform A (identifier: P35030-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform B (identifier: P35030-2) The sequence of this isoform differs from the canonical sequence as follows: 1-45: MCGPDDRCPARWPGPGRAVKCGKGLAAARPGRVERGGAQRGGAGL → M | ||||||
| Isoform C (identifier: P35030-3) The sequence of this isoform differs from the canonical sequence as follows: 1-70: MCGPDDRCPA...DADGCEALGT → MNPFLILAFVGAA | ||||||
| Isoform D (identifier: P35030-4) The sequence of this isoform differs from the canonical sequence as follows: 1-71: MCGPDDRCPA...ADGCEALGTV → MHMRETSGFTLKKGRSAPLVFHPPDALI |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – ? | Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Propeptide | ? – 80 | Activation peptide | PRO_0000028201 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 81 – 304 | 224 | Trypsin-3 | PRO_0000028202 | |||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 81 – 301 | 221 | Peptidase S1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 120 | 1 | Charge relay system | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 164 | 1 | Charge relay system | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 257 | 1 | Charge relay system | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 132 | 1 | Calcium | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 134 | 1 | Calcium; via carbonyl oxygen | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 137 | 1 | Calcium; via carbonyl oxygen | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 142 | 1 | Calcium | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 251 | 1 | Required for specificity By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 211 | 1 | Sulfotyrosine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 87 ↔ 217 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 105 ↔ 121 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 196 ↔ 263 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 228 ↔ 242 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 253 ↔ 277 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 71 | 71 | MCGPD…ALGTV → MHMRETSGFTLKKGRSAPLV FHPPDALI in isoform D. | VSP_005409 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 70 | 70 | MCGPD…EALGT → MNPFLILAFVGAA in isoform C. | VSP_005410 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 45 | 45 | MCGPD…GGAGL → M in isoform B. | VSP_042074 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 174 | 1 | A → V. Corresponds to variant rs11547028 [ dbSNP | Ensembl ]. | VAR_067459 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 188 | 1 | T → A. Ref.1 Ref.2 Ref.3 Ref.4 Ref.6 Corresponds to variant rs855581 [ dbSNP | Ensembl ]. | VAR_046794 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 224 | 1 | T → S. Corresponds to variant rs1063273 [ dbSNP | Ensembl ]. | VAR_059788 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 232 | 1 | Y → C. Ref.2 Corresponds to variant rs1048379 [ dbSNP | Ensembl ]. | VAR_046795 | |||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 89 | 1 | Missing in CAA50484. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 224 – 225 | 2 | TQ → RE in CAA33527. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 253 – 254 | 2 | CQ → WK in CAA33527. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 89 – 91 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 95 – 111 | 17 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 114 – 117 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 119 – 121 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 127 – 131 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 133 – 137 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 143 – 152 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 158 – 160 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 166 – 172 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 177 – 180 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 195 – 201 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 206 – 208 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 216 – 222 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 225 – 231 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 233 – 235 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 240 – 244 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 246 – 249 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 254 – 258 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 260 – 263 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 266 – 273 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 275 – 278 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 284 – 288 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 289 – 292 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 293 – 302 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning of the cDNA encoding human brain trypsinogen and characterization of its product." Wiegand U., Corbach S., Minn A., Kang J., Mueller-Hill B. Gene 136:167-175(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A AND B), VARIANT ALA-188. Tissue: Brain. |
| [2] | "Nucleotide sequence of the human pancreatic trypsinogen III cDNA." Tani T., Kawashima I., Mita K., Takiguchi Y. Nucleic Acids Res. 18:1631-1631(1990) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM C), VARIANTS ALA-188 AND CYS-232. Tissue: Pancreas. |
| [3] | Fukuoka S. Submitted (FEB-1995) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM C), VARIANT ALA-188. |
| [4] | "Keratinocytes synthesize enteropeptidase and multiple forms of trypsinogen during terminal differentiation." Nakanishi J., Yamamoto M., Koyama J., Sato J., Hibino T. J. Invest. Dermatol. 130:944-952(2010) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], VARIANT ALA-188. |
| [5] | "DNA sequence and analysis of human chromosome 9." Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L. Dunham I.Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT ALA-188. |
| [7] | "Paneth cell trypsin is the processing enzyme for human defensin-5." Ghosh D., Porter E., Shen B., Lee S.K., Wilk D., Drazba J., Yadav S.P., Crabb J.W., Ganz T., Bevins C.L. Nat. Immunol. 3:583-590(2002) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY. |
| [8] | "Human mesotrypsin is a unique digestive protease specialized for the degradation of trypsin inhibitors." Szmola R., Kukor Z., Sahin-Toth M. J. Biol. Chem. 278:48580-48589(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [9] | "Crystal structure reveals basis for the inhibitor resistance of human brain trypsin." Katona G., Berglund G.I., Hajdu J., Graf L., Szilagyi L. J. Mol. Biol. 315:1209-1218(2002) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.7 ANGSTROMS) (ISOFORM A). |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | X72781 mRNA. Translation: CAB58178.1. X71345 mRNA. Translation: CAA50484.1. X15505 mRNA. Translation: CAA33527.1. D45417 mRNA. Translation: BAA08257.1. AB298285 mRNA. Translation: BAF80324.1. AL356489, AL139113, AL358573 Genomic DNA. Translation: CAH69873.1. AL358573, AL139113 Genomic DNA. Translation: CAI39514.1. AL358573, AL139113, AL356489 Genomic DNA. Translation: CAI39515.1. AL139113, AL358573 Genomic DNA. Translation: CAI39655.1. AL139113, AL356489, AL358573 Genomic DNA. Translation: CAI39658.1. CH471071 Genomic DNA. Translation: EAW58484.1. | ||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00015614. IPI00220839. IPI00843764. | ||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | S12764. S33496. | ||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001184026.2. NM_001197097.2. NP_002762.2. NM_002771.3. NP_031369.2. NM_007343.3. | ||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.654513. | ||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | P35030. | ||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | P35030. 2 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000354280. | ||||||||||||||||||||||||||||||||||||||||||||||||
Protein family/group databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| MEROPS | S01.174. | ||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | P35030. | ||||||||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| DMDM | 209572698. | ||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| PaxDb | P35030. | ||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | P35030. | ||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| DNASU | 5646. | ||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000342836; ENSP00000340889; ENSG00000010438. ENST00000361005; ENSP00000354280; ENSG00000010438. ENST00000379405; ENSP00000368715; ENSG00000010438. | ||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 5646. | ||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:5646. | ||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc003zti.4. human. uc003ztj.4. human. | ||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 5646. | ||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC09P033750. | ||||||||||||||||||||||||||||||||||||||||||||||||
| H-InvDB | HIX0035151. | ||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:9486. PRSS3. | ||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 613578. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_P35030. | ||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA33838. | ||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | COG5640. | ||||||||||||||||||||||||||||||||||||||||||||||||
| HOGENOM | HOG000251820. | ||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG013304. | ||||||||||||||||||||||||||||||||||||||||||||||||
| InParanoid | P35030. | ||||||||||||||||||||||||||||||||||||||||||||||||
| KO | K01312. | ||||||||||||||||||||||||||||||||||||||||||||||||
| OMA | GQITETM. | ||||||||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG4SJ5FV. | ||||||||||||||||||||||||||||||||||||||||||||||||
| PhylomeDB | P35030. | ||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_6900. Immune System. | ||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | P35030. | ||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | P35030. | ||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_PRSS3. | ||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | P35030. | ||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000010438. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR001254. Peptidase_S1. IPR018114. Peptidase_S1_AS. IPR001314. Peptidase_S1A. IPR009003. Trypsin-like_Pept_dom. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00089. Trypsin. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||
| PRINTS | PR00722. CHYMOTRYPSIN. | ||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00020. Tryp_SPc. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF50494. Pept_Ser_Cys. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS50240. TRYPSIN_DOM. 1 hit. PS00134. TRYPSIN_HIS. 1 hit. PS00135. TRYPSIN_SER. False negative. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||
| BindingDB | P35030. | ||||||||||||||||||||||||||||||||||||||||||||||||
| ChEMBL | CHEMBL4551. | ||||||||||||||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | P35030. | ||||||||||||||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 5646. | ||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 21934. | ||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | TRY3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P35030 Secondary accession number(s): A8CED1 Q9UQV3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Peptidase families Classification of peptidase families and list of entries |
| Human chromosome 9 Human chromosome 9: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
