Reviewed,
UniProtKB/Swiss-Prot P34998 (CRFR1_HUMAN)
Last modified
October 13, 2009.
Version 95.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Corticotropin-releasing factor receptor 1 Short name=CRF-R Short name=CRF1 Alternative name(s): Corticotropin-releasing hormone receptor 1 Short name=CRH-R 1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 444 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | This is a receptor for corticotropin releasing factor. Shows high-affinity CRF binding. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. |
| Subcellular location | |
| Tissue specificity | Predominantly expressed in the cerebellum, pituitary, cerebral cortex and olfactory lobe. |
| Post-translational modification | C-terminal Ser or Thr residues may be phosphorylated. |
| Sequence similarities | Belongs to the G-protein coupled receptor 2 family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Signal Transmembrane |
| Molecular function | G-protein coupled receptor Receptor Transducer |
| PTM | Disulfide bond Glycoprotein Phosphoprotein |
| Technical term | 3D-structure Complete proteome Direct protein sequencing |
| Gene Ontology (GO) | |
| Biological process | G-protein signaling, coupled to cAMP nucleotide second messenger Ref.1 Traceable author statement. Source: ProtInc activation of adenylate cyclase activity Ref.5Traceable author statement. Source: ProtInc female pregnancyNon-traceable author statement. Source: ProtInc immune response Ref.1Traceable author statement. Source: ProtInc parturition Ref.5Traceable author statement. Source: ProtInc |
| Cellular component | integral to plasma membrane Ref.5 Traceable author statement. Source: ProtInc |
| Molecular function | corticotrophin-releasing factor receptor activity Ref.5 Traceable author statement. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform CRF-R1 (identifier: P34998-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform CRF-R2 (identifier: P34998-2) The sequence of this isoform differs from the canonical sequence as follows: 146-174: Missing. | ||||||
| Note: Major isoform. | ||||||
| Isoform CRF-R3 (identifier: P34998-3) The sequence of this isoform differs from the canonical sequence as follows: 41-81: GLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTN → D 146-174: Missing. | ||||||
| Note: Does not bind to CRF with high affinity. | ||||||
| Isoform CRF-R4 (identifier: P34998-4) Also known as: 1D; The sequence of this isoform differs from the canonical sequence as follows: 146-174: Missing. 385-398: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||
Molecule processing | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 23 | 23 | Ref.7 | ||||||||||
| Chain | 24 – 444 | 421 | Corticotropin-releasing factor receptor 1 | PRO_0000012814 | |||||||||
Regions | |||||||||||||
| Topological domain | 24 – 121 | 98 | Extracellular Potential | ||||||||||
| Transmembrane | 122 – 142 | 21 | 1 Potential | ||||||||||
| Topological domain | 143 – 180 | 38 | Cytoplasmic Potential | ||||||||||
| Transmembrane | 181 – 200 | 20 | 2 Potential | ||||||||||
| Topological domain | 201 – 218 | 18 | Extracellular Potential | ||||||||||
| Transmembrane | 219 – 242 | 24 | 3 Potential | ||||||||||
| Topological domain | 243 – 256 | 14 | Cytoplasmic Potential | ||||||||||
| Transmembrane | 257 – 278 | 22 | 4 Potential | ||||||||||
| Topological domain | 279 – 297 | 19 | Extracellular Potential | ||||||||||
| Transmembrane | 298 – 320 | 23 | 5 Potential | ||||||||||
| Topological domain | 321 – 343 | 23 | Cytoplasmic Potential | ||||||||||
| Transmembrane | 344 – 363 | 20 | 6 Potential | ||||||||||
| Topological domain | 364 – 378 | 15 | Extracellular Potential | ||||||||||
| Transmembrane | 379 – 398 | 20 | 7 Potential | ||||||||||
| Topological domain | 399 – 444 | 46 | Cytoplasmic Potential | ||||||||||
Amino acid modifications | |||||||||||||
| Glycosylation | 38 | 1 | N-linked (GlcNAc...) Potential | ||||||||||
| Glycosylation | 45 | 1 | N-linked (GlcNAc...) Potential | ||||||||||
| Glycosylation | 78 | 1 | N-linked (GlcNAc...) Potential | ||||||||||
| Glycosylation | 90 | 1 | N-linked (GlcNAc...) Potential | ||||||||||
| Glycosylation | 98 | 1 | N-linked (GlcNAc...) Potential | ||||||||||
| Disulfide bond | 30 ↔ 54 | Ref.7 | |||||||||||
| Disulfide bond | 44 ↔ 87 | Ref.7 | |||||||||||
| Disulfide bond | 68 ↔ 102 | Ref.7 | |||||||||||
Natural variations | |||||||||||||
| Alternative sequence | 41 – 81 | 41 | GLQCN…YNTTN → D in isoform CRF-R3. | VSP_001996 | |||||||||
| Alternative sequence | 146 – 174 | 29 | Missing in isoform CRF-R2, isoform CRF-R3 and isoform CRF-R4. | VSP_001997 | |||||||||
| Alternative sequence | 385 – 398 | 14 | Missing in isoform CRF-R4. | VSP_001998 | |||||||||
Secondary structure | |||||||||||||
Helix Strand Turn | |||||||||||||
| Helix | 28 – 32 | 5 | |||||||||||
| Beta strand | 85 – 87 | 3 | |||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Expression cloning of a human corticotropin-releasing-factor receptor." Chen R., Lewis K.A., Perrin M.H., Vale W.W. Proc. Natl. Acad. Sci. U.S.A. 90:8967-8971(1993) [PubMed: 7692441] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS CRF-R1 AND CRF-R2). Tissue: Pituitary. |
| [2] | "Primary structure and functional expression of mouse pituitary and human brain corticotrophin releasing factor receptors." Vita N., Laurent P., Lefort S., Chalon P., Lelias J.-M., Kaghad M., le Fur G., Caput D., Ferrara P. FEBS Lett. 335:1-5(1993) [PubMed: 8243652] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM CRF-R2). Tissue: Brain. |
| [3] | "The genomic organization of the human corticotropin-releasing factor type-1 receptor." Sakai K., Yamada M., Horiba N., Wakui M., Demura H., Suda T. Gene 219:125-130(1998) [PubMed: 9757017] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [4] | "A variant of the human corticotropin-releasing factor (CRF) receptor: cloning, expression and pharmacology." Ross P.C., Kostas C.M., Ramabhadran T.V. Biochem. Biophys. Res. Commun. 205:1836-1842(1994) [PubMed: 7811272] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM CRF-R3). Tissue: Hippocampus. |
| [5] | "A novel spliced variant of the type 1 corticotropin-releasing hormone receptor with a deletion in the seventh transmembrane domain present in the human pregnant term myometrium and fetal membranes." Grammatopoulos D.K., Dai Y., Randeva H.S., Levine M.A., Karteris E., Easton A.J., Hillhouse E.W. Mol. Endocrinol. 13:2189-2202(1999) [PubMed: 10598591] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM CRF-R4). |
| [6] | "cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org)." King M.M., Aronstam R.S., Sharma S.V. Submitted (NOV-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM CRF-R2). Tissue: Brain. |
| [7] | "Expression, purification, and characterization of a soluble form of the first extracellular domain of the human type 1 corticotropin releasing factor receptor." Perrin M.H., Fischer W.H., Kunitake K.S., Craig A.G., Koerber S.C., Cervini L.A., Rivier J.E., Groppe J.C., Greenwald J., Moller Nielsen S., Vale W.W. J. Biol. Chem. 276:31528-31534(2001) [PubMed: 11425856] [Abstract] Cited for: PROTEIN SEQUENCE OF 24-31, DISULFIDE BONDS. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| L23333 mRNA. Translation: AAA35719.1. L23332 mRNA. Translation: AAA35718.1. X72304 mRNA. Translation: CAA51052.1. AF039523 AF039522 Genomic DNA. Translation: AAC69993.1. U16273 mRNA. Translation: AAC50073.1. AF180301 mRNA. Translation: AAD52688.1. AY457172 mRNA. Translation: AAR19768.1. | |||||||||||||||||||||||||
| IPI | IPI00219267. IPI00219268. IPI00219269. IPI00873090. | ||||||||||||||||||||||||
| PIR | I38879. A48260. I60975. | ||||||||||||||||||||||||
| RefSeq | NP_001138618.1. NP_001138619.1. NP_001138620.1. NP_004373.2. | ||||||||||||||||||||||||
| UniGene | Hs.417628 | ||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||
| |||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||
| STRING | P34998. | ||||||||||||||||||||||||
Protein family/group databases | |||||||||||||||||||||||||
| GPCRDB | Search... | ||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||
| PhosphoSite | P34998. | ||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||
| PRIDE | P34998. | ||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||
| Ensembl | ENST00000293493; ENSP00000293493; ENSG00000120088; Homo sapiens. [Genome view] ENST00000314537; ENSP00000326060; ENSG00000120088; Homo sapiens. [Genome view] ENST00000339069; ENSP00000340522; ENSG00000120088; Homo sapiens. [Genome view] ENST00000347197; ENSP00000239167; ENSG00000120088; Homo sapiens. [Genome view] ENST00000352855; ENSP00000344068; ENSG00000120088; Homo sapiens. [Genome view] ENST00000398285; ENSP00000381333; ENSG00000120088; Homo sapiens. [Genome view] ENST00000423694; ENSP00000416995; ENSG00000226460; Homo sapiens. [Genome view] ENST00000429123; ENSP00000405747; ENSG00000226460; Homo sapiens. [Genome view] ENST00000430106; ENSP00000388294; ENSG00000120088; Homo sapiens. [Genome view] ENST00000441899; ENSP00000391273; ENSG00000226460; Homo sapiens. [Genome view] ENST00000451487; ENSP00000415867; ENSG00000226460; Homo sapiens. [Genome view] ENST00000455759; ENSP00000391795; ENSG00000226460; Homo sapiens. [Genome view] ENST00000456940; ENSP00000407078; ENSG00000226460; Homo sapiens. [Genome view] ENST00000457569; ENSP00000389407; ENSG00000226460; Homo sapiens. [Genome view] | ||||||||||||||||||||||||
| GeneID | 1394. | ||||||||||||||||||||||||
| KEGG | hsa:1394. | ||||||||||||||||||||||||
| UCSC | uc002ijn.1. human. uc010dap.1. human. uc010dar.1. human. | ||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||
| CTD | 1394. | ||||||||||||||||||||||||
| GeneCards | GC17P041217. | ||||||||||||||||||||||||
| H-InvDB | HIX0027131. | ||||||||||||||||||||||||
| HGNC | HGNC:2357. CRHR1. | ||||||||||||||||||||||||
| MIM | 122561. gene. | ||||||||||||||||||||||||
| PharmGKB | PA26874. | ||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||
| HOVERGEN | P34998. | ||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||
| Reactome | REACT_14797. Signaling by GPCR. | ||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||
| ArrayExpress | P34998. | ||||||||||||||||||||||||
| Bgee | P34998. | ||||||||||||||||||||||||
| CleanEx | HS_CRHR1. | ||||||||||||||||||||||||
| Genevestigator | P34998. | ||||||||||||||||||||||||
| GermOnline | ENSG00000120088. Homo sapiens. | ||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||
| InterPro | IPR017981. GPCR_2-like. IPR003052. GPCR_2_CRF1_rcpt. IPR003051. GPCR_2_CRF_rcpt. IPR001879. GPCR_2_extracellular. IPR000832. GPCR_2_secretin-like. IPR017983. GPCR_2_secretin-like_CS. [Graphical view] | ||||||||||||||||||||||||
| PANTHER | PTHR12011:SF73. CRF_rcpt. 1 hit. | ||||||||||||||||||||||||
| Pfam | PF00002. 7tm_2. 1 hit. PF02793. HRM. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| PRINTS | PR01279. CRFRECEPTOR. PR01280. CRFRECEPTOR1. PR00249. GPCRSECRETIN. | ||||||||||||||||||||||||
| SMART | SM00008. HormR. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| PROSITE | PS00649. G_PROTEIN_RECEP_F2_1. 1 hit. PS00650. G_PROTEIN_RECEP_F2_2. 1 hit. PS50227. G_PROTEIN_RECEP_F2_3. 1 hit. PS50261. G_PROTEIN_RECEP_F2_4. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||
Other Resources | |||||||||||||||||||||||||
| NextBio | 5703. | ||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||
Entry information
| Entry name | CRFR1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P34998 Secondary accession number(s): Q13008, Q9UK64 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| 7-transmembrane G-linked receptors List of 7-transmembrane G-linked receptor entries |
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


