SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P34980

- PE2R3_RAT

UniProt

P34980 - PE2R3_RAT

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Prostaglandin E2 receptor EP3 subtype

Gene
Ptger3
Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 3 out of 5 - Experimental evidence at transcript leveli

Functioni

Receptor for prostaglandin E2 (PGE2); the EP3 receptor may be involved in inhibition of gastric acid secretion, modulation of neurotransmitter release in central and peripheral neurons, inhibition of sodium and water reabsorption in kidney tubulus and contraction in uterine smooth muscle. The activity of this receptor can couple to both the inhibition of adenylate cyclase mediated by G(i) proteins, and to an elevation of intracellular calcium. The various forms can interact with different second messenger systems By similarity.

GO - Molecular functioni

  1. prostaglandin E receptor activity Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Names & Taxonomyi

Protein namesi
Recommended name:
Prostaglandin E2 receptor EP3 subtype
Short name:
PGE receptor EP3 subtype
Short name:
PGE2 receptor EP3 subtype
Alternative name(s):
Prostanoid EP3 receptor
Gene namesi
Name:Ptger3
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
ProteomesiUP000002494: Chromosome 2

Organism-specific databases

RGDi3435. Ptger3.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 3030Extracellular Reviewed predictionAdd
BLAST
Transmembranei31 – 5525Helical; Name=1; Reviewed predictionAdd
BLAST
Topological domaini56 – 6813Cytoplasmic Reviewed predictionAdd
BLAST
Transmembranei69 – 8921Helical; Name=2; Reviewed predictionAdd
BLAST
Topological domaini90 – 10819Extracellular Reviewed predictionAdd
BLAST
Transmembranei109 – 13022Helical; Name=3; Reviewed predictionAdd
BLAST
Topological domaini131 – 15121Cytoplasmic Reviewed predictionAdd
BLAST
Transmembranei152 – 17322Helical; Name=4; Reviewed predictionAdd
BLAST
Topological domaini174 – 20330Extracellular Reviewed predictionAdd
BLAST
Transmembranei204 – 22926Helical; Name=5; Reviewed predictionAdd
BLAST
Topological domaini230 – 25930Cytoplasmic Reviewed predictionAdd
BLAST
Transmembranei260 – 28324Helical; Name=6; Reviewed predictionAdd
BLAST
Topological domaini284 – 30320Extracellular Reviewed predictionAdd
BLAST
Transmembranei304 – 32522Helical; Name=7; Reviewed predictionAdd
BLAST
Topological domaini326 – 36540Cytoplasmic Reviewed predictionAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. plasma membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 365365Prostaglandin E2 receptor EP3 subtypePRO_0000070062Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi16 – 161N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi107 ↔ 184 By similarity
Glycosylationi193 – 1931N-linked (GlcNAc...) Reviewed prediction

Keywords - PTMi

Disulfide bond, Glycoprotein, Lipoprotein, Palmitate

Proteomic databases

PaxDbiP34980.

Expressioni

Tissue specificityi

Principally expressed in the tubules of the renal medulla. Specific expression is seen in medullary and cortical thick ascending limbs; lower levels are detected in cortical and inner medullary collecting ducts. Not detected significantly in the glomeruli. In the brain, expressed in all types of glial cells.

Gene expression databases

GenevestigatoriP34980.

Interactioni

Protein-protein interaction databases

MINTiMINT-189653.

Structurei

3D structure databases

ProteinModelPortaliP34980.

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG244691.
GeneTreeiENSGT00690000102015.
HOGENOMiHOG000015238.
HOVERGENiHBG052720.
InParanoidiP34980.
KOiK04260.
OrthoDBiEOG70W3D9.
PhylomeDBiP34980.

Family and domain databases

Gene3Di1.20.1070.10. 1 hit.
InterProiIPR000154. EP3_rcpt_3.
IPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
IPR008365. Prostanoid_rcpt.
IPR001244. Prostglndn_DP_rcpt.
IPR000265. Prostglndn_EP3_rcpt.
[Graphical view]
PANTHERiPTHR11866. PTHR11866. 1 hit.
PTHR11866:SF10. PTHR11866:SF10. 1 hit.
PfamiPF00001. 7tm_1. 1 hit.
[Graphical view]
PRINTSiPR00237. GPCRRHODOPSN.
PR00428. PROSTAGLNDNR.
PR01788. PROSTANOIDR.
PR00585. PRSTNOIDE33R.
PR00582. PRSTNOIDEP3R.
PROSITEiPS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Note: Additional isoforms seem to exist. Isoforms have identical ligand binding properties but different coupling properties with G proteins: isoform Alpha and isoform Beta couple to G(i) proteins, whereas isoform Gamma couples to multiple G proteins, G(i) and G(s).

Isoform Alpha (identifier: P34980-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAGVWAPEHS VEAHSNQSSA ADGCGSVSVA FPITMMVTGF VGNALAMLLV    50
VRSYRRRESK RKKSFLLCIG WLALTDLVGQ LLTSPVVILV YLSQRRWEQL 100
DPSGRLCTFF GLTMTVFGLS SLLVASAMAV ERALAIRAPH WYASHMKTRA 150
TPVLLGVWLS VLAFALLPVL GVGRYSVQWP GTWCFISTGP AGNETDSARE 200
PGSVAFASAF ACLGLLALVV TFACNLATIK ALVSRCRAKA AASQSSAQWG 250
RITTETAIQL MGIMCVLSVC WSPLLIMMLK MIFNQMSVEQ CKTQMGKEKE 300
CNSFLIAVRL ASLNQILDPW VYLLLRKILL RKFCQIRDHT NYASSSTSLP 350
CPGSSVLMWS DQLER 365
Length:365
Mass (Da):39,942
Last modified:February 1, 1994 - v1
Checksum:i3247190CF95FD825
GO
Isoform Beta (identifier: P34980-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     336-365: IRDHTNYASSSTSLPCPGSSVLMWSDQLER → MMNNLKRSFIAIPASLSMRISSPREG

Show »
Length:361
Mass (Da):39,511
Checksum:iFF4E6C4D0675D4D0
GO
Isoform Gamma (identifier: P34980-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     336-365: IRDHTNYASSSTSLPCPGSSVLMWSDQLER → VANAVSSCSSDQQKGQAISLSNEVVHPGP

Show »
Length:364
Mass (Da):39,514
Checksum:i4F2B08636E7B04E3
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti152 – 1521P → RA.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei336 – 36530IRDHT…DQLER → MMNNLKRSFIAIPASLSMRI SSPREG in isoform Beta. VSP_001949Add
BLAST
Alternative sequencei336 – 36530IRDHT…DQLER → VANAVSSCSSDQQKGQAISL SNEVVHPGP in isoform Gamma. VSP_001950Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti51 – 511V → S1 Publication
Sequence conflicti51 – 511V → S1 Publication
Sequence conflicti354 – 3541S → F in CAA58735. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
D14869 mRNA. Translation: BAA03585.1.
D16443 mRNA. Translation: BAA03912.1.
X80133 mRNA. Translation: CAA56432.1.
D29969 mRNA. Translation: BAA06236.1.
X83855 mRNA. Translation: CAA58735.1.
PIRiJN0693.
S48689.
S51280.
RefSeqiNP_036836.1. NM_012704.1.
UniGeneiRn.10361.

Genome annotation databases

EnsembliENSRNOT00000014126; ENSRNOP00000014126; ENSRNOG00000010325.
GeneIDi24929.
KEGGirno:24929.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
D14869 mRNA. Translation: BAA03585.1 .
D16443 mRNA. Translation: BAA03912.1 .
X80133 mRNA. Translation: CAA56432.1 .
D29969 mRNA. Translation: BAA06236.1 .
X83855 mRNA. Translation: CAA58735.1 .
PIRi JN0693.
S48689.
S51280.
RefSeqi NP_036836.1. NM_012704.1.
UniGenei Rn.10361.

3D structure databases

ProteinModelPortali P34980.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

MINTi MINT-189653.

Chemistry

BindingDBi P34980.
ChEMBLi CHEMBL5674.
GuidetoPHARMACOLOGYi 342.

Protein family/group databases

GPCRDBi Search...

Proteomic databases

PaxDbi P34980.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSRNOT00000014126 ; ENSRNOP00000014126 ; ENSRNOG00000010325 .
GeneIDi 24929.
KEGGi rno:24929.

Organism-specific databases

CTDi 5733.
RGDi 3435. Ptger3.

Phylogenomic databases

eggNOGi NOG244691.
GeneTreei ENSGT00690000102015.
HOGENOMi HOG000015238.
HOVERGENi HBG052720.
InParanoidi P34980.
KOi K04260.
OrthoDBi EOG70W3D9.
PhylomeDBi P34980.

Miscellaneous databases

NextBioi 604891.
PROi P34980.

Gene expression databases

Genevestigatori P34980.

Family and domain databases

Gene3Di 1.20.1070.10. 1 hit.
InterProi IPR000154. EP3_rcpt_3.
IPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
IPR008365. Prostanoid_rcpt.
IPR001244. Prostglndn_DP_rcpt.
IPR000265. Prostglndn_EP3_rcpt.
[Graphical view ]
PANTHERi PTHR11866. PTHR11866. 1 hit.
PTHR11866:SF10. PTHR11866:SF10. 1 hit.
Pfami PF00001. 7tm_1. 1 hit.
[Graphical view ]
PRINTSi PR00237. GPCRRHODOPSN.
PR00428. PROSTAGLNDNR.
PR01788. PROSTANOIDR.
PR00585. PRSTNOIDE33R.
PR00582. PRSTNOIDEP3R.
PROSITEi PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Molecular cloning and intrarenal localization of rat prostaglandin E2 receptor EP3 subtype."
    Takeuchi K., Abe T., Takahashi N., Abe K.
    Biochem. Biophys. Res. Commun. 194:885-891(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA].
    Strain: Sprague-Dawley.
    Tissue: Kidney.
  2. "Two isoforms of the rat kidney EP3 receptor derived by alternative RNA splicing: intrarenal expression co-localization."
    Takeuchi K., Takahashi N., Abe T., Abe K.
    Biochem. Biophys. Res. Commun. 199:834-840(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA AND GAMMA).
    Strain: Sprague-Dawley.
    Tissue: Kidney.
  3. "Molecular cloning and expression of a prostaglandin E2 receptor of the EP3 beta subtype from rat hepatocytes."
    Neuschaefer-Rube F., de Vries C., Haenecke K., Jungermann K., Pueschel G.P.
    FEBS Lett. 351:119-122(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA AND BETA).
    Tissue: Hepatocyte.
  4. "Expression pattern of messenger RNAs for prostanoid receptors in glial cell cultures."
    Kitanaka J., Hashimoto H., Gotoh M., Kondo K., Sakata K., Hirasawa Y., Sawada M., Suzumura A., Marunouchi T., Matsuda T., Baba A.
    Brain Res. 707:282-287(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM BETA).
    Strain: Sprague-Dawley.
    Tissue: Brain cortex.

Entry informationi

Entry nameiPE2R3_RAT
AccessioniPrimary (citable) accession number: P34980
Secondary accession number(s): Q63194, Q64376
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: February 1, 1994
Last modified: April 16, 2014
This is version 118 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi