Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Prostaglandin E2 receptor EP3 subtype

Gene

Ptger3

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Receptor for prostaglandin E2 (PGE2); the EP3 receptor may be involved in inhibition of gastric acid secretion, modulation of neurotransmitter release in central and peripheral neurons, inhibition of sodium and water reabsorption in kidney tubulus and contraction in uterine smooth muscle. The activity of this receptor can couple to both the inhibition of adenylate cyclase mediated by G(i) proteins, and to an elevation of intracellular calcium. The various forms can interact with different second messenger systems (By similarity).By similarity

GO - Molecular functioni

  • prostaglandin E receptor activity Source: RGD

GO - Biological processi

  • cellular response to interleukin-1 Source: RGD
  • desensitization of G-protein coupled receptor protein signaling pathway Source: RGD
  • negative regulation of cAMP biosynthetic process Source: RGD
  • positive regulation of cAMP biosynthetic process Source: RGD
  • positive regulation of neutrophil extravasation Source: RGD
  • response to salt Source: RGD
Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

ReactomeiREACT_310434. Prostanoid ligand receptors.
REACT_339234. G alpha (i) signalling events.

Names & Taxonomyi

Protein namesi
Recommended name:
Prostaglandin E2 receptor EP3 subtype
Short name:
PGE receptor EP3 subtype
Short name:
PGE2 receptor EP3 subtype
Alternative name(s):
Prostanoid EP3 receptor
Gene namesi
Name:Ptger3
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
ProteomesiUP000002494 Componenti: Unplaced

Organism-specific databases

RGDi3435. Ptger3.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 3030ExtracellularSequence AnalysisAdd
BLAST
Transmembranei31 – 5525Helical; Name=1Sequence AnalysisAdd
BLAST
Topological domaini56 – 6813CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei69 – 8921Helical; Name=2Sequence AnalysisAdd
BLAST
Topological domaini90 – 10819ExtracellularSequence AnalysisAdd
BLAST
Transmembranei109 – 13022Helical; Name=3Sequence AnalysisAdd
BLAST
Topological domaini131 – 15121CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei152 – 17322Helical; Name=4Sequence AnalysisAdd
BLAST
Topological domaini174 – 20330ExtracellularSequence AnalysisAdd
BLAST
Transmembranei204 – 22926Helical; Name=5Sequence AnalysisAdd
BLAST
Topological domaini230 – 25930CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei260 – 28324Helical; Name=6Sequence AnalysisAdd
BLAST
Topological domaini284 – 30320ExtracellularSequence AnalysisAdd
BLAST
Transmembranei304 – 32522Helical; Name=7Sequence AnalysisAdd
BLAST
Topological domaini326 – 36540CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  • brush border membrane Source: RGD
  • integral component of membrane Source: UniProtKB-KW
  • neuronal cell body Source: RGD
  • neuron projection Source: RGD
  • nuclear membrane Source: RGD
  • plasma membrane Source: RGD
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 365365Prostaglandin E2 receptor EP3 subtypePRO_0000070062Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi16 – 161N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi107 ↔ 184PROSITE-ProRule annotation
Glycosylationi193 – 1931N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Disulfide bond, Glycoprotein, Lipoprotein, Palmitate

Proteomic databases

PaxDbiP34980.

Expressioni

Tissue specificityi

Principally expressed in the tubules of the renal medulla. Specific expression is seen in medullary and cortical thick ascending limbs; lower levels are detected in cortical and inner medullary collecting ducts. Not detected significantly in the glomeruli. In the brain, expressed in all types of glial cells.

Gene expression databases

ExpressionAtlasiP34980. baseline.
GenevisibleiP34980. RN.

Interactioni

Protein-protein interaction databases

MINTiMINT-189653.
STRINGi10116.ENSRNOP00000014034.

Structurei

3D structure databases

ProteinModelPortaliP34980.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG244691.
HOGENOMiHOG000015238.
HOVERGENiHBG052720.
InParanoidiP34980.
KOiK04260.
OrthoDBiEOG70W3D9.
PhylomeDBiP34980.

Family and domain databases

InterProiIPR000154. EP3_rcpt_3.
IPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
IPR008365. Prostanoid_rcpt.
IPR001244. Prostglndn_DP_rcpt.
IPR000265. Prostglndn_EP3_rcpt.
[Graphical view]
PANTHERiPTHR11866. PTHR11866. 1 hit.
PTHR11866:SF10. PTHR11866:SF10. 1 hit.
PfamiPF00001. 7tm_1. 1 hit.
[Graphical view]
PRINTSiPR00237. GPCRRHODOPSN.
PR00428. PROSTAGLNDNR.
PR01788. PROSTANOIDR.
PR00585. PRSTNOIDE33R.
PR00582. PRSTNOIDEP3R.
PROSITEiPS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist. Isoforms have identical ligand binding properties but different coupling properties with G proteins: isoform Alpha and isoform Beta couple to G(i) proteins, whereas isoform Gamma couples to multiple G proteins, G(i) and G(s).

Isoform Alpha (identifier: P34980-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAGVWAPEHS VEAHSNQSSA ADGCGSVSVA FPITMMVTGF VGNALAMLLV
60 70 80 90 100
VRSYRRRESK RKKSFLLCIG WLALTDLVGQ LLTSPVVILV YLSQRRWEQL
110 120 130 140 150
DPSGRLCTFF GLTMTVFGLS SLLVASAMAV ERALAIRAPH WYASHMKTRA
160 170 180 190 200
TPVLLGVWLS VLAFALLPVL GVGRYSVQWP GTWCFISTGP AGNETDSARE
210 220 230 240 250
PGSVAFASAF ACLGLLALVV TFACNLATIK ALVSRCRAKA AASQSSAQWG
260 270 280 290 300
RITTETAIQL MGIMCVLSVC WSPLLIMMLK MIFNQMSVEQ CKTQMGKEKE
310 320 330 340 350
CNSFLIAVRL ASLNQILDPW VYLLLRKILL RKFCQIRDHT NYASSSTSLP
360
CPGSSVLMWS DQLER
Length:365
Mass (Da):39,942
Last modified:February 1, 1994 - v1
Checksum:i3247190CF95FD825
GO
Isoform Beta (identifier: P34980-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     336-365: IRDHTNYASSSTSLPCPGSSVLMWSDQLER → MMNNLKRSFIAIPASLSMRISSPREG

Show »
Length:361
Mass (Da):39,511
Checksum:iFF4E6C4D0675D4D0
GO
Isoform Gamma (identifier: P34980-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     336-365: IRDHTNYASSSTSLPCPGSSVLMWSDQLER → VANAVSSCSSDQQKGQAISLSNEVVHPGP

Show »
Length:364
Mass (Da):39,514
Checksum:i4F2B08636E7B04E3
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti51 – 511V → S (PubMed:8076679).Curated
Sequence conflicti51 – 511V → S (PubMed:8919306).Curated
Sequence conflicti354 – 3541S → F in CAA58735 (PubMed:8076679).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti152 – 1521P → RA.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei336 – 36530IRDHT…DQLER → MMNNLKRSFIAIPASLSMRI SSPREG in isoform Beta. 2 PublicationsVSP_001949Add
BLAST
Alternative sequencei336 – 36530IRDHT…DQLER → VANAVSSCSSDQQKGQAISL SNEVVHPGP in isoform Gamma. 1 PublicationVSP_001950Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D14869 mRNA. Translation: BAA03585.1.
D16443 mRNA. Translation: BAA03912.1.
X80133 mRNA. Translation: CAA56432.1.
D29969 mRNA. Translation: BAA06236.1.
X83855 mRNA. Translation: CAA58735.1.
PIRiJN0693.
S48689.
S51280.
RefSeqiNP_036836.1. NM_012704.1.
UniGeneiRn.10361.

Genome annotation databases

GeneIDi24929.
KEGGirno:24929.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D14869 mRNA. Translation: BAA03585.1.
D16443 mRNA. Translation: BAA03912.1.
X80133 mRNA. Translation: CAA56432.1.
D29969 mRNA. Translation: BAA06236.1.
X83855 mRNA. Translation: CAA58735.1.
PIRiJN0693.
S48689.
S51280.
RefSeqiNP_036836.1. NM_012704.1.
UniGeneiRn.10361.

3D structure databases

ProteinModelPortaliP34980.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

MINTiMINT-189653.
STRINGi10116.ENSRNOP00000014034.

Chemistry

BindingDBiP34980.
ChEMBLiCHEMBL5674.
GuidetoPHARMACOLOGYi342.

Protein family/group databases

GPCRDBiSearch...

Proteomic databases

PaxDbiP34980.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi24929.
KEGGirno:24929.

Organism-specific databases

CTDi5733.
RGDi3435. Ptger3.

Phylogenomic databases

eggNOGiNOG244691.
HOGENOMiHOG000015238.
HOVERGENiHBG052720.
InParanoidiP34980.
KOiK04260.
OrthoDBiEOG70W3D9.
PhylomeDBiP34980.

Enzyme and pathway databases

ReactomeiREACT_310434. Prostanoid ligand receptors.
REACT_339234. G alpha (i) signalling events.

Miscellaneous databases

NextBioi604891.
PROiP34980.

Gene expression databases

ExpressionAtlasiP34980. baseline.
GenevisibleiP34980. RN.

Family and domain databases

InterProiIPR000154. EP3_rcpt_3.
IPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
IPR008365. Prostanoid_rcpt.
IPR001244. Prostglndn_DP_rcpt.
IPR000265. Prostglndn_EP3_rcpt.
[Graphical view]
PANTHERiPTHR11866. PTHR11866. 1 hit.
PTHR11866:SF10. PTHR11866:SF10. 1 hit.
PfamiPF00001. 7tm_1. 1 hit.
[Graphical view]
PRINTSiPR00237. GPCRRHODOPSN.
PR00428. PROSTAGLNDNR.
PR01788. PROSTANOIDR.
PR00585. PRSTNOIDE33R.
PR00582. PRSTNOIDEP3R.
PROSITEiPS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Molecular cloning and intrarenal localization of rat prostaglandin E2 receptor EP3 subtype."
    Takeuchi K., Abe T., Takahashi N., Abe K.
    Biochem. Biophys. Res. Commun. 194:885-891(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA].
    Strain: Sprague-Dawley.
    Tissue: Kidney.
  2. "Two isoforms of the rat kidney EP3 receptor derived by alternative RNA splicing: intrarenal expression co-localization."
    Takeuchi K., Takahashi N., Abe T., Abe K.
    Biochem. Biophys. Res. Commun. 199:834-840(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA AND GAMMA).
    Strain: Sprague-Dawley.
    Tissue: Kidney.
  3. "Molecular cloning and expression of a prostaglandin E2 receptor of the EP3 beta subtype from rat hepatocytes."
    Neuschaefer-Rube F., de Vries C., Haenecke K., Jungermann K., Pueschel G.P.
    FEBS Lett. 351:119-122(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA AND BETA).
    Tissue: Hepatocyte.
  4. "Expression pattern of messenger RNAs for prostanoid receptors in glial cell cultures."
    Kitanaka J., Hashimoto H., Gotoh M., Kondo K., Sakata K., Hirasawa Y., Sawada M., Suzumura A., Marunouchi T., Matsuda T., Baba A.
    Brain Res. 707:282-287(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM BETA).
    Strain: Sprague-Dawley.
    Tissue: Brain cortex.

Entry informationi

Entry nameiPE2R3_RAT
AccessioniPrimary (citable) accession number: P34980
Secondary accession number(s): Q63194, Q64376
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: February 1, 1994
Last modified: June 24, 2015
This is version 126 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.