P34998 (CRFR1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 117.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Corticotropin-releasing factor receptor 1 Short name=CRF-R-1 Short name=CRF-R1 Short name=CRFR-1 Alternative name(s): Corticotropin-releasing hormone receptor 1 Short name=CRH-R-1 Short name=CRH-R1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 444 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Receptor for corticotropin releasing factor (CRH). Shows high-affinity CRF binding. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Ref.11 |
| Subunit structure | Interacts (via N-terminal extracellular domain) with CRF and UCN. Ref.10 |
| Subcellular location | |
| Tissue specificity | Predominantly expressed in the cerebellum, pituitary, cerebral cortex and olfactory lobe. |
| Post-translational modification | C-terminal Ser or Thr residues may be phosphorylated. |
| Sequence similarities | Belongs to the G-protein coupled receptor 2 family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Signal Transmembrane Transmembrane helix |
| Molecular function | G-protein coupled receptor Receptor Transducer |
| PTM | Disulfide bond Glycoprotein Phosphoprotein |
| Technical term | 3D-structure Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological process | female pregnancy Non-traceable author statement. Source: ProtInc immune responseTraceable author statement. Source: ProtInc parturitionTraceable author statement. Source: ProtInc |
| Cellular component | integral to plasma membrane Traceable author statement. Source: ProtInc |
| Molecular function | corticotrophin-releasing factor receptor activity Traceable author statement. Source: ProtInc protein bindingInferred from physical interaction Ref.11. Source: IntAct |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| CRH | P06850 | 2 | EBI-3870393,EBI-3870390 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform CRF-R1 (identifier: P34998-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform CRF-R2 (identifier: P34998-2) The sequence of this isoform differs from the canonical sequence as follows: 146-174: Missing. | ||||||
| Note: Major isoform. | ||||||
| Isoform CRF-R3 (identifier: P34998-3) The sequence of this isoform differs from the canonical sequence as follows: 41-81: GLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTN → D 146-174: Missing. | ||||||
| Note: Does not bind to CRF with high affinity. | ||||||
| Isoform CRF-R4 (identifier: P34998-4) Also known as: 1D; The sequence of this isoform differs from the canonical sequence as follows: 146-174: Missing. 385-398: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||
Molecule processing | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 23 | 23 | Ref.9 | ||||||||||
| Chain | 24 – 444 | 421 | Corticotropin-releasing factor receptor 1 | PRO_0000012814 | |||||||||
Regions | |||||||||||||
| Topological domain | 24 – 121 | 98 | Extracellular Potential | ||||||||||
| Transmembrane | 122 – 142 | 21 | Helical; Name=1; Potential | ||||||||||
| Topological domain | 143 – 180 | 38 | Cytoplasmic Potential | ||||||||||
| Transmembrane | 181 – 200 | 20 | Helical; Name=2; Potential | ||||||||||
| Topological domain | 201 – 218 | 18 | Extracellular Potential | ||||||||||
| Transmembrane | 219 – 242 | 24 | Helical; Name=3; Potential | ||||||||||
| Topological domain | 243 – 256 | 14 | Cytoplasmic Potential | ||||||||||
| Transmembrane | 257 – 278 | 22 | Helical; Name=4; Potential | ||||||||||
| Topological domain | 279 – 297 | 19 | Extracellular Potential | ||||||||||
| Transmembrane | 298 – 320 | 23 | Helical; Name=5; Potential | ||||||||||
| Topological domain | 321 – 343 | 23 | Cytoplasmic Potential | ||||||||||
| Transmembrane | 344 – 363 | 20 | Helical; Name=6; Potential | ||||||||||
| Topological domain | 364 – 378 | 15 | Extracellular Potential | ||||||||||
| Transmembrane | 379 – 398 | 20 | Helical; Name=7; Potential | ||||||||||
| Topological domain | 399 – 444 | 46 | Cytoplasmic Potential | ||||||||||
Amino acid modifications | |||||||||||||
| Glycosylation | 38 | 1 | N-linked (GlcNAc...) Potential | ||||||||||
| Glycosylation | 45 | 1 | N-linked (GlcNAc...) Potential | ||||||||||
| Glycosylation | 78 | 1 | N-linked (GlcNAc...) Potential | ||||||||||
| Glycosylation | 90 | 1 | N-linked (GlcNAc...) Potential | ||||||||||
| Glycosylation | 98 | 1 | N-linked (GlcNAc...) Potential | ||||||||||
| Disulfide bond | 30 ↔ 54 | Ref.9 Ref.11 | |||||||||||
| Disulfide bond | 44 ↔ 87 | Ref.9 Ref.11 | |||||||||||
| Disulfide bond | 68 ↔ 102 | Ref.9 Ref.11 | |||||||||||
Natural variations | |||||||||||||
| Alternative sequence | 41 – 81 | 41 | GLQCN…YNTTN → D in isoform CRF-R3. | VSP_001996 | |||||||||
| Alternative sequence | 146 – 174 | 29 | Missing in isoform CRF-R2, isoform CRF-R3 and isoform CRF-R4. | VSP_001997 | |||||||||
| Alternative sequence | 385 – 398 | 14 | Missing in isoform CRF-R4. | VSP_001998 | |||||||||
Secondary structure | |||||||||||||
Helix Strand Turn | |||||||||||||
| Helix | 28 – 32 | 5 | |||||||||||
| Beta strand | 85 – 87 | 3 | |||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Expression cloning of a human corticotropin-releasing-factor receptor." Chen R., Lewis K.A., Perrin M.H., Vale W.W. Proc. Natl. Acad. Sci. U.S.A. 90:8967-8971(1993) [PubMed: 7692441] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS CRF-R1 AND CRF-R2). Tissue: Pituitary. |
| [2] | "Primary structure and functional expression of mouse pituitary and human brain corticotrophin releasing factor receptors." Vita N., Laurent P., Lefort S., Chalon P., Lelias J.-M., Kaghad M., le Fur G., Caput D., Ferrara P. FEBS Lett. 335:1-5(1993) [PubMed: 8243652] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM CRF-R2). Tissue: Brain. |
| [3] | "The genomic organization of the human corticotropin-releasing factor type-1 receptor." Sakai K., Yamada M., Horiba N., Wakui M., Demura H., Suda T. Gene 219:125-130(1998) [PubMed: 9757017] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [4] | "A variant of the human corticotropin-releasing factor (CRF) receptor: cloning, expression and pharmacology." Ross P.C., Kostas C.M., Ramabhadran T.V. Biochem. Biophys. Res. Commun. 205:1836-1842(1994) [PubMed: 7811272] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM CRF-R3). Tissue: Hippocampus. |
| [5] | "A novel spliced variant of the type 1 corticotropin-releasing hormone receptor with a deletion in the seventh transmembrane domain present in the human pregnant term myometrium and fetal membranes." Grammatopoulos D.K., Dai Y., Randeva H.S., Levine M.A., Karteris E., Easton A.J., Hillhouse E.W. Mol. Endocrinol. 13:2189-2202(1999) [PubMed: 10598591] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM CRF-R4). |
| [6] | "cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org)." King M.M., Aronstam R.S., Sharma S.V. Submitted (NOV-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM CRF-R2). Tissue: Brain. |
| [7] | "Human protein factory for converting the transcriptome into an in vitro-expressed proteome." Goshima N., Kawamura Y., Fukumoto A., Miura A., Honma R., Satoh R., Wakamatsu A., Yamamoto J., Kimura K., Nishikawa T., Andoh T., Iida Y., Ishikawa K., Ito E., Kagawa N., Kaminaga C., Kanehori K., Kawakami B. Nomura N.Nat. Methods 5:1011-1017(2008) [PubMed: 19054851] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM CRF-R2). |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM CRF-R2). |
| [9] | "Expression, purification, and characterization of a soluble form of the first extracellular domain of the human type 1 corticotropin releasing factor receptor." Perrin M.H., Fischer W.H., Kunitake K.S., Craig A.G., Koerber S.C., Cervini L.A., Rivier J.E., Groppe J.C., Greenwald J., Moller Nielsen S., Vale W.W. J. Biol. Chem. 276:31528-31534(2001) [PubMed: 11425856] [Abstract] Cited for: PROTEIN SEQUENCE OF 24-31, DISULFIDE BONDS. |
| [10] | "Structural basis for hormone recognition by the Human CRFR2{alpha} G protein-coupled receptor." Pal K., Swaminathan K., Xu H.E., Pioszak A.A. J. Biol. Chem. 285:40351-40361(2010) [PubMed: 20966082] [Abstract] Cited for: INTERACTION WITH CRF AND UCN. |
| [11] | "Molecular recognition of corticotropin-releasing factor by its G-protein-coupled receptor CRFR1." Pioszak A.A., Parker N.R., Suino-Powell K., Xu H.E. J. Biol. Chem. 283:32900-32912(2008) [PubMed: 18801728] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.96 ANGSTROMS) OF 24-119 IN COMPLEX WITH CRH, FUNCTION, DISULFIDE BONDS. |
| [12] | "NMR structure of the first extracellular domain of corticotropin-releasing factor receptor 1 (ECD1-CRF-R1) complexed with a high affinity agonist." Grace C.R., Perrin M.H., Gulyas J., Rivier J.E., Vale W.W., Riek R. J. Biol. Chem. 285:38580-38589(2010) [PubMed: 20843795] [Abstract] Cited for: STRUCTURE BY NMR OF 25-109 IN COMPLEX WITH SYNTHETIC AGONIST. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | L23333 mRNA. Translation: AAA35719.1. L23332 mRNA. Translation: AAA35718.1. X72304 mRNA. Translation: CAA51052.1. AF039523 AF039522 Genomic DNA. Translation: AAC69993.1.U16273 mRNA. Translation: AAC50073.1. AF180301 mRNA. Translation: AAD52688.1. AY457172 mRNA. Translation: AAR19768.1. AB451466 mRNA. Translation: BAG70280.1. BC096836 mRNA. Translation: AAH96836.1. | ||||||||||||||||||||||||||||||
| IPI | IPI00003083. IPI00219267. IPI00219268. IPI00219269. | ||||||||||||||||||||||||||||||
| PIR | I38879. A48260. I60975. | ||||||||||||||||||||||||||||||
| RefSeq | NP_001138618.1. NM_001145146.1. NP_001138619.1. NM_001145147.1. NP_001138620.1. NM_001145148.1. NP_004373.2. NM_004382.4. | ||||||||||||||||||||||||||||||
| UniGene | Hs.417628. | ||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||
| ProteinModelPortal | P34998. | ||||||||||||||||||||||||||||||
| SMR | P34998. Positions 24-108. | ||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||
| IntAct | P34998. 1 interaction. | ||||||||||||||||||||||||||||||
| MINT | MINT-1217325. | ||||||||||||||||||||||||||||||
| STRING | P34998. | ||||||||||||||||||||||||||||||
Protein family/group databases | |||||||||||||||||||||||||||||||
| GPCRDB | Search... | ||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||
| PhosphoSite | P34998. | ||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||
| DMDM | 461836. | ||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||
| PRIDE | P34998. | ||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||
| Ensembl | ENST00000398285; ENSP00000381333; ENSG00000120088. ENST00000456940; ENSP00000407078; ENSG00000226460. | ||||||||||||||||||||||||||||||
| GeneID | 1394. | ||||||||||||||||||||||||||||||
| KEGG | hsa:1394. | ||||||||||||||||||||||||||||||
| UCSC | uc002ijn.1. human. uc010dap.1. human. uc010dar.1. human. | ||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||
| CTD | 1394. | ||||||||||||||||||||||||||||||
| GeneCards | GC17P043699. | ||||||||||||||||||||||||||||||
| H-InvDB | HIX0027131. | ||||||||||||||||||||||||||||||
| HGNC | HGNC:2357. CRHR1. | ||||||||||||||||||||||||||||||
| MIM | 122561. gene. | ||||||||||||||||||||||||||||||
| neXtProt | NX_P34998. | ||||||||||||||||||||||||||||||
| PharmGKB | PA26874. | ||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||
| eggNOG | prNOG04138. | ||||||||||||||||||||||||||||||
| GeneTree | ENSGT00580000081433. | ||||||||||||||||||||||||||||||
| HOVERGEN | HBG106921. | ||||||||||||||||||||||||||||||
| OrthoDB | EOG4DBTDQ. | ||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||
| Reactome | REACT_111102. Signal Transduction. | ||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||
| Bgee | P34998. | ||||||||||||||||||||||||||||||
| CleanEx | HS_CRHR1. | ||||||||||||||||||||||||||||||
| Genevestigator | P34998. | ||||||||||||||||||||||||||||||
| GermOnline | ENSG00000120088. Homo sapiens. | ||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||
| InterPro | IPR017981. GPCR_2-like. IPR003052. GPCR_2_CRF1_rcpt. IPR003051. GPCR_2_CRF_rcpt. IPR001879. GPCR_2_extracellular_dom. IPR000832. GPCR_2_secretin-like. IPR017983. GPCR_2_secretin-like_CS. [Graphical view] | ||||||||||||||||||||||||||||||
| KO | K04578. | ||||||||||||||||||||||||||||||
| PANTHER | PTHR12011:SF73. CRF_rcpt. 1 hit. | ||||||||||||||||||||||||||||||
| Pfam | PF00002. 7tm_2. 1 hit. PF02793. HRM. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||
| PRINTS | PR01279. CRFRECEPTOR. PR01280. CRFRECEPTOR1. PR00249. GPCRSECRETIN. | ||||||||||||||||||||||||||||||
| SMART | SM00008. HormR. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||
| PROSITE | PS00649. G_PROTEIN_RECEP_F2_1. 1 hit. PS00650. G_PROTEIN_RECEP_F2_2. 1 hit. PS50227. G_PROTEIN_RECEP_F2_3. 1 hit. PS50261. G_PROTEIN_RECEP_F2_4. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||
| NextBio | 5703. | ||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||
Entry information
| Entry name | CRFR1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P34998 Secondary accession number(s): Q13008, Q4QRJ1, Q9UK64 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| 7-transmembrane G-linked receptors List of 7-transmembrane G-linked receptor entries |
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with