SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P34998

- CRFR1_HUMAN

UniProt

P34998 - CRFR1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Corticotropin-releasing factor receptor 1

Gene
CRHR1, CRFR, CRFR1, CRHR
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

G-protein coupled receptor for CRH (corticotropin-releasing factor) and UCN (urocortin). Has high affinity for CRH and UCN. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and down-stream effectors, such as adenylate cyclase. Promotes the activation of adenylate cyclase, leading to increased intracellular cAMP levels. Inhibits the activity of the calcium channel CACNA1H. Required for normal embryonic development of the adrenal gland and for normal hormonal responses to stress. Plays a role in the response to anxiogenic stimuli.4 Publications

GO - Molecular functioni

  1. corticotrophin-releasing factor receptor activity Source: UniProtKB
  2. corticotropin-releasing hormone binding Source: Ensembl
  3. corticotropin-releasing hormone receptor activity Source: Ensembl
  4. protein binding Source: IntAct

GO - Biological processi

  1. activation of adenylate cyclase activity Source: ProtInc
  2. adrenal gland development Source: Ensembl
  3. behavioral response to cocaine Source: Ensembl
  4. behavioral response to ethanol Source: Ensembl
  5. behavioral response to pain Source: Ensembl
  6. cellular response to corticotropin-releasing hormone stimulus Source: UniProtKB
  7. corticotropin secretion Source: UniProtKB
  8. epithelial cell differentiation Source: Ensembl
  9. fear response Source: Ensembl
  10. female pregnancy Source: ProtInc
  11. general adaptation syndrome, behavioral process Source: Ensembl
  12. hypothalamus development Source: Ensembl
  13. immune response Source: ProtInc
  14. locomotory exploration behavior Source: Ensembl
  15. long-term synaptic potentiation Source: Ensembl
  16. memory Source: Ensembl
  17. negative regulation of epinephrine secretion Source: Ensembl
  18. negative regulation of feeding behavior Source: Ensembl
  19. negative regulation of neuron death Source: Ensembl
  20. negative regulation of voltage-gated calcium channel activity Source: UniProtKB
  21. neuropeptide signaling pathway Source: Ensembl
  22. parturition Source: ProtInc
  23. phospholipase C-activating G-protein coupled receptor signaling pathway Source: Ensembl
  24. positive regulation of adenylate cyclase activity involved in G-protein coupled receptor signaling pathway Source: UniProtKB
  25. positive regulation of cytosolic calcium ion concentration Source: Ensembl
  26. positive regulation of mast cell degranulation Source: Ensembl
  27. regulation of adenylate cyclase activity involved in G-protein coupled receptor signaling pathway Source: UniProtKB
  28. regulation of corticosterone secretion Source: UniProtKB
  29. response to hypoxia Source: Ensembl
  30. response to immobilization stress Source: Ensembl
  31. visual learning Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

ReactomeiREACT_18372. Class B/2 (Secretin family receptors).
REACT_19327. G alpha (s) signalling events.

Protein family/group databases

TCDBi9.A.14.4.3. the g-protein-coupled receptor (gpcr) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Corticotropin-releasing factor receptor 1
Short name:
CRF-R-1
Short name:
CRF-R1
Short name:
CRFR-1
Alternative name(s):
Corticotropin-releasing hormone receptor 1
Short name:
CRH-R-1
Short name:
CRH-R1
Gene namesi
Name:CRHR1
Synonyms:CRFR, CRFR1, CRHR
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 17

Organism-specific databases

HGNCiHGNC:2357. CRHR1.

Subcellular locationi

Cell membrane; Multi-pass membrane protein. Endosome
Note: Agonist-binding promotes endocytosis.3 Publications

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini24 – 11188Extracellular1 PublicationAdd
BLAST
Transmembranei112 – 14231Helical; Name=1Add
BLAST
Topological domaini143 – 17836Cytoplasmic1 PublicationAdd
BLAST
Transmembranei179 – 20325Helical; Name=2Add
BLAST
Topological domaini204 – 21815Extracellular1 PublicationAdd
BLAST
Transmembranei219 – 24729Helical; Name=3Add
BLAST
Topological domaini248 – 2547Cytoplasmic1 Publication
Transmembranei255 – 28228Helical; Name=4Add
BLAST
Topological domaini283 – 29816Extracellular1 PublicationAdd
BLAST
Transmembranei299 – 32426Helical; Name=5Add
BLAST
Topological domaini325 – 33511Cytoplasmic1 PublicationAdd
BLAST
Transmembranei336 – 36025Helical; Name=6Add
BLAST
Topological domaini361 – 3677Extracellular1 Publication
Transmembranei368 – 39730Helical; Name=7Add
BLAST
Topological domaini398 – 44447Cytoplasmic1 PublicationAdd
BLAST

GO - Cellular componenti

  1. apical part of cell Source: Ensembl
  2. dendrite Source: Ensembl
  3. integral component of membrane Source: UniProtKB
  4. integral component of plasma membrane Source: ProtInc
  5. intrinsic component of plasma membrane Source: UniProtKB
  6. multivesicular body Source: Ensembl
  7. neuronal cell body Source: Ensembl
  8. plasma membrane Source: Reactome
  9. trans-Golgi network Source: Ensembl
  10. vesicle Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Endosome, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi232 – 2321F → A: Nearly abolishes antagonist binding. 1 Publication
Mutagenesisi235 – 2351M → A: Strongly reduces antagonist binding. 1 Publication
Mutagenesisi309 – 3091L → A: Nearly abolishes antagonist binding. 1 Publication
Mutagenesisi312 – 3121N → A: Nearly abolishes antagonist binding. 1 Publication
Mutagenesisi313 – 3131F → A: Slightly reduces antagonist binding. 1 Publication
Mutagenesisi316 – 3161L → A: Strongly reduces antagonist binding. 1 Publication
Mutagenesisi319 – 3191I → A: Strongly reduces antagonist binding. 1 Publication
Mutagenesisi356 – 3561Y → A: Strongly reduces antagonist binding. 1 Publication
Mutagenesisi384 – 3841Q → A: Increases antagonist binding. 1 Publication

Organism-specific databases

PharmGKBiPA26874.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 23231 PublicationAdd
BLAST
Chaini24 – 444421Corticotropin-releasing factor receptor 1PRO_0000012814Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi30 ↔ 543 Publications
Glycosylationi38 – 381N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi44 ↔ 873 Publications
Glycosylationi45 – 451N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi68 ↔ 1023 Publications
Glycosylationi78 – 781N-linked (GlcNAc...) Reviewed prediction
Glycosylationi90 – 901N-linked (GlcNAc...) Reviewed prediction
Glycosylationi98 – 981N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi217 ↔ 2873 Publications
Modified residuei330 – 3301Phosphoserine; by PKA1 Publication

Post-translational modificationi

C-terminal Ser or Thr residues may be phosphorylated.1 Publication
Phosphorylation at Ser-330 by PKA prevents maximal coupling to Gq-protein, and thereby negatively regulates downstream signaling.

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiP34998.
PRIDEiP34998.

PTM databases

PhosphoSiteiP34998.

Expressioni

Tissue specificityi

Predominantly expressed in the cerebellum, pituitary, cerebral cortex and olfactory lobe.1 Publication

Gene expression databases

ArrayExpressiP34998.
BgeeiP34998.
CleanExiHS_CRHR1.
GenevestigatoriP34998.

Interactioni

Subunit structurei

Heterodimer; heterodimerizes with GPER1 By similarity. Interacts (via N-terminal extracellular domain) with CRH and UCN. Interacts with DLG1; this inhibits endocytosis of CRHR1 after agonist binding.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
CRHP068502EBI-3870393,EBI-3870390

Protein-protein interaction databases

BioGridi107784. 8 interactions.
IntActiP34998. 2 interactions.
MINTiMINT-1217325.
STRINGi9606.ENSP00000381333.

Structurei

Secondary structure

1
444
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi28 – 325
Beta strandi49 – 524
Beta strandi62 – 676
Beta strandi70 – 745
Beta strandi81 – 877
Turni89 – 913
Beta strandi93 – 986
Helixi99 – 1013
Helixi103 – 1075
Helixi116 – 14328
Helixi175 – 1773
Helixi179 – 20527
Helixi207 – 2126
Helixi215 – 23723
Helixi239 – 24810
Helixi250 – 2534
Helixi257 – 2593
Helixi270 – 29627
Helixi304 – 33128
Helixi339 – 36729
Helixi374 – 3829
Helixi384 – 39512

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2L27NMR-A25-108[»]
3EHSX-ray2.76A24-119[»]
3EHTX-ray3.40A24-119[»]
3EHUX-ray1.96A/B24-119[»]
4K5YX-ray2.98A/B/C104-373[»]
ProteinModelPortaliP34998.
SMRiP34998. Positions 24-108, 117-397.

Miscellaneous databases

EvolutionaryTraceiP34998.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni99 – 10810Important for peptide agonist binding
Regioni309 – 31911Important for antagonist bindingAdd
BLAST

Domaini

The transmembrane domain is composed of seven transmembrane helices that are arranged in V-shape. Transmembrane helix 7 assumes a sharply kinked structure. The antagonist CP-376395 binds at an allosteric site, far from the presumed binding site for the physiological peptide ligand.

Sequence similaritiesi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG295825.
HOGENOMiHOG000230719.
HOVERGENiHBG106921.
KOiK04578.
OMAiVGWCRLV.
PhylomeDBiP34998.
TreeFamiTF315710.

Family and domain databases

InterProiIPR017981. GPCR_2-like.
IPR003052. GPCR_2_CRF1_rcpt.
IPR003051. GPCR_2_CRF_rcpt.
IPR001879. GPCR_2_extracellular_dom.
IPR000832. GPCR_2_secretin-like.
IPR017983. GPCR_2_secretin-like_CS.
[Graphical view]
PfamiPF00002. 7tm_2. 1 hit.
PF02793. HRM. 1 hit.
[Graphical view]
PRINTSiPR01279. CRFRECEPTOR.
PR01280. CRFRECEPTOR1.
PR00249. GPCRSECRETIN.
SMARTiSM00008. HormR. 1 hit.
[Graphical view]
PROSITEiPS00649. G_PROTEIN_RECEP_F2_1. 1 hit.
PS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
PS50227. G_PROTEIN_RECEP_F2_3. 1 hit.
PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform CRF-R1 (identifier: P34998-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MGGHPQLRLV KALLLLGLNP VSASLQDQHC ESLSLASNIS GLQCNASVDL    50
IGTCWPRSPA GQLVVRPCPA FFYGVRYNTT NNGYRECLAN GSWAARVNYS 100
ECQEILNEEK KSKVHYHVAV IINYLGHCIS LVALLVAFVL FLRLRPGCTH 150
WGDQADGALE VGAPWSGAPF QVRRSIRCLR NIIHWNLISA FILRNATWFV 200
VQLTMSPEVH QSNVGWCRLV TAAYNYFHVT NFFWMFGEGC YLHTAIVLTY 250
STDRLRKWMF ICIGWGVPFP IIVAWAIGKL YYDNEKCWFG KRPGVYTDYI 300
YQGPMILVLL INFIFLFNIV RILMTKLRAS TTSETIQYRK AVKATLVLLP 350
LLGITYMLFF VNPGEDEVSR VVFIYFNSFL ESFQGFFVSV FYCFLNSEVR 400
SAIRKRWHRW QDKHSIRARV ARAMSIPTSP TRVSFHSIKQ STAV 444
Length:444
Mass (Da):50,719
Last modified:February 1, 1994 - v1
Checksum:i7221AEFB0E7AA8ED
GO
Isoform CRF-R2 (identifier: P34998-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     146-174: Missing.

Note: Major isoform.

Show »
Length:415
Mass (Da):47,671
Checksum:i81445283CCE34C6E
GO
Isoform CRF-R3 (identifier: P34998-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     41-81: GLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTN → D
     146-174: Missing.

Note: Does not bind to CRF with high affinity.

Show »
Length:375
Mass (Da):43,331
Checksum:i6A2068BE9386F8B0
GO
Isoform CRF-R4 (identifier: P34998-4) [UniParc]FASTAAdd to Basket

Also known as: 1D

The sequence of this isoform differs from the canonical sequence as follows:
     146-174: Missing.
     385-398: Missing.

Show »
Length:401
Mass (Da):46,030
Checksum:i3D8FF9B128810372
GO
Isoform 5 (identifier: P34998-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-204: Missing.

Show »
Length:240
Mass (Da):28,122
Checksum:iF4465F15BF7C52E4
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 204204Missing in isoform 5. VSP_045434Add
BLAST
Alternative sequencei41 – 8141GLQCN…YNTTN → D in isoform CRF-R3. VSP_001996Add
BLAST
Alternative sequencei146 – 17429Missing in isoform CRF-R2, isoform CRF-R3 and isoform CRF-R4. VSP_001997Add
BLAST
Alternative sequencei385 – 39814Missing in isoform CRF-R4. VSP_001998Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
L23333 mRNA. Translation: AAA35719.1.
L23332 mRNA. Translation: AAA35718.1.
X72304 mRNA. Translation: CAA51052.1.
AF039523
, AF039510, AF039511, AF039512, AF039513, AF039514, AF039515, AF039516, AF039517, AF039518, AF039519, AF039520, AF039521, AF039522 Genomic DNA. Translation: AAC69993.1.
U16273 mRNA. Translation: AAC50073.1.
AF180301 mRNA. Translation: AAD52688.1.
FJ543100 mRNA. Translation: ACU68591.1.
AY457172 mRNA. Translation: AAR19768.1.
AB451466 mRNA. Translation: BAG70280.1.
AK295559 mRNA. Translation: BAG58461.1.
AC126544 Genomic DNA. No translation available.
AC217770 Genomic DNA. No translation available.
AC217771 Genomic DNA. No translation available.
AC217774 Genomic DNA. No translation available.
AC225613 Genomic DNA. No translation available.
CH471233 Genomic DNA. Translation: EAW93557.1.
BC096836 mRNA. Translation: AAH96836.1.
CCDSiCCDS42350.1. [P34998-2]
CCDS45712.1. [P34998-1]
CCDS45713.1. [P34998-4]
CCDS45714.1. [P34998-3]
CCDS58556.1. [P34998-5]
PIRiI38879.
I60975. A48260.
RefSeqiNP_001138618.1. NM_001145146.1. [P34998-1]
NP_001138619.1. NM_001145147.1. [P34998-3]
NP_001138620.1. NM_001145148.1. [P34998-4]
NP_001243228.1. NM_001256299.1. [P34998-5]
NP_004373.2. NM_004382.4. [P34998-2]
UniGeneiHs.417628.

Genome annotation databases

EnsembliENST00000293493; ENSP00000293493; ENSG00000120088. [P34998-5]
ENST00000314537; ENSP00000326060; ENSG00000120088. [P34998-2]
ENST00000352855; ENSP00000344068; ENSG00000120088. [P34998-3]
ENST00000398285; ENSP00000381333; ENSG00000120088. [P34998-1]
ENST00000577353; ENSP00000462016; ENSG00000120088. [P34998-4]
GeneIDi1394.
KEGGihsa:1394.
UCSCiuc002ijm.3. human. [P34998-2]
uc002ijn.3. human. [P34998-3]
uc002ijo.2. human. [P34998-1]
uc010dar.3. human. [P34998-4]

Polymorphism databases

DMDMi461836.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
L23333 mRNA. Translation: AAA35719.1 .
L23332 mRNA. Translation: AAA35718.1 .
X72304 mRNA. Translation: CAA51052.1 .
AF039523
, AF039510 , AF039511 , AF039512 , AF039513 , AF039514 , AF039515 , AF039516 , AF039517 , AF039518 , AF039519 , AF039520 , AF039521 , AF039522 Genomic DNA. Translation: AAC69993.1 .
U16273 mRNA. Translation: AAC50073.1 .
AF180301 mRNA. Translation: AAD52688.1 .
FJ543100 mRNA. Translation: ACU68591.1 .
AY457172 mRNA. Translation: AAR19768.1 .
AB451466 mRNA. Translation: BAG70280.1 .
AK295559 mRNA. Translation: BAG58461.1 .
AC126544 Genomic DNA. No translation available.
AC217770 Genomic DNA. No translation available.
AC217771 Genomic DNA. No translation available.
AC217774 Genomic DNA. No translation available.
AC225613 Genomic DNA. No translation available.
CH471233 Genomic DNA. Translation: EAW93557.1 .
BC096836 mRNA. Translation: AAH96836.1 .
CCDSi CCDS42350.1. [P34998-2 ]
CCDS45712.1. [P34998-1 ]
CCDS45713.1. [P34998-4 ]
CCDS45714.1. [P34998-3 ]
CCDS58556.1. [P34998-5 ]
PIRi I38879.
I60975. A48260.
RefSeqi NP_001138618.1. NM_001145146.1. [P34998-1 ]
NP_001138619.1. NM_001145147.1. [P34998-3 ]
NP_001138620.1. NM_001145148.1. [P34998-4 ]
NP_001243228.1. NM_001256299.1. [P34998-5 ]
NP_004373.2. NM_004382.4. [P34998-2 ]
UniGenei Hs.417628.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2L27 NMR - A 25-108 [» ]
3EHS X-ray 2.76 A 24-119 [» ]
3EHT X-ray 3.40 A 24-119 [» ]
3EHU X-ray 1.96 A/B 24-119 [» ]
4K5Y X-ray 2.98 A/B/C 104-373 [» ]
ProteinModelPortali P34998.
SMRi P34998. Positions 24-108, 117-397.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 107784. 8 interactions.
IntActi P34998. 2 interactions.
MINTi MINT-1217325.
STRINGi 9606.ENSP00000381333.

Chemistry

BindingDBi P34998.
ChEMBLi CHEMBL1800.
GuidetoPHARMACOLOGYi 212.

Protein family/group databases

TCDBi 9.A.14.4.3. the g-protein-coupled receptor (gpcr) family.
GPCRDBi Search...

PTM databases

PhosphoSitei P34998.

Polymorphism databases

DMDMi 461836.

Proteomic databases

PaxDbi P34998.
PRIDEi P34998.

Protocols and materials databases

DNASUi 1394.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000293493 ; ENSP00000293493 ; ENSG00000120088 . [P34998-5 ]
ENST00000314537 ; ENSP00000326060 ; ENSG00000120088 . [P34998-2 ]
ENST00000352855 ; ENSP00000344068 ; ENSG00000120088 . [P34998-3 ]
ENST00000398285 ; ENSP00000381333 ; ENSG00000120088 . [P34998-1 ]
ENST00000577353 ; ENSP00000462016 ; ENSG00000120088 . [P34998-4 ]
GeneIDi 1394.
KEGGi hsa:1394.
UCSCi uc002ijm.3. human. [P34998-2 ]
uc002ijn.3. human. [P34998-3 ]
uc002ijo.2. human. [P34998-1 ]
uc010dar.3. human. [P34998-4 ]

Organism-specific databases

CTDi 1394.
GeneCardsi GC17P043704.
HGNCi HGNC:2357. CRHR1.
MIMi 122561. gene.
neXtProti NX_P34998.
PharmGKBi PA26874.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG295825.
HOGENOMi HOG000230719.
HOVERGENi HBG106921.
KOi K04578.
OMAi VGWCRLV.
PhylomeDBi P34998.
TreeFami TF315710.

Enzyme and pathway databases

Reactomei REACT_18372. Class B/2 (Secretin family receptors).
REACT_19327. G alpha (s) signalling events.

Miscellaneous databases

EvolutionaryTracei P34998.
GeneWikii Corticotropin_releasing_hormone_receptor_1.
GenomeRNAii 1394.
NextBioi 5703.
PROi P34998.
SOURCEi Search...

Gene expression databases

ArrayExpressi P34998.
Bgeei P34998.
CleanExi HS_CRHR1.
Genevestigatori P34998.

Family and domain databases

InterProi IPR017981. GPCR_2-like.
IPR003052. GPCR_2_CRF1_rcpt.
IPR003051. GPCR_2_CRF_rcpt.
IPR001879. GPCR_2_extracellular_dom.
IPR000832. GPCR_2_secretin-like.
IPR017983. GPCR_2_secretin-like_CS.
[Graphical view ]
Pfami PF00002. 7tm_2. 1 hit.
PF02793. HRM. 1 hit.
[Graphical view ]
PRINTSi PR01279. CRFRECEPTOR.
PR01280. CRFRECEPTOR1.
PR00249. GPCRSECRETIN.
SMARTi SM00008. HormR. 1 hit.
[Graphical view ]
PROSITEi PS00649. G_PROTEIN_RECEP_F2_1. 1 hit.
PS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
PS50227. G_PROTEIN_RECEP_F2_3. 1 hit.
PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Expression cloning of a human corticotropin-releasing-factor receptor."
    Chen R., Lewis K.A., Perrin M.H., Vale W.W.
    Proc. Natl. Acad. Sci. U.S.A. 90:8967-8971(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS CRF-R1 AND CRF-R2).
    Tissue: Pituitary.
  2. "Primary structure and functional expression of mouse pituitary and human brain corticotrophin releasing factor receptors."
    Vita N., Laurent P., Lefort S., Chalon P., Lelias J.-M., Kaghad M., le Fur G., Caput D., Ferrara P.
    FEBS Lett. 335:1-5(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM CRF-R2), TISSUE SPECIFICITY.
    Tissue: Brain.
  3. "The genomic organization of the human corticotropin-releasing factor type-1 receptor."
    Sakai K., Yamada M., Horiba N., Wakui M., Demura H., Suda T.
    Gene 219:125-130(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  4. "A variant of the human corticotropin-releasing factor (CRF) receptor: cloning, expression and pharmacology."
    Ross P.C., Kostas C.M., Ramabhadran T.V.
    Biochem. Biophys. Res. Commun. 205:1836-1842(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM CRF-R3).
    Tissue: Hippocampus.
  5. "A novel spliced variant of the type 1 corticotropin-releasing hormone receptor with a deletion in the seventh transmembrane domain present in the human pregnant term myometrium and fetal membranes."
    Grammatopoulos D.K., Dai Y., Randeva H.S., Levine M.A., Karteris E., Easton A.J., Hillhouse E.W.
    Mol. Endocrinol. 13:2189-2202(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM CRF-R4).
  6. "A novel CRF1 splice isoform involved in neurodegenerative and stress disorders."
    Sherrin T., Murthy S.R., Spiess J.
    Submitted (DEC-2008) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5).
  7. "cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org)."
    King M.M., Aronstam R.S., Sharma S.V.
    Submitted (NOV-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM CRF-R2).
    Tissue: Brain.
  8. "Human protein factory for converting the transcriptome into an in vitro-expressed proteome."
    Goshima N., Kawamura Y., Fukumoto A., Miura A., Honma R., Satoh R., Wakamatsu A., Yamamoto J., Kimura K., Nishikawa T., Andoh T., Iida Y., Ishikawa K., Ito E., Kagawa N., Kaminaga C., Kanehori K., Kawakami B.
    , Kenmochi K., Kimura R., Kobayashi M., Kuroita T., Kuwayama H., Maruyama Y., Matsuo K., Minami K., Mitsubori M., Mori M., Morishita R., Murase A., Nishikawa A., Nishikawa S., Okamoto T., Sakagami N., Sakamoto Y., Sasaki Y., Seki T., Sono S., Sugiyama A., Sumiya T., Takayama T., Takayama Y., Takeda H., Togashi T., Yahata K., Yamada H., Yanagisawa Y., Endo Y., Imamoto F., Kisu Y., Tanaka S., Isogai T., Imai J., Watanabe S., Nomura N.
    Nat. Methods 5:1011-1017(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM CRF-R2).
  9. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
    Tissue: Hippocampus.
  10. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  11. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  12. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM CRF-R2).
  13. "Expression, purification, and characterization of a soluble form of the first extracellular domain of the human type 1 corticotropin releasing factor receptor."
    Perrin M.H., Fischer W.H., Kunitake K.S., Craig A.G., Koerber S.C., Cervini L.A., Rivier J.E., Groppe J.C., Greenwald J., Moller Nielsen S., Vale W.W.
    J. Biol. Chem. 276:31528-31534(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 24-31, DISULFIDE BONDS.
  14. "Protein kinase A-induced negative regulation of the corticotropin-releasing hormone R1alpha receptor-extracellularly regulated kinase signal transduction pathway: the critical role of Ser301 for signaling switch and selectivity."
    Papadopoulou N., Chen J., Randeva H.S., Levine M.A., Hillhouse E.W., Grammatopoulos D.K.
    Mol. Endocrinol. 18:624-639(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION AT SER-330.
  15. "Activation of corticotropin-releasing factor receptor 1 selectively inhibits CaV3.2 T-type calcium channels."
    Tao J., Hildebrand M.E., Liao P., Liang M.C., Tan G., Li S., Snutch T.P., Soong T.W.
    Mol. Pharmacol. 73:1596-1609(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION.
  16. "Structural basis for hormone recognition by the Human CRFR2{alpha} G protein-coupled receptor."
    Pal K., Swaminathan K., Xu H.E., Pioszak A.A.
    J. Biol. Chem. 285:40351-40361(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH CRF AND UCN.
  17. "Role of SAP97 protein in the regulation of corticotropin-releasing factor receptor 1 endocytosis and extracellular signal-regulated kinase 1/2 signaling."
    Dunn H.A., Walther C., Godin C.M., Hall R.A., Ferguson S.S.
    J. Biol. Chem. 288:15023-15034(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH DLG1.
  18. "Molecular recognition of corticotropin-releasing factor by its G-protein-coupled receptor CRFR1."
    Pioszak A.A., Parker N.R., Suino-Powell K., Xu H.E.
    J. Biol. Chem. 283:32900-32912(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (1.96 ANGSTROMS) OF 24-119 IN COMPLEX WITH CRH, FUNCTION, DISULFIDE BONDS.
  19. "NMR structure of the first extracellular domain of corticotropin-releasing factor receptor 1 (ECD1-CRF-R1) complexed with a high affinity agonist."
    Grace C.R., Perrin M.H., Gulyas J., Rivier J.E., Vale W.W., Riek R.
    J. Biol. Chem. 285:38580-38589(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: STRUCTURE BY NMR OF 25-109 IN COMPLEX WITH SYNTHETIC CRH ANALOG.
  20. "Structure of class B GPCR corticotropin-releasing factor receptor 1."
    Hollenstein K., Kean J., Bortolato A., Cheng R.K., Dore A.S., Jazayeri A., Cooke R.M., Weir M., Marshall F.H.
    Nature 499:438-443(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.98 ANGSTROMS) OF 104-373 IN COMPLEX WITH THE SYNTHETIC ANTAGONIST CP-376395, FUNCTION, SUBCELLULAR LOCATION, MEMBRANE TOPOLOGY, DISULFIDE BOND, ANTAGONIST BINDING SITES, MUTAGENESIS OF PHE-232; MET-235; LEU-309; ASN-312; PHE-313; LEU-316; ILE-319; TYR-356 AND GLN-384.

Entry informationi

Entry nameiCRFR1_HUMAN
AccessioniPrimary (citable) accession number: P34998
Secondary accession number(s): B4DIE9
, Q13008, Q4QRJ1, Q9UK64
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: February 1, 1994
Last modified: September 3, 2014
This is version 145 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi