P34980 (PE2R3_RAT) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 109.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Prostaglandin E2 receptor EP3 subtype Short name=PGE receptor EP3 subtype Short name=PGE2 receptor EP3 subtype Alternative name(s): Prostanoid EP3 receptor | ||
| Gene names |
| ||
| Organism | Rattus norvegicus (Rat) [Reference proteome] | ||
| Taxonomic identifier | 10116 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Rattus![]() |
Protein attributes
| Sequence length | 365 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Receptor for prostaglandin E2 (PGE2); the EP3 receptor may be involved in inhibition of gastric acid secretion, modulation of neurotransmitter release in central and peripheral neurons, inhibition of sodium and water reabsorption in kidney tubulus and contraction in uterine smooth muscle. The activity of this receptor can couple to both the inhibition of adenylate cyclase mediated by G(i) proteins, and to an elevation of intracellular calcium. The various forms can interact with different second messenger systems By similarity. |
| Subcellular location | |
| Tissue specificity | Principally expressed in the tubules of the renal medulla. Specific expression is seen in medullary and cortical thick ascending limbs; lower levels are detected in cortical and inner medullary collecting ducts. Not detected significantly in the glomeruli. In the brain, expressed in all types of glial cells. |
| Sequence similarities | Belongs to the G-protein coupled receptor 1 family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Transmembrane Transmembrane helix |
| Molecular function | G-protein coupled receptor Receptor Transducer |
| PTM | Disulfide bond Glycoprotein Lipoprotein Palmitate |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW plasma membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | prostaglandin E receptor activity Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. Isoforms have identical ligand binding properties but different coupling properties with G proteins: isoform Alpha and isoform Beta couple to G(i) proteins, whereas isoform Gamma couples to multiple G proteins, G(i) and G(s). | ||||||
| Isoform Alpha (identifier: P34980-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Beta (identifier: P34980-2) The sequence of this isoform differs from the canonical sequence as follows: 336-365: IRDHTNYASSSTSLPCPGSSVLMWSDQLER → MMNNLKRSFIAIPASLSMRISSPREG | ||||||
| Isoform Gamma (identifier: P34980-3) The sequence of this isoform differs from the canonical sequence as follows: 336-365: IRDHTNYASSSTSLPCPGSSVLMWSDQLER → VANAVSSCSSDQQKGQAISLSNEVVHPGP |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 365 | 365 | Prostaglandin E2 receptor EP3 subtype | PRO_0000070062 | |||||||
Regions | |||||||||||
| Topological domain | 1 – 30 | 30 | Extracellular Potential | ||||||||
| Transmembrane | 31 – 55 | 25 | Helical; Name=1; Potential | ||||||||
| Topological domain | 56 – 68 | 13 | Cytoplasmic Potential | ||||||||
| Transmembrane | 69 – 89 | 21 | Helical; Name=2; Potential | ||||||||
| Topological domain | 90 – 108 | 19 | Extracellular Potential | ||||||||
| Transmembrane | 109 – 130 | 22 | Helical; Name=3; Potential | ||||||||
| Topological domain | 131 – 151 | 21 | Cytoplasmic Potential | ||||||||
| Transmembrane | 152 – 173 | 22 | Helical; Name=4; Potential | ||||||||
| Topological domain | 174 – 203 | 30 | Extracellular Potential | ||||||||
| Transmembrane | 204 – 229 | 26 | Helical; Name=5; Potential | ||||||||
| Topological domain | 230 – 259 | 30 | Cytoplasmic Potential | ||||||||
| Transmembrane | 260 – 283 | 24 | Helical; Name=6; Potential | ||||||||
| Topological domain | 284 – 303 | 20 | Extracellular Potential | ||||||||
| Transmembrane | 304 – 325 | 22 | Helical; Name=7; Potential | ||||||||
| Topological domain | 326 – 365 | 40 | Cytoplasmic Potential | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 16 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 193 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 107 ↔ 184 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 336 – 365 | 30 | IRDHT…DQLER → MMNNLKRSFIAIPASLSMRI SSPREG in isoform Beta. | VSP_001949 | |||||||
| Alternative sequence | 336 – 365 | 30 | IRDHT…DQLER → VANAVSSCSSDQQKGQAISL SNEVVHPGP in isoform Gamma. | VSP_001950 | |||||||
| Natural variant | 152 | 1 | P → RA. | ||||||||
Experimental info | |||||||||||
| Sequence conflict | 51 | 1 | V → S Ref.3 | ||||||||
| Sequence conflict | 51 | 1 | V → S Ref.4 | ||||||||
| Sequence conflict | 354 | 1 | S → F in CAA58735. Ref.3 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| [1] | "Molecular cloning and intrarenal localization of rat prostaglandin E2 receptor EP3 subtype." Takeuchi K., Abe T., Takahashi N., Abe K. Biochem. Biophys. Res. Commun. 194:885-891(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Strain: Sprague-Dawley. Tissue: Kidney. |
| [2] | "Two isoforms of the rat kidney EP3 receptor derived by alternative RNA splicing: intrarenal expression co-localization." Takeuchi K., Takahashi N., Abe T., Abe K. Biochem. Biophys. Res. Commun. 199:834-840(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA AND GAMMA). Strain: Sprague-Dawley. Tissue: Kidney. |
| [3] | "Molecular cloning and expression of a prostaglandin E2 receptor of the EP3 beta subtype from rat hepatocytes." Neuschaefer-Rube F., de Vries C., Haenecke K., Jungermann K., Pueschel G.P. FEBS Lett. 351:119-122(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA AND BETA). Tissue: Hepatocyte. |
| [4] | "Expression pattern of messenger RNAs for prostanoid receptors in glial cell cultures." Kitanaka J., Hashimoto H., Gotoh M., Kondo K., Sakata K., Hirasawa Y., Sawada M., Suzumura A., Marunouchi T., Matsuda T., Baba A. Brain Res. 707:282-287(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM BETA). Strain: Sprague-Dawley. Tissue: Brain cortex. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | D14869 mRNA. Translation: BAA03585.1. D16443 mRNA. Translation: BAA03912.1. X80133 mRNA. Translation: CAA56432.1. D29969 mRNA. Translation: BAA06236.1. X83855 mRNA. Translation: CAA58735.1. |
| IPI | IPI00210321. IPI00231640. IPI00231725. |
| PIR | JN0693. S48689. S51280. |
| RefSeq | NP_036836.1. NM_012704.1. |
| UniGene | Rn.10361. |
3D structure databases | |
| ProteinModelPortal | P34980. |
| ModBase | Search... |
Protein family/group databases | |
| GPCRDB | Search... |
Proteomic databases | |
| PaxDb | P34980. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSRNOT00000014126; ENSRNOP00000014126; ENSRNOG00000010325. |
| GeneID | 24929. |
| KEGG | rno:24929. |
Organism-specific databases | |
| CTD | 5733. |
| RGD | 3435. Ptger3. |
Phylogenomic databases | |
| eggNOG | NOG244691. |
| GeneTree | ENSGT00690000102015. |
| HOGENOM | HOG000015238. |
| HOVERGEN | HBG052720. |
| InParanoid | P34980. |
| KO | K04260. |
Gene expression databases | |
| Genevestigator | P34980. |
| GermOnline | ENSRNOG00000010325. Rattus norvegicus. |
Family and domain databases | |
| InterPro | IPR000154. EP3_rcpt_3. IPR000276. GPCR_Rhodpsn. IPR017452. GPCR_Rhodpsn_7TM. IPR008365. Prostanoid_rcpt. IPR001244. Prostglndn_DP_rcpt. IPR000265. Prostglndn_EP3_rcpt. [Graphical view] |
| PANTHER | PTHR11866. PTHR11866. 1 hit. PTHR11866:SF10. PTHR11866:SF10. 1 hit. |
| Pfam | PF00001. 7tm_1. 1 hit. [Graphical view] |
| PRINTS | PR00237. GPCRRHODOPSN. PR00428. PROSTAGLNDNR. PR01788. PROSTANOIDR. PR00585. PRSTNOIDE33R. PR00582. PRSTNOIDEP3R. |
| PROSITE | PS00237. G_PROTEIN_RECEP_F1_1. False negative. PS50262. G_PROTEIN_RECEP_F1_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | P34980. |
| ChEMBL | CHEMBL5674. |
| NextBio | 604891. |
Entry information
| Entry name | PE2R3_RAT | ||||||||
| Accession | Primary (citable) accession number: P34980 Secondary accession number(s): Q63194, Q64376 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| 7-transmembrane G-linked receptors List of 7-transmembrane G-linked receptor entries |
| SIMILARITY comments Index of protein domains and families |

Clusters with
