P34969 (5HT7R_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 127.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: 5-hydroxytryptamine receptor 7 Short name=5-HT-7 Short name=5-HT7 Alternative name(s): 5-HT-X Serotonin receptor 7 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 479 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that stimulate adenylate cyclase. |
| Subcellular location | |
| Tissue specificity | Isoform A is the predominant isoform in spleen, caudate and hippocampus. Isoform B is expressed at lower levels. Isoform D is a minor isoform in term of expression. Ref.1 |
| Sequence similarities | Belongs to the G-protein coupled receptor 1 family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transmembrane Transmembrane helix |
| Molecular function | G-protein coupled receptor Receptor Transducer |
| PTM | Disulfide bond Glycoprotein Lipoprotein Palmitate |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | G-protein coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger Traceable author statement Ref.2. Source: ProtInc blood circulationTraceable author statement Ref.2. Source: ProtInc circadian rhythmTraceable author statement PubMed 8398139. Source: ProtInc synaptic transmissionTraceable author statement Ref.2. Source: ProtInc |
| Cellular_component | integral to plasma membrane Traceable author statement Ref.2. Source: ProtInc |
| Molecular_function | serotonin receptor activity Traceable author statement Ref.2. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] Note: Isoform A and isoform B appear to be expressed at higher levels. | ||||||
| Isoform D (identifier: P34969-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform A (identifier: P34969-2) The sequence of this isoform differs from the canonical sequence as follows: 433-479: RACTRRVLLRPEKRPPVSVWVLQSPDHHNWLADKMLTTVEKKVMIHD → QNADYCRKKGHDS | ||||||
| Isoform B (identifier: P34969-3) The sequence of this isoform differs from the canonical sequence as follows: 433-479: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 479 | 479 | 5-hydroxytryptamine receptor 7 | PRO_0000068979 | |||||||
Regions | |||||||||||
| Topological domain | 1 – 83 | 83 | Extracellular By similarity | ||||||||
| Transmembrane | 84 – 104 | 21 | Helical; Name=1; By similarity | ||||||||
| Topological domain | 105 – 117 | 13 | Cytoplasmic By similarity | ||||||||
| Transmembrane | 118 – 138 | 21 | Helical; Name=2; By similarity | ||||||||
| Topological domain | 139 – 157 | 19 | Extracellular By similarity | ||||||||
| Transmembrane | 158 – 178 | 21 | Helical; Name=3; By similarity | ||||||||
| Topological domain | 179 – 201 | 23 | Cytoplasmic By similarity | ||||||||
| Transmembrane | 202 – 222 | 21 | Helical; Name=4; By similarity | ||||||||
| Topological domain | 223 – 236 | 14 | Extracellular By similarity | ||||||||
| Transmembrane | 237 – 257 | 21 | Helical; Name=5; By similarity | ||||||||
| Topological domain | 258 – 325 | 68 | Cytoplasmic By similarity | ||||||||
| Transmembrane | 326 – 346 | 21 | Helical; Name=6; By similarity | ||||||||
| Topological domain | 347 – 367 | 21 | Extracellular By similarity | ||||||||
| Transmembrane | 368 – 388 | 21 | Helical; Name=7; By similarity | ||||||||
| Topological domain | 389 – 479 | 91 | Cytoplasmic By similarity | ||||||||
Amino acid modifications | |||||||||||
| Lipidation | 401 | 1 | S-palmitoyl cysteine Potential | ||||||||
| Glycosylation | 5 | 1 | N-linked (GlcNAc...) Ref.9 | ||||||||
| Glycosylation | 66 | 1 | N-linked (GlcNAc...) Ref.9 | ||||||||
| Disulfide bond | 155 ↔ 231 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 433 – 479 | 47 | RACTR…VMIHD → QNADYCRKKGHDS in isoform A. | VSP_001857 | |||||||
| Alternative sequence | 433 – 479 | 47 | Missing in isoform B. | VSP_001856 | |||||||
| Natural variant | 92 | 1 | T → K. Ref.10 | VAR_012995 | |||||||
| Natural variant | 279 | 1 | P → L. Ref.10 | VAR_012996 | |||||||
| Natural variant | 448 | 1 | P → Q. Corresponds to variant rs33954285 [ dbSNP | Ensembl ]. | VAR_049365 | |||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Four 5-hydroxytryptamine7 (5-HT7) receptor isoforms in human and rat produced by alternative splicing: species differences due to altered intron-exon organization." Heidmann D.E.A., Metcalf M.A., Kohen R., Hamblin M.W. J. Neurochem. 68:1372-1381(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA], ALTERNATIVE SPLICING, TISSUE SPECIFICITY. |
| [2] | "Cloning of a novel human serotonin receptor (5-HT7) positively linked to adenylate cyclase." Bard J.A., Zgombick J.M., Adham N., Vaysse P., Branchek T.A., Weinshank R.L. J. Biol. Chem. 268:23422-23426(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A). Tissue: Fetal brain and Placenta. |
| [3] | "Isolation of cDNA coding for 5-hydroxytryptamine receptor 7, transcript variant b (HTR7B)." King M.M., Aronstam R.S., Sharma S.V. Submitted (DEC-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM B). Tissue: Brain. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. Tissue: Testis. |
| [5] | "Human protein factory for converting the transcriptome into an in vitro-expressed proteome." Goshima N., Kawamura Y., Fukumoto A., Miura A., Honma R., Satoh R., Wakamatsu A., Yamamoto J., Kimura K., Nishikawa T., Andoh T., Iida Y., Ishikawa K., Ito E., Kagawa N., Kaminaga C., Kanehori K., Kawakami B. Nomura N.Nat. Methods 5:1011-1017(2008) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM B). |
| [6] | "The DNA sequence and comparative analysis of human chromosome 10." Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. Rogers J.Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A). Tissue: Testis. |
| [9] | "Biochemical and pharmacological study of N-linked glycosylation of the human serotonin 5-HT(7)a receptor." Gellynck E., Andressen K.W., Lintermans B., Haegeman G., Levy F.O., Vanhoenacker P., Van Craenenbroeck K. FEBS J. 279:1994-2003(2012) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION AT ASN-5 AND ASN-66. |
| [10] | "The human serotonin 7 (5-HT7) receptor gene: genomic organization and systematic mutation screening in schizophrenia and bipolar affective disorder." Erdmann J., Nothen M.M., Shimron-Abarbanell D., Rietschel M., Albus M., Borrmann M., Maier W., Franzek E., Korner J., Weigelt B., Fimmers R., Propping P. Mol. Psychiatry 1:392-397(1996) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS LYS-92 AND LEU-279. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U68487 mRNA. Translation: AAB48393.1. U68488 mRNA. Translation: AAB48394.1. U68492 Genomic DNA. Translation: AAF07218.1. U68493, U68492 Genomic DNA. Translation: AAF07217.1. U68493, U68492 Genomic DNA. Translation: AAB48397.2. L21195 mRNA. Translation: AAC37538.1. AY493988 mRNA. Translation: AAR87480.1. AK292606 mRNA. Translation: BAF85295.1. AB451482 mRNA. Translation: BAG70296.1. AL360011 Genomic DNA. Translation: CAH69966.1. AL360011 Genomic DNA. Translation: CAH69967.1. AL360011 Genomic DNA. Translation: CAH69968.1. CH471066 Genomic DNA. Translation: EAW50118.1. CH471066 Genomic DNA. Translation: EAW50119.1. CH471066 Genomic DNA. Translation: EAW50120.1. BC047526 mRNA. Translation: AAH47526.1. |
| IPI | IPI00003048. IPI00015395. IPI00553192. |
| PIR | A48881. |
| RefSeq | NP_000863.1. NM_000872.4. NP_062873.1. NM_019859.3. NP_062874.1. NM_019860.3. |
| UniGene | Hs.73739. |
3D structure databases | |
| ProteinModelPortal | P34969. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P34969. 2 interactions. |
| STRING | 9606.ENSP00000337949. |
Protein family/group databases | |
| GPCRDB | Search... |
Polymorphism databases | |
| DMDM | 8488960. |
Proteomic databases | |
| PaxDb | P34969. |
| PRIDE | P34969. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000277874; ENSP00000277874; ENSG00000148680. ENST00000336152; ENSP00000337949; ENSG00000148680. ENST00000371719; ENSP00000360784; ENSG00000148680. |
| GeneID | 3363. |
| KEGG | hsa:3363. |
| UCSC | uc001kgz.3. human. uc001kha.3. human. |
Organism-specific databases | |
| CTD | 3363. |
| GeneCards | GC10M092490. |
| HGNC | HGNC:5302. HTR7. |
| HPA | CAB022708. |
| MIM | 182137. gene. |
| neXtProt | NX_P34969. |
| PharmGKB | PA29561. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG249628. |
| HOVERGEN | HBG106962. |
| InParanoid | P34969. |
| KO | K04163. |
| OMA | PTWDAPP. |
| OrthoDB | EOG4F1X37. |
| PhylomeDB | P34969. |
Enzyme and pathway databases | |
| Reactome | REACT_111102. Signal Transduction. |
Gene expression databases | |
| ArrayExpress | P34969. |
| Bgee | P34969. |
| CleanEx | HS_HTR7. |
| Genevestigator | P34969. |
| GermOnline | ENSG00000148680. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR001069. 5HT_7_rcpt. IPR000276. GPCR_Rhodpsn. IPR017452. GPCR_Rhodpsn_7TM. [Graphical view] |
| Pfam | PF00001. 7tm_1. 1 hit. [Graphical view] |
| PRINTS | PR00652. 5HT7RECEPTR. PR00237. GPCRRHODOPSN. |
| PROSITE | PS00237. G_PROTEIN_RECEP_F1_1. 1 hit. PS50262. G_PROTEIN_RECEP_F1_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | P34969. |
| ChEMBL | CHEMBL3155. |
| DrugBank | DB00216. Eletriptan. DB00247. Methysergide. DB00246. Ziprasidone. |
| GenomeRNAi | 3363. |
| NextBio | 13312. |
| SOURCE | Search... |
Entry information
| Entry name | 5HT7R_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P34969 Secondary accession number(s): B5BUP6 Q5VX03 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| 7-transmembrane G-linked receptors List of 7-transmembrane G-linked receptor entries |
| Human chromosome 10 Human chromosome 10: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
