Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Prostaglandin E2 receptor EP3 subtype

Gene

Ptger3

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Receptor for prostaglandin E2 (PGE2); the EP3 receptor may be involved in inhibition of gastric acid secretion, modulation of neurotransmitter release in central and peripheral neurons, inhibition of sodium and water reabsorption in kidney tubulus and contraction in uterine smooth muscle. The activity of this receptor can couple to both the inhibition of adenylate cyclase mediated by G(i) proteins, and to an elevation of intracellular calcium. The various forms can interact with different second messenger systems (By similarity).By similarity

GO - Molecular functioni

  • prostaglandin E receptor activity Source: RGD

GO - Biological processi

  • cellular response to forskolin Source: RGD
  • cellular response to interleukin-1 Source: RGD
  • cellular response to lipopolysaccharide Source: RGD
  • desensitization of G-protein coupled receptor protein signaling pathway Source: RGD
  • female pregnancy Source: RGD
  • inflammatory response Source: GO_Central
  • intestine smooth muscle contraction Source: RGD
  • maternal process involved in parturition Source: RGD
  • negative regulation of calcium ion transmembrane transport Source: RGD
  • negative regulation of cAMP biosynthetic process Source: RGD
  • negative regulation of circadian sleep/wake cycle, wakefulness Source: RGD
  • negative regulation of forebrain neuron differentiation Source: RGD
  • negative regulation of gastric acid secretion Source: RGD
  • negative regulation of gastrin-induced gastric acid secretion Source: RGD
  • negative regulation of insulin secretion Source: RGD
  • negative regulation of norepinephrine secretion Source: RGD
  • negative regulation of platelet aggregation Source: RGD
  • negative regulation of potassium ion transmembrane transport Source: RGD
  • phospholipase C-activating G-protein coupled receptor signaling pathway Source: GO_Central
  • positive regulation of blood circulation Source: RGD
  • positive regulation of cAMP biosynthetic process Source: RGD
  • positive regulation of circadian sleep/wake cycle, non-REM sleep Source: RGD
  • positive regulation of colon smooth muscle contraction Source: RGD
  • positive regulation of cytosolic calcium ion concentration Source: RGD
  • positive regulation of gastric mucosal blood circulation Source: RGD
  • positive regulation of gene expression Source: RGD
  • positive regulation of inhibitory G-protein coupled receptor phosphorylation Source: RGD
  • positive regulation of myofibroblast contraction Source: RGD
  • positive regulation of neutrophil extravasation Source: RGD
  • positive regulation of protein phosphorylation Source: RGD
  • positive regulation of smooth muscle contraction involved in micturition Source: RGD
  • positive regulation of vasoconstriction Source: RGD
  • prostaglandin receptor internalization Source: RGD
  • receptor internalization Source: RGD
  • regulation of circadian sleep/wake cycle, wakefulness Source: RGD
  • regulation of norepinephrine secretion Source: RGD
  • response to drug Source: RGD
  • response to estradiol Source: RGD
  • response to progesterone Source: RGD
  • response to salt Source: RGD
  • urinary bladder smooth muscle contraction Source: RGD
Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Names & Taxonomyi

Protein namesi
Recommended name:
Prostaglandin E2 receptor EP3 subtype
Short name:
PGE receptor EP3 subtype
Short name:
PGE2 receptor EP3 subtype
Alternative name(s):
Prostanoid EP3 receptor
Gene namesi
Name:Ptger3
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Unplaced

Organism-specific databases

RGDi3435. Ptger3.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 30ExtracellularSequence analysisAdd BLAST30
Transmembranei31 – 55Helical; Name=1Sequence analysisAdd BLAST25
Topological domaini56 – 68CytoplasmicSequence analysisAdd BLAST13
Transmembranei69 – 89Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini90 – 108ExtracellularSequence analysisAdd BLAST19
Transmembranei109 – 130Helical; Name=3Sequence analysisAdd BLAST22
Topological domaini131 – 151CytoplasmicSequence analysisAdd BLAST21
Transmembranei152 – 173Helical; Name=4Sequence analysisAdd BLAST22
Topological domaini174 – 203ExtracellularSequence analysisAdd BLAST30
Transmembranei204 – 229Helical; Name=5Sequence analysisAdd BLAST26
Topological domaini230 – 259CytoplasmicSequence analysisAdd BLAST30
Transmembranei260 – 283Helical; Name=6Sequence analysisAdd BLAST24
Topological domaini284 – 303ExtracellularSequence analysisAdd BLAST20
Transmembranei304 – 325Helical; Name=7Sequence analysisAdd BLAST22
Topological domaini326 – 365CytoplasmicSequence analysisAdd BLAST40

GO - Cellular componenti

  • brush border membrane Source: RGD
  • cell surface Source: RGD
  • integral component of plasma membrane Source: GO_Central
  • neuronal cell body Source: RGD
  • neuron projection Source: RGD
  • nuclear membrane Source: RGD
  • plasma membrane Source: RGD
  • proximal neuron projection Source: RGD
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Chemistry databases

ChEMBLiCHEMBL5674.
GuidetoPHARMACOLOGYi342.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000700621 – 365Prostaglandin E2 receptor EP3 subtypeAdd BLAST365

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi16N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi107 ↔ 184PROSITE-ProRule annotation
Glycosylationi193N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein, Lipoprotein, Palmitate

Proteomic databases

PaxDbiP34980.
PRIDEiP34980.

PTM databases

PhosphoSitePlusiP34980.

Expressioni

Tissue specificityi

Principally expressed in the tubules of the renal medulla. Specific expression is seen in medullary and cortical thick ascending limbs; lower levels are detected in cortical and inner medullary collecting ducts. Not detected significantly in the glomeruli. In the brain, expressed in all types of glial cells.

Gene expression databases

BgeeiENSRNOG00000010325.

Interactioni

Protein-protein interaction databases

MINTiMINT-189653.
STRINGi10116.ENSRNOP00000014034.

Chemistry databases

BindingDBiP34980.

Structurei

3D structure databases

ProteinModelPortaliP34980.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3656. Eukaryota.
ENOG410XRW9. LUCA.
HOGENOMiHOG000015238.
HOVERGENiHBG052720.
InParanoidiP34980.
KOiK04260.
PhylomeDBiP34980.

Family and domain databases

InterProiIPR000154. EP3_rcpt_3.
IPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
IPR008365. Prostanoid_rcpt.
IPR001244. Prostglndn_DP_rcpt.
IPR000265. Prostglndn_EP3_rcpt.
[Graphical view]
PANTHERiPTHR11866. PTHR11866. 1 hit.
PTHR11866:SF10. PTHR11866:SF10. 1 hit.
PfamiPF00001. 7tm_1. 1 hit.
[Graphical view]
PRINTSiPR00237. GPCRRHODOPSN.
PR00428. PROSTAGLNDNR.
PR01788. PROSTANOIDR.
PR00585. PRSTNOIDE33R.
PR00582. PRSTNOIDEP3R.
PROSITEiPS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist. Isoforms have identical ligand binding properties but different coupling properties with G proteins: isoform Alpha and isoform Beta couple to G(i) proteins, whereas isoform Gamma couples to multiple G proteins, G(i) and G(s).
Isoform Alpha (identifier: P34980-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAGVWAPEHS VEAHSNQSSA ADGCGSVSVA FPITMMVTGF VGNALAMLLV
60 70 80 90 100
VRSYRRRESK RKKSFLLCIG WLALTDLVGQ LLTSPVVILV YLSQRRWEQL
110 120 130 140 150
DPSGRLCTFF GLTMTVFGLS SLLVASAMAV ERALAIRAPH WYASHMKTRA
160 170 180 190 200
TPVLLGVWLS VLAFALLPVL GVGRYSVQWP GTWCFISTGP AGNETDSARE
210 220 230 240 250
PGSVAFASAF ACLGLLALVV TFACNLATIK ALVSRCRAKA AASQSSAQWG
260 270 280 290 300
RITTETAIQL MGIMCVLSVC WSPLLIMMLK MIFNQMSVEQ CKTQMGKEKE
310 320 330 340 350
CNSFLIAVRL ASLNQILDPW VYLLLRKILL RKFCQIRDHT NYASSSTSLP
360
CPGSSVLMWS DQLER
Length:365
Mass (Da):39,942
Last modified:February 1, 1994 - v1
Checksum:i3247190CF95FD825
GO
Isoform Beta (identifier: P34980-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     336-365: IRDHTNYASSSTSLPCPGSSVLMWSDQLER → MMNNLKRSFIAIPASLSMRISSPREG

Show »
Length:361
Mass (Da):39,511
Checksum:iFF4E6C4D0675D4D0
GO
Isoform Gamma (identifier: P34980-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     336-365: IRDHTNYASSSTSLPCPGSSVLMWSDQLER → VANAVSSCSSDQQKGQAISLSNEVVHPGP

Show »
Length:364
Mass (Da):39,514
Checksum:i4F2B08636E7B04E3
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti51V → S (PubMed:8076679).Curated1
Sequence conflicti51V → S (PubMed:8919306).Curated1
Sequence conflicti354S → F in CAA58735 (PubMed:8076679).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural varianti152P → RA.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_001949336 – 365IRDHT…DQLER → MMNNLKRSFIAIPASLSMRI SSPREG in isoform Beta. 2 PublicationsAdd BLAST30
Alternative sequenceiVSP_001950336 – 365IRDHT…DQLER → VANAVSSCSSDQQKGQAISL SNEVVHPGP in isoform Gamma. 1 PublicationAdd BLAST30

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D14869 mRNA. Translation: BAA03585.1.
D16443 mRNA. Translation: BAA03912.1.
X80133 mRNA. Translation: CAA56432.1.
D29969 mRNA. Translation: BAA06236.1.
X83855 mRNA. Translation: CAA58735.1.
PIRiJN0693.
S48689.
S51280.
RefSeqiNP_036836.1. NM_012704.1.
UniGeneiRn.10361.

Genome annotation databases

GeneIDi24929.
KEGGirno:24929.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D14869 mRNA. Translation: BAA03585.1.
D16443 mRNA. Translation: BAA03912.1.
X80133 mRNA. Translation: CAA56432.1.
D29969 mRNA. Translation: BAA06236.1.
X83855 mRNA. Translation: CAA58735.1.
PIRiJN0693.
S48689.
S51280.
RefSeqiNP_036836.1. NM_012704.1.
UniGeneiRn.10361.

3D structure databases

ProteinModelPortaliP34980.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

MINTiMINT-189653.
STRINGi10116.ENSRNOP00000014034.

Chemistry databases

BindingDBiP34980.
ChEMBLiCHEMBL5674.
GuidetoPHARMACOLOGYi342.

Protein family/group databases

GPCRDBiSearch...

PTM databases

PhosphoSitePlusiP34980.

Proteomic databases

PaxDbiP34980.
PRIDEiP34980.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi24929.
KEGGirno:24929.

Organism-specific databases

CTDi5733.
RGDi3435. Ptger3.

Phylogenomic databases

eggNOGiKOG3656. Eukaryota.
ENOG410XRW9. LUCA.
HOGENOMiHOG000015238.
HOVERGENiHBG052720.
InParanoidiP34980.
KOiK04260.
PhylomeDBiP34980.

Miscellaneous databases

PROiP34980.

Gene expression databases

BgeeiENSRNOG00000010325.

Family and domain databases

InterProiIPR000154. EP3_rcpt_3.
IPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
IPR008365. Prostanoid_rcpt.
IPR001244. Prostglndn_DP_rcpt.
IPR000265. Prostglndn_EP3_rcpt.
[Graphical view]
PANTHERiPTHR11866. PTHR11866. 1 hit.
PTHR11866:SF10. PTHR11866:SF10. 1 hit.
PfamiPF00001. 7tm_1. 1 hit.
[Graphical view]
PRINTSiPR00237. GPCRRHODOPSN.
PR00428. PROSTAGLNDNR.
PR01788. PROSTANOIDR.
PR00585. PRSTNOIDE33R.
PR00582. PRSTNOIDEP3R.
PROSITEiPS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPE2R3_RAT
AccessioniPrimary (citable) accession number: P34980
Secondary accession number(s): Q63194, Q64376
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: February 1, 1994
Last modified: November 2, 2016
This is version 136 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.