Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P34980 (PE2R3_RAT) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 118. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Prostaglandin E2 receptor EP3 subtype

Short name=PGE receptor EP3 subtype
Short name=PGE2 receptor EP3 subtype
Alternative name(s):
Prostanoid EP3 receptor
Gene names
Name:Ptger3
OrganismRattus norvegicus (Rat) [Reference proteome]
Taxonomic identifier10116 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus

Protein attributes

Sequence length365 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Receptor for prostaglandin E2 (PGE2); the EP3 receptor may be involved in inhibition of gastric acid secretion, modulation of neurotransmitter release in central and peripheral neurons, inhibition of sodium and water reabsorption in kidney tubulus and contraction in uterine smooth muscle. The activity of this receptor can couple to both the inhibition of adenylate cyclase mediated by G(i) proteins, and to an elevation of intracellular calcium. The various forms can interact with different second messenger systems By similarity.

Subcellular location

Cell membrane; Multi-pass membrane protein.

Tissue specificity

Principally expressed in the tubules of the renal medulla. Specific expression is seen in medullary and cortical thick ascending limbs; lower levels are detected in cortical and inner medullary collecting ducts. Not detected significantly in the glomeruli. In the brain, expressed in all types of glial cells.

Sequence similarities

Belongs to the G-protein coupled receptor 1 family.

Ontologies

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]

Note: Additional isoforms seem to exist. Isoforms have identical ligand binding properties but different coupling properties with G proteins: isoform Alpha and isoform Beta couple to G(i) proteins, whereas isoform Gamma couples to multiple G proteins, G(i) and G(s).
Isoform Alpha (identifier: P34980-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform Beta (identifier: P34980-2)

The sequence of this isoform differs from the canonical sequence as follows:
     336-365: IRDHTNYASSSTSLPCPGSSVLMWSDQLER → MMNNLKRSFIAIPASLSMRISSPREG
Isoform Gamma (identifier: P34980-3)

The sequence of this isoform differs from the canonical sequence as follows:
     336-365: IRDHTNYASSSTSLPCPGSSVLMWSDQLER → VANAVSSCSSDQQKGQAISLSNEVVHPGP

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 365365Prostaglandin E2 receptor EP3 subtype
PRO_0000070062

Regions

Topological domain1 – 3030Extracellular Potential
Transmembrane31 – 5525Helical; Name=1; Potential
Topological domain56 – 6813Cytoplasmic Potential
Transmembrane69 – 8921Helical; Name=2; Potential
Topological domain90 – 10819Extracellular Potential
Transmembrane109 – 13022Helical; Name=3; Potential
Topological domain131 – 15121Cytoplasmic Potential
Transmembrane152 – 17322Helical; Name=4; Potential
Topological domain174 – 20330Extracellular Potential
Transmembrane204 – 22926Helical; Name=5; Potential
Topological domain230 – 25930Cytoplasmic Potential
Transmembrane260 – 28324Helical; Name=6; Potential
Topological domain284 – 30320Extracellular Potential
Transmembrane304 – 32522Helical; Name=7; Potential
Topological domain326 – 36540Cytoplasmic Potential

Amino acid modifications

Glycosylation161N-linked (GlcNAc...) Potential
Glycosylation1931N-linked (GlcNAc...) Potential
Disulfide bond107 ↔ 184 By similarity

Natural variations

Alternative sequence336 – 36530IRDHT…DQLER → MMNNLKRSFIAIPASLSMRI SSPREG in isoform Beta.
VSP_001949
Alternative sequence336 – 36530IRDHT…DQLER → VANAVSSCSSDQQKGQAISL SNEVVHPGP in isoform Gamma.
VSP_001950
Natural variant1521P → RA.

Experimental info

Sequence conflict511V → S Ref.3
Sequence conflict511V → S Ref.4
Sequence conflict3541S → F in CAA58735. Ref.3

Sequences

Sequence LengthMass (Da)Tools
Isoform Alpha [UniParc].

Last modified February 1, 1994. Version 1.
Checksum: 3247190CF95FD825

FASTA36539,942
        10         20         30         40         50         60 
MAGVWAPEHS VEAHSNQSSA ADGCGSVSVA FPITMMVTGF VGNALAMLLV VRSYRRRESK 

        70         80         90        100        110        120 
RKKSFLLCIG WLALTDLVGQ LLTSPVVILV YLSQRRWEQL DPSGRLCTFF GLTMTVFGLS 

       130        140        150        160        170        180 
SLLVASAMAV ERALAIRAPH WYASHMKTRA TPVLLGVWLS VLAFALLPVL GVGRYSVQWP 

       190        200        210        220        230        240 
GTWCFISTGP AGNETDSARE PGSVAFASAF ACLGLLALVV TFACNLATIK ALVSRCRAKA 

       250        260        270        280        290        300 
AASQSSAQWG RITTETAIQL MGIMCVLSVC WSPLLIMMLK MIFNQMSVEQ CKTQMGKEKE 

       310        320        330        340        350        360 
CNSFLIAVRL ASLNQILDPW VYLLLRKILL RKFCQIRDHT NYASSSTSLP CPGSSVLMWS 


DQLER 

« Hide

Isoform Beta [UniParc].

Checksum: FF4E6C4D0675D4D0
Show »

FASTA36139,511
Isoform Gamma [UniParc].

Checksum: 4F2B08636E7B04E3
Show »

FASTA36439,514

References

[1]"Molecular cloning and intrarenal localization of rat prostaglandin E2 receptor EP3 subtype."
Takeuchi K., Abe T., Takahashi N., Abe K.
Biochem. Biophys. Res. Commun. 194:885-891(1993) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA].
Strain: Sprague-Dawley.
Tissue: Kidney.
[2]"Two isoforms of the rat kidney EP3 receptor derived by alternative RNA splicing: intrarenal expression co-localization."
Takeuchi K., Takahashi N., Abe T., Abe K.
Biochem. Biophys. Res. Commun. 199:834-840(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA AND GAMMA).
Strain: Sprague-Dawley.
Tissue: Kidney.
[3]"Molecular cloning and expression of a prostaglandin E2 receptor of the EP3 beta subtype from rat hepatocytes."
Neuschaefer-Rube F., de Vries C., Haenecke K., Jungermann K., Pueschel G.P.
FEBS Lett. 351:119-122(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA AND BETA).
Tissue: Hepatocyte.
[4]"Expression pattern of messenger RNAs for prostanoid receptors in glial cell cultures."
Kitanaka J., Hashimoto H., Gotoh M., Kondo K., Sakata K., Hirasawa Y., Sawada M., Suzumura A., Marunouchi T., Matsuda T., Baba A.
Brain Res. 707:282-287(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM BETA).
Strain: Sprague-Dawley.
Tissue: Brain cortex.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
D14869 mRNA. Translation: BAA03585.1.
D16443 mRNA. Translation: BAA03912.1.
X80133 mRNA. Translation: CAA56432.1.
D29969 mRNA. Translation: BAA06236.1.
X83855 mRNA. Translation: CAA58735.1.
PIRJN0693.
S48689.
S51280.
RefSeqNP_036836.1. NM_012704.1.
UniGeneRn.10361.

3D structure databases

ProteinModelPortalP34980.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

MINTMINT-189653.

Chemistry

BindingDBP34980.
ChEMBLCHEMBL5674.
GuidetoPHARMACOLOGY342.

Protein family/group databases

GPCRDBSearch...

Proteomic databases

PaxDbP34980.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSRNOT00000014126; ENSRNOP00000014126; ENSRNOG00000010325.
GeneID24929.
KEGGrno:24929.

Organism-specific databases

CTD5733.
RGD3435. Ptger3.

Phylogenomic databases

eggNOGNOG244691.
GeneTreeENSGT00690000102015.
HOGENOMHOG000015238.
HOVERGENHBG052720.
InParanoidP34980.
KOK04260.
OrthoDBEOG70W3D9.
PhylomeDBP34980.

Gene expression databases

GenevestigatorP34980.

Family and domain databases

Gene3D1.20.1070.10. 1 hit.
InterProIPR000154. EP3_rcpt_3.
IPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
IPR008365. Prostanoid_rcpt.
IPR001244. Prostglndn_DP_rcpt.
IPR000265. Prostglndn_EP3_rcpt.
[Graphical view]
PANTHERPTHR11866. PTHR11866. 1 hit.
PTHR11866:SF10. PTHR11866:SF10. 1 hit.
PfamPF00001. 7tm_1. 1 hit.
[Graphical view]
PRINTSPR00237. GPCRRHODOPSN.
PR00428. PROSTAGLNDNR.
PR01788. PROSTANOIDR.
PR00585. PRSTNOIDE33R.
PR00582. PRSTNOIDEP3R.
PROSITEPS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio604891.
PROP34980.

Entry information

Entry namePE2R3_RAT
AccessionPrimary (citable) accession number: P34980
Secondary accession number(s): Q63194, Q64376
Entry history
Integrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: February 1, 1994
Last modified: April 16, 2014
This is version 118 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

7-transmembrane G-linked receptors

List of 7-transmembrane G-linked receptor entries