Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P34980

- PE2R3_RAT

UniProt

P34980 - PE2R3_RAT

Protein

Prostaglandin E2 receptor EP3 subtype

Gene

Ptger3

Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 119 (01 Oct 2014)
      Sequence version 1 (01 Feb 1994)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Receptor for prostaglandin E2 (PGE2); the EP3 receptor may be involved in inhibition of gastric acid secretion, modulation of neurotransmitter release in central and peripheral neurons, inhibition of sodium and water reabsorption in kidney tubulus and contraction in uterine smooth muscle. The activity of this receptor can couple to both the inhibition of adenylate cyclase mediated by G(i) proteins, and to an elevation of intracellular calcium. The various forms can interact with different second messenger systems By similarity.By similarity

    GO - Molecular functioni

    1. prostaglandin E receptor activity Source: InterPro

    Keywords - Molecular functioni

    G-protein coupled receptor, Receptor, Transducer

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Prostaglandin E2 receptor EP3 subtype
    Short name:
    PGE receptor EP3 subtype
    Short name:
    PGE2 receptor EP3 subtype
    Alternative name(s):
    Prostanoid EP3 receptor
    Gene namesi
    Name:Ptger3
    OrganismiRattus norvegicus (Rat)
    Taxonomic identifieri10116 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
    ProteomesiUP000002494: Chromosome 2

    Organism-specific databases

    RGDi3435. Ptger3.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW
    2. plasma membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell membrane, Membrane

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 365365Prostaglandin E2 receptor EP3 subtypePRO_0000070062Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi16 – 161N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi107 ↔ 184PROSITE-ProRule annotation
    Glycosylationi193 – 1931N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Disulfide bond, Glycoprotein, Lipoprotein, Palmitate

    Proteomic databases

    PaxDbiP34980.

    Expressioni

    Tissue specificityi

    Principally expressed in the tubules of the renal medulla. Specific expression is seen in medullary and cortical thick ascending limbs; lower levels are detected in cortical and inner medullary collecting ducts. Not detected significantly in the glomeruli. In the brain, expressed in all types of glial cells.

    Gene expression databases

    GenevestigatoriP34980.

    Interactioni

    Protein-protein interaction databases

    MINTiMINT-189653.

    Structurei

    3D structure databases

    ProteinModelPortaliP34980.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 3030ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini56 – 6813CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini90 – 10819ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini131 – 15121CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini174 – 20330ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini230 – 25930CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini284 – 30320ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini326 – 36540CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei31 – 5525Helical; Name=1Sequence AnalysisAdd
    BLAST
    Transmembranei69 – 8921Helical; Name=2Sequence AnalysisAdd
    BLAST
    Transmembranei109 – 13022Helical; Name=3Sequence AnalysisAdd
    BLAST
    Transmembranei152 – 17322Helical; Name=4Sequence AnalysisAdd
    BLAST
    Transmembranei204 – 22926Helical; Name=5Sequence AnalysisAdd
    BLAST
    Transmembranei260 – 28324Helical; Name=6Sequence AnalysisAdd
    BLAST
    Transmembranei304 – 32522Helical; Name=7Sequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG244691.
    GeneTreeiENSGT00690000102015.
    HOGENOMiHOG000015238.
    HOVERGENiHBG052720.
    InParanoidiP34980.
    KOiK04260.
    OrthoDBiEOG70W3D9.
    PhylomeDBiP34980.

    Family and domain databases

    Gene3Di1.20.1070.10. 1 hit.
    InterProiIPR000154. EP3_rcpt_3.
    IPR000276. GPCR_Rhodpsn.
    IPR017452. GPCR_Rhodpsn_7TM.
    IPR008365. Prostanoid_rcpt.
    IPR001244. Prostglndn_DP_rcpt.
    IPR000265. Prostglndn_EP3_rcpt.
    [Graphical view]
    PANTHERiPTHR11866. PTHR11866. 1 hit.
    PTHR11866:SF10. PTHR11866:SF10. 1 hit.
    PfamiPF00001. 7tm_1. 1 hit.
    [Graphical view]
    PRINTSiPR00237. GPCRRHODOPSN.
    PR00428. PROSTAGLNDNR.
    PR01788. PROSTANOIDR.
    PR00585. PRSTNOIDE33R.
    PR00582. PRSTNOIDEP3R.
    PROSITEiPS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Note: Additional isoforms seem to exist. Isoforms have identical ligand binding properties but different coupling properties with G proteins: isoform Alpha and isoform Beta couple to G(i) proteins, whereas isoform Gamma couples to multiple G proteins, G(i) and G(s).

    Isoform Alpha (identifier: P34980-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAGVWAPEHS VEAHSNQSSA ADGCGSVSVA FPITMMVTGF VGNALAMLLV    50
    VRSYRRRESK RKKSFLLCIG WLALTDLVGQ LLTSPVVILV YLSQRRWEQL 100
    DPSGRLCTFF GLTMTVFGLS SLLVASAMAV ERALAIRAPH WYASHMKTRA 150
    TPVLLGVWLS VLAFALLPVL GVGRYSVQWP GTWCFISTGP AGNETDSARE 200
    PGSVAFASAF ACLGLLALVV TFACNLATIK ALVSRCRAKA AASQSSAQWG 250
    RITTETAIQL MGIMCVLSVC WSPLLIMMLK MIFNQMSVEQ CKTQMGKEKE 300
    CNSFLIAVRL ASLNQILDPW VYLLLRKILL RKFCQIRDHT NYASSSTSLP 350
    CPGSSVLMWS DQLER 365
    Length:365
    Mass (Da):39,942
    Last modified:February 1, 1994 - v1
    Checksum:i3247190CF95FD825
    GO
    Isoform Beta (identifier: P34980-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         336-365: IRDHTNYASSSTSLPCPGSSVLMWSDQLER → MMNNLKRSFIAIPASLSMRISSPREG

    Show »
    Length:361
    Mass (Da):39,511
    Checksum:iFF4E6C4D0675D4D0
    GO
    Isoform Gamma (identifier: P34980-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         336-365: IRDHTNYASSSTSLPCPGSSVLMWSDQLER → VANAVSSCSSDQQKGQAISLSNEVVHPGP

    Show »
    Length:364
    Mass (Da):39,514
    Checksum:i4F2B08636E7B04E3
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti51 – 511V → S(PubMed:8076679)Curated
    Sequence conflicti51 – 511V → S(PubMed:8919306)Curated
    Sequence conflicti354 – 3541S → F in CAA58735. (PubMed:8076679)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti152 – 1521P → RA.

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei336 – 36530IRDHT…DQLER → MMNNLKRSFIAIPASLSMRI SSPREG in isoform Beta. 2 PublicationsVSP_001949Add
    BLAST
    Alternative sequencei336 – 36530IRDHT…DQLER → VANAVSSCSSDQQKGQAISL SNEVVHPGP in isoform Gamma. 1 PublicationVSP_001950Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D14869 mRNA. Translation: BAA03585.1.
    D16443 mRNA. Translation: BAA03912.1.
    X80133 mRNA. Translation: CAA56432.1.
    D29969 mRNA. Translation: BAA06236.1.
    X83855 mRNA. Translation: CAA58735.1.
    PIRiJN0693.
    S48689.
    S51280.
    RefSeqiNP_036836.1. NM_012704.1.
    UniGeneiRn.10361.

    Genome annotation databases

    EnsembliENSRNOT00000014126; ENSRNOP00000014126; ENSRNOG00000010325.
    GeneIDi24929.
    KEGGirno:24929.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D14869 mRNA. Translation: BAA03585.1 .
    D16443 mRNA. Translation: BAA03912.1 .
    X80133 mRNA. Translation: CAA56432.1 .
    D29969 mRNA. Translation: BAA06236.1 .
    X83855 mRNA. Translation: CAA58735.1 .
    PIRi JN0693.
    S48689.
    S51280.
    RefSeqi NP_036836.1. NM_012704.1.
    UniGenei Rn.10361.

    3D structure databases

    ProteinModelPortali P34980.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    MINTi MINT-189653.

    Chemistry

    BindingDBi P34980.
    ChEMBLi CHEMBL5674.
    GuidetoPHARMACOLOGYi 342.

    Protein family/group databases

    GPCRDBi Search...

    Proteomic databases

    PaxDbi P34980.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSRNOT00000014126 ; ENSRNOP00000014126 ; ENSRNOG00000010325 .
    GeneIDi 24929.
    KEGGi rno:24929.

    Organism-specific databases

    CTDi 5733.
    RGDi 3435. Ptger3.

    Phylogenomic databases

    eggNOGi NOG244691.
    GeneTreei ENSGT00690000102015.
    HOGENOMi HOG000015238.
    HOVERGENi HBG052720.
    InParanoidi P34980.
    KOi K04260.
    OrthoDBi EOG70W3D9.
    PhylomeDBi P34980.

    Miscellaneous databases

    NextBioi 604891.
    PROi P34980.

    Gene expression databases

    Genevestigatori P34980.

    Family and domain databases

    Gene3Di 1.20.1070.10. 1 hit.
    InterProi IPR000154. EP3_rcpt_3.
    IPR000276. GPCR_Rhodpsn.
    IPR017452. GPCR_Rhodpsn_7TM.
    IPR008365. Prostanoid_rcpt.
    IPR001244. Prostglndn_DP_rcpt.
    IPR000265. Prostglndn_EP3_rcpt.
    [Graphical view ]
    PANTHERi PTHR11866. PTHR11866. 1 hit.
    PTHR11866:SF10. PTHR11866:SF10. 1 hit.
    Pfami PF00001. 7tm_1. 1 hit.
    [Graphical view ]
    PRINTSi PR00237. GPCRRHODOPSN.
    PR00428. PROSTAGLNDNR.
    PR01788. PROSTANOIDR.
    PR00585. PRSTNOIDE33R.
    PR00582. PRSTNOIDEP3R.
    PROSITEi PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Molecular cloning and intrarenal localization of rat prostaglandin E2 receptor EP3 subtype."
      Takeuchi K., Abe T., Takahashi N., Abe K.
      Biochem. Biophys. Res. Commun. 194:885-891(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA].
      Strain: Sprague-Dawley.
      Tissue: Kidney.
    2. "Two isoforms of the rat kidney EP3 receptor derived by alternative RNA splicing: intrarenal expression co-localization."
      Takeuchi K., Takahashi N., Abe T., Abe K.
      Biochem. Biophys. Res. Commun. 199:834-840(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA AND GAMMA).
      Strain: Sprague-Dawley.
      Tissue: Kidney.
    3. "Molecular cloning and expression of a prostaglandin E2 receptor of the EP3 beta subtype from rat hepatocytes."
      Neuschaefer-Rube F., de Vries C., Haenecke K., Jungermann K., Pueschel G.P.
      FEBS Lett. 351:119-122(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA AND BETA).
      Tissue: Hepatocyte.
    4. "Expression pattern of messenger RNAs for prostanoid receptors in glial cell cultures."
      Kitanaka J., Hashimoto H., Gotoh M., Kondo K., Sakata K., Hirasawa Y., Sawada M., Suzumura A., Marunouchi T., Matsuda T., Baba A.
      Brain Res. 707:282-287(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM BETA).
      Strain: Sprague-Dawley.
      Tissue: Brain cortex.

    Entry informationi

    Entry nameiPE2R3_RAT
    AccessioniPrimary (citable) accession number: P34980
    Secondary accession number(s): Q63194, Q64376
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 1, 1994
    Last sequence update: February 1, 1994
    Last modified: October 1, 2014
    This is version 119 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. 7-transmembrane G-linked receptors
      List of 7-transmembrane G-linked receptor entries
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3