Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Corticotropin-releasing factor receptor 1

Gene

CRHR1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

G-protein coupled receptor for CRH (corticotropin-releasing factor) and UCN (urocortin). Has high affinity for CRH and UCN. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and down-stream effectors, such as adenylate cyclase. Promotes the activation of adenylate cyclase, leading to increased intracellular cAMP levels. Inhibits the activity of the calcium channel CACNA1H. Required for normal embryonic development of the adrenal gland and for normal hormonal responses to stress. Plays a role in the response to anxiogenic stimuli.4 Publications

GO - Molecular functioni

  • corticotrophin-releasing factor receptor activity Source: UniProtKB

GO - Biological processi

  • activation of adenylate cyclase activity Source: ProtInc
  • cell surface receptor signaling pathway Source: InterPro
  • cellular response to corticotropin-releasing hormone stimulus Source: UniProtKB
  • corticotropin secretion Source: UniProtKB
  • female pregnancy Source: ProtInc
  • immune response Source: ProtInc
  • negative regulation of voltage-gated calcium channel activity Source: UniProtKB
  • parturition Source: ProtInc
  • positive regulation of adenylate cyclase activity involved in G-protein coupled receptor signaling pathway Source: UniProtKB
  • regulation of adenylate cyclase activity involved in G-protein coupled receptor signaling pathway Source: UniProtKB
  • regulation of corticosterone secretion Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

BioCyciZFISH:ENSG00000120088-MONOMER.
ReactomeiR-HSA-373080. Class B/2 (Secretin family receptors).
R-HSA-418555. G alpha (s) signalling events.
SIGNORiP34998.

Protein family/group databases

TCDBi9.A.14.4.3. the g-protein-coupled receptor (gpcr) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Corticotropin-releasing factor receptor 1
Short name:
CRF-R-1
Short name:
CRF-R1
Short name:
CRFR-1
Alternative name(s):
Corticotropin-releasing hormone receptor 1
Short name:
CRH-R-1
Short name:
CRH-R1
Gene namesi
Name:CRHR1
Synonyms:CRFR, CRFR1, CRHR
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:2357. CRHR1.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini24 – 111ExtracellularAdd BLAST88
Transmembranei112 – 142Helical; Name=1Add BLAST31
Topological domaini143 – 178CytoplasmicAdd BLAST36
Transmembranei179 – 203Helical; Name=2Add BLAST25
Topological domaini204 – 218ExtracellularAdd BLAST15
Transmembranei219 – 247Helical; Name=3Add BLAST29
Topological domaini248 – 254Cytoplasmic7
Transmembranei255 – 282Helical; Name=4Add BLAST28
Topological domaini283 – 298ExtracellularAdd BLAST16
Transmembranei299 – 324Helical; Name=5Add BLAST26
Topological domaini325 – 335CytoplasmicAdd BLAST11
Transmembranei336 – 360Helical; Name=6Add BLAST25
Topological domaini361 – 367Extracellular7
Transmembranei368 – 397Helical; Name=7Add BLAST30
Topological domaini398 – 444CytoplasmicAdd BLAST47

GO - Cellular componenti

  • endosome Source: UniProtKB-SubCell
  • integral component of membrane Source: UniProtKB
  • integral component of plasma membrane Source: ProtInc
  • intrinsic component of plasma membrane Source: UniProtKB
  • plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Endosome, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi232F → A: Nearly abolishes antagonist binding. 1 Publication1
Mutagenesisi235M → A: Strongly reduces antagonist binding. 1 Publication1
Mutagenesisi309L → A: Nearly abolishes antagonist binding. 1 Publication1
Mutagenesisi312N → A: Nearly abolishes antagonist binding. 1 Publication1
Mutagenesisi313F → A: Slightly reduces antagonist binding. 1 Publication1
Mutagenesisi316L → A: Strongly reduces antagonist binding. 1 Publication1
Mutagenesisi319I → A: Strongly reduces antagonist binding. 1 Publication1
Mutagenesisi356Y → A: Strongly reduces antagonist binding. 1 Publication1
Mutagenesisi384Q → A: Increases antagonist binding. 1 Publication1

Organism-specific databases

DisGeNETi1394.
OpenTargetsiENSG00000120088.
ENSG00000263715.
ENSG00000276191.
ENSG00000278232.
PharmGKBiPA26874.

Chemistry databases

ChEMBLiCHEMBL1800.
GuidetoPHARMACOLOGYi212.

Polymorphism and mutation databases

BioMutaiCRHR1.
DMDMi461836.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 231 PublicationAdd BLAST23
ChainiPRO_000001281424 – 444Corticotropin-releasing factor receptor 1Add BLAST421

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi30 ↔ 54
Glycosylationi38N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi44 ↔ 87
Glycosylationi45N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi68 ↔ 102
Glycosylationi78N-linked (GlcNAc...)Sequence analysis1
Glycosylationi90N-linked (GlcNAc...)Sequence analysis1
Glycosylationi98N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi217 ↔ 287
Modified residuei330Phosphoserine; by PKA1 Publication1

Post-translational modificationi

C-terminal Ser or Thr residues may be phosphorylated.1 Publication
Phosphorylation at Ser-330 by PKA prevents maximal coupling to Gq-protein, and thereby negatively regulates downstream signaling.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiP34998.
PeptideAtlasiP34998.
PRIDEiP34998.

PTM databases

iPTMnetiP34998.
PhosphoSitePlusiP34998.

Expressioni

Tissue specificityi

Predominantly expressed in the cerebellum, pituitary, cerebral cortex and olfactory lobe.1 Publication

Gene expression databases

BgeeiENSG00000120088.
CleanExiHS_CRHR1.
ExpressionAtlasiP34998. baseline and differential.
GenevisibleiP34998. HS.

Organism-specific databases

HPAiCAB000476.
CAB016253.

Interactioni

Subunit structurei

Heterodimer; heterodimerizes with GPER1 (By similarity). Interacts (via N-terminal extracellular domain) with CRH and UCN. Interacts with DLG1; this inhibits endocytosis of CRHR1 after agonist binding.By similarity5 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
CRHP068502EBI-3870393,EBI-3870390

Protein-protein interaction databases

BioGridi107784. 8 interactors.
IntActiP34998. 2 interactors.
MINTiMINT-1217325.
STRINGi9606.ENSP00000381333.

Chemistry databases

BindingDBiP34998.

Structurei

Secondary structure

1444
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Turni25 – 27Combined sources3
Helixi28 – 32Combined sources5
Beta strandi49 – 52Combined sources4
Beta strandi62 – 67Combined sources6
Beta strandi70 – 74Combined sources5
Beta strandi81 – 87Combined sources7
Turni89 – 91Combined sources3
Beta strandi93 – 98Combined sources6
Helixi99 – 101Combined sources3
Helixi103 – 107Combined sources5
Helixi116 – 143Combined sources28
Helixi175 – 177Combined sources3
Helixi179 – 205Combined sources27
Helixi207 – 212Combined sources6
Helixi215 – 237Combined sources23
Helixi239 – 247Combined sources9
Turni252 – 254Combined sources3
Helixi257 – 259Combined sources3
Helixi270 – 282Combined sources13
Helixi286 – 288Combined sources3
Helixi299 – 325Combined sources27
Helixi333 – 366Combined sources34
Helixi368 – 378Combined sources11
Helixi384 – 398Combined sources15

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2L27NMR-A25-108[»]
3EHSX-ray2.76A24-119[»]
3EHTX-ray3.40A24-119[»]
3EHUX-ray1.96A/B24-119[»]
4K5YX-ray2.98A/B/C104-373[»]
4Z9GX-ray3.18A/B/C104-249[»]
A/B/C252-401[»]
ProteinModelPortaliP34998.
SMRiP34998.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP34998.

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni99 – 108Important for peptide agonist binding10
Regioni309 – 319Important for antagonist bindingAdd BLAST11

Domaini

The transmembrane domain is composed of seven transmembrane helices that are arranged in V-shape. Transmembrane helix 7 assumes a sharply kinked structure. The antagonist CP-376395 binds at an allosteric site, far from the presumed binding site for the physiological peptide ligand.

Sequence similaritiesi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG4564. Eukaryota.
ENOG410XRS2. LUCA.
GeneTreeiENSGT00760000118800.
HOGENOMiHOG000230719.
HOVERGENiHBG106921.
InParanoidiP34998.
KOiK04578.
OMAiMFVCIGW.
OrthoDBiEOG091G0BBY.
PhylomeDBiP34998.
TreeFamiTF315710.

Family and domain databases

InterProiIPR017981. GPCR_2-like.
IPR003052. GPCR_2_CRF1_rcpt.
IPR003051. GPCR_2_CRF_rcpt.
IPR001879. GPCR_2_extracellular_dom.
IPR000832. GPCR_2_secretin-like.
IPR017983. GPCR_2_secretin-like_CS.
[Graphical view]
PfamiPF00002. 7tm_2. 1 hit.
PF02793. HRM. 1 hit.
[Graphical view]
PRINTSiPR01279. CRFRECEPTOR.
PR01280. CRFRECEPTOR1.
PR00249. GPCRSECRETIN.
SMARTiSM00008. HormR. 1 hit.
[Graphical view]
PROSITEiPS00649. G_PROTEIN_RECEP_F2_1. 1 hit.
PS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
PS50227. G_PROTEIN_RECEP_F2_3. 1 hit.
PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform CRF-R1 (identifier: P34998-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGGHPQLRLV KALLLLGLNP VSASLQDQHC ESLSLASNIS GLQCNASVDL
60 70 80 90 100
IGTCWPRSPA GQLVVRPCPA FFYGVRYNTT NNGYRECLAN GSWAARVNYS
110 120 130 140 150
ECQEILNEEK KSKVHYHVAV IINYLGHCIS LVALLVAFVL FLRLRPGCTH
160 170 180 190 200
WGDQADGALE VGAPWSGAPF QVRRSIRCLR NIIHWNLISA FILRNATWFV
210 220 230 240 250
VQLTMSPEVH QSNVGWCRLV TAAYNYFHVT NFFWMFGEGC YLHTAIVLTY
260 270 280 290 300
STDRLRKWMF ICIGWGVPFP IIVAWAIGKL YYDNEKCWFG KRPGVYTDYI
310 320 330 340 350
YQGPMILVLL INFIFLFNIV RILMTKLRAS TTSETIQYRK AVKATLVLLP
360 370 380 390 400
LLGITYMLFF VNPGEDEVSR VVFIYFNSFL ESFQGFFVSV FYCFLNSEVR
410 420 430 440
SAIRKRWHRW QDKHSIRARV ARAMSIPTSP TRVSFHSIKQ STAV
Length:444
Mass (Da):50,719
Last modified:February 1, 1994 - v1
Checksum:i7221AEFB0E7AA8ED
GO
Isoform CRF-R2 (identifier: P34998-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     146-174: Missing.

Note: Major isoform.
Show »
Length:415
Mass (Da):47,671
Checksum:i81445283CCE34C6E
GO
Isoform CRF-R3 (identifier: P34998-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     41-81: GLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTN → D
     146-174: Missing.

Note: Does not bind to CRF with high affinity.
Show »
Length:375
Mass (Da):43,331
Checksum:i6A2068BE9386F8B0
GO
Isoform CRF-R4 (identifier: P34998-4) [UniParc]FASTAAdd to basket
Also known as: 1D

The sequence of this isoform differs from the canonical sequence as follows:
     146-174: Missing.
     385-398: Missing.

Show »
Length:401
Mass (Da):46,030
Checksum:i3D8FF9B128810372
GO
Isoform 5 (identifier: P34998-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-204: Missing.

Show »
Length:240
Mass (Da):28,122
Checksum:iF4465F15BF7C52E4
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0454341 – 204Missing in isoform 5. 2 PublicationsAdd BLAST204
Alternative sequenceiVSP_00199641 – 81GLQCN…YNTTN → D in isoform CRF-R3. 1 PublicationAdd BLAST41
Alternative sequenceiVSP_001997146 – 174Missing in isoform CRF-R2, isoform CRF-R3 and isoform CRF-R4. 7 PublicationsAdd BLAST29
Alternative sequenceiVSP_001998385 – 398Missing in isoform CRF-R4. 1 PublicationAdd BLAST14

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L23333 mRNA. Translation: AAA35719.1.
L23332 mRNA. Translation: AAA35718.1.
X72304 mRNA. Translation: CAA51052.1.
AF039523
, AF039510, AF039511, AF039512, AF039513, AF039514, AF039515, AF039516, AF039517, AF039518, AF039519, AF039520, AF039521, AF039522 Genomic DNA. Translation: AAC69993.1.
U16273 mRNA. Translation: AAC50073.1.
AF180301 mRNA. Translation: AAD52688.1.
FJ543100 mRNA. Translation: ACU68591.1.
AY457172 mRNA. Translation: AAR19768.1.
AB451466 mRNA. Translation: BAG70280.1.
AK295559 mRNA. Translation: BAG58461.1.
AC126544 Genomic DNA. No translation available.
AC217770 Genomic DNA. No translation available.
AC217771 Genomic DNA. No translation available.
AC217774 Genomic DNA. No translation available.
AC225613 Genomic DNA. No translation available.
CH471233 Genomic DNA. Translation: EAW93557.1.
BC096836 mRNA. Translation: AAH96836.1.
CCDSiCCDS42350.1. [P34998-2]
CCDS45712.1. [P34998-1]
CCDS45713.1. [P34998-4]
CCDS45714.1. [P34998-3]
CCDS58556.1. [P34998-5]
PIRiI38879.
I60975. A48260.
RefSeqiNP_001138618.1. NM_001145146.1. [P34998-1]
NP_001138619.1. NM_001145147.1. [P34998-3]
NP_001138620.1. NM_001145148.1. [P34998-4]
NP_001243228.1. NM_001256299.2. [P34998-5]
NP_001289945.1. NM_001303016.1.
NP_001289947.1. NM_001303018.1. [P34998-5]
NP_004373.2. NM_004382.4. [P34998-2]
UniGeneiHs.417628.

Genome annotation databases

EnsembliENST00000314537; ENSP00000326060; ENSG00000120088. [P34998-2]
ENST00000352855; ENSP00000344068; ENSG00000120088. [P34998-3]
ENST00000398285; ENSP00000381333; ENSG00000120088. [P34998-1]
ENST00000577353; ENSP00000462016; ENSG00000120088. [P34998-4]
ENST00000613260; ENSP00000484387; ENSG00000278232. [P34998-1]
ENST00000615345; ENSP00000480752; ENSG00000278232. [P34998-3]
ENST00000616274; ENSP00000480396; ENSG00000276191. [P34998-1]
ENST00000616748; ENSP00000478177; ENSG00000276191. [P34998-3]
ENST00000617905; ENSP00000483802; ENSG00000276191. [P34998-2]
ENST00000618382; ENSP00000477786; ENSG00000278232. [P34998-2]
ENST00000633723; ENSP00000488342; ENSG00000276191. [P34998-4]
GeneIDi104909134.
1394.
KEGGihsa:104909134.
hsa:1394.
UCSCiuc002ijm.4. human. [P34998-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L23333 mRNA. Translation: AAA35719.1.
L23332 mRNA. Translation: AAA35718.1.
X72304 mRNA. Translation: CAA51052.1.
AF039523
, AF039510, AF039511, AF039512, AF039513, AF039514, AF039515, AF039516, AF039517, AF039518, AF039519, AF039520, AF039521, AF039522 Genomic DNA. Translation: AAC69993.1.
U16273 mRNA. Translation: AAC50073.1.
AF180301 mRNA. Translation: AAD52688.1.
FJ543100 mRNA. Translation: ACU68591.1.
AY457172 mRNA. Translation: AAR19768.1.
AB451466 mRNA. Translation: BAG70280.1.
AK295559 mRNA. Translation: BAG58461.1.
AC126544 Genomic DNA. No translation available.
AC217770 Genomic DNA. No translation available.
AC217771 Genomic DNA. No translation available.
AC217774 Genomic DNA. No translation available.
AC225613 Genomic DNA. No translation available.
CH471233 Genomic DNA. Translation: EAW93557.1.
BC096836 mRNA. Translation: AAH96836.1.
CCDSiCCDS42350.1. [P34998-2]
CCDS45712.1. [P34998-1]
CCDS45713.1. [P34998-4]
CCDS45714.1. [P34998-3]
CCDS58556.1. [P34998-5]
PIRiI38879.
I60975. A48260.
RefSeqiNP_001138618.1. NM_001145146.1. [P34998-1]
NP_001138619.1. NM_001145147.1. [P34998-3]
NP_001138620.1. NM_001145148.1. [P34998-4]
NP_001243228.1. NM_001256299.2. [P34998-5]
NP_001289945.1. NM_001303016.1.
NP_001289947.1. NM_001303018.1. [P34998-5]
NP_004373.2. NM_004382.4. [P34998-2]
UniGeneiHs.417628.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2L27NMR-A25-108[»]
3EHSX-ray2.76A24-119[»]
3EHTX-ray3.40A24-119[»]
3EHUX-ray1.96A/B24-119[»]
4K5YX-ray2.98A/B/C104-373[»]
4Z9GX-ray3.18A/B/C104-249[»]
A/B/C252-401[»]
ProteinModelPortaliP34998.
SMRiP34998.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107784. 8 interactors.
IntActiP34998. 2 interactors.
MINTiMINT-1217325.
STRINGi9606.ENSP00000381333.

Chemistry databases

BindingDBiP34998.
ChEMBLiCHEMBL1800.
GuidetoPHARMACOLOGYi212.

Protein family/group databases

TCDBi9.A.14.4.3. the g-protein-coupled receptor (gpcr) family.
GPCRDBiSearch...

PTM databases

iPTMnetiP34998.
PhosphoSitePlusiP34998.

Polymorphism and mutation databases

BioMutaiCRHR1.
DMDMi461836.

Proteomic databases

PaxDbiP34998.
PeptideAtlasiP34998.
PRIDEiP34998.

Protocols and materials databases

DNASUi1394.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000314537; ENSP00000326060; ENSG00000120088. [P34998-2]
ENST00000352855; ENSP00000344068; ENSG00000120088. [P34998-3]
ENST00000398285; ENSP00000381333; ENSG00000120088. [P34998-1]
ENST00000577353; ENSP00000462016; ENSG00000120088. [P34998-4]
ENST00000613260; ENSP00000484387; ENSG00000278232. [P34998-1]
ENST00000615345; ENSP00000480752; ENSG00000278232. [P34998-3]
ENST00000616274; ENSP00000480396; ENSG00000276191. [P34998-1]
ENST00000616748; ENSP00000478177; ENSG00000276191. [P34998-3]
ENST00000617905; ENSP00000483802; ENSG00000276191. [P34998-2]
ENST00000618382; ENSP00000477786; ENSG00000278232. [P34998-2]
ENST00000633723; ENSP00000488342; ENSG00000276191. [P34998-4]
GeneIDi104909134.
1394.
KEGGihsa:104909134.
hsa:1394.
UCSCiuc002ijm.4. human. [P34998-1]

Organism-specific databases

CTDi104909134.
1394.
DisGeNETi1394.
GeneCardsiCRHR1.
HGNCiHGNC:2357. CRHR1.
HPAiCAB000476.
CAB016253.
MIMi122561. gene.
neXtProtiNX_P34998.
OpenTargetsiENSG00000120088.
ENSG00000263715.
ENSG00000276191.
ENSG00000278232.
PharmGKBiPA26874.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4564. Eukaryota.
ENOG410XRS2. LUCA.
GeneTreeiENSGT00760000118800.
HOGENOMiHOG000230719.
HOVERGENiHBG106921.
InParanoidiP34998.
KOiK04578.
OMAiMFVCIGW.
OrthoDBiEOG091G0BBY.
PhylomeDBiP34998.
TreeFamiTF315710.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000120088-MONOMER.
ReactomeiR-HSA-373080. Class B/2 (Secretin family receptors).
R-HSA-418555. G alpha (s) signalling events.
SIGNORiP34998.

Miscellaneous databases

ChiTaRSiCRHR1. human.
EvolutionaryTraceiP34998.
GeneWikiiCorticotropin_releasing_hormone_receptor_1.
PROiP34998.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000120088.
CleanExiHS_CRHR1.
ExpressionAtlasiP34998. baseline and differential.
GenevisibleiP34998. HS.

Family and domain databases

InterProiIPR017981. GPCR_2-like.
IPR003052. GPCR_2_CRF1_rcpt.
IPR003051. GPCR_2_CRF_rcpt.
IPR001879. GPCR_2_extracellular_dom.
IPR000832. GPCR_2_secretin-like.
IPR017983. GPCR_2_secretin-like_CS.
[Graphical view]
PfamiPF00002. 7tm_2. 1 hit.
PF02793. HRM. 1 hit.
[Graphical view]
PRINTSiPR01279. CRFRECEPTOR.
PR01280. CRFRECEPTOR1.
PR00249. GPCRSECRETIN.
SMARTiSM00008. HormR. 1 hit.
[Graphical view]
PROSITEiPS00649. G_PROTEIN_RECEP_F2_1. 1 hit.
PS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
PS50227. G_PROTEIN_RECEP_F2_3. 1 hit.
PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCRFR1_HUMAN
AccessioniPrimary (citable) accession number: P34998
Secondary accession number(s): B4DIE9
, Q13008, Q4QRJ1, Q9UK64
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: February 1, 1994
Last modified: November 30, 2016
This is version 171 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.