Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

5-hydroxytryptamine receptor 7

Gene

HTR7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that stimulate adenylate cyclase.

GO - Molecular functioni

  • G-protein coupled serotonin receptor activity Source: ProtInc

GO - Biological processi

  • blood circulation Source: ProtInc
  • circadian rhythm Source: ProtInc
  • G-protein coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger Source: ProtInc
  • smooth muscle contraction Source: InterPro
  • synaptic transmission Source: ProtInc
  • vasoconstriction Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

ReactomeiR-HSA-390666. Serotonin receptors.
R-HSA-418555. G alpha (s) signalling events.

Names & Taxonomyi

Protein namesi
Recommended name:
5-hydroxytryptamine receptor 7
Short name:
5-HT-7
Short name:
5-HT7
Alternative name(s):
5-HT-X
Serotonin receptor 7
Gene namesi
Name:HTR7
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

HGNCiHGNC:5302. HTR7.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 8383ExtracellularBy similarityAdd
BLAST
Transmembranei84 – 10421Helical; Name=1By similarityAdd
BLAST
Topological domaini105 – 11713CytoplasmicBy similarityAdd
BLAST
Transmembranei118 – 13821Helical; Name=2By similarityAdd
BLAST
Topological domaini139 – 15719ExtracellularBy similarityAdd
BLAST
Transmembranei158 – 17821Helical; Name=3By similarityAdd
BLAST
Topological domaini179 – 20123CytoplasmicBy similarityAdd
BLAST
Transmembranei202 – 22221Helical; Name=4By similarityAdd
BLAST
Topological domaini223 – 23614ExtracellularBy similarityAdd
BLAST
Transmembranei237 – 25721Helical; Name=5By similarityAdd
BLAST
Topological domaini258 – 32568CytoplasmicBy similarityAdd
BLAST
Transmembranei326 – 34621Helical; Name=6By similarityAdd
BLAST
Topological domaini347 – 36721ExtracellularBy similarityAdd
BLAST
Transmembranei368 – 38821Helical; Name=7By similarityAdd
BLAST
Topological domaini389 – 47991CytoplasmicBy similarityAdd
BLAST

GO - Cellular componenti

  • integral component of plasma membrane Source: ProtInc
  • plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA29561.

Chemistry

ChEMBLiCHEMBL2096904.
DrugBankiDB06288. Amisulpride.
DB00321. Amitriptyline.
DB00543. Amoxapine.
DB01238. Aripiprazole.
DB06216. Asenapine.
DB01200. Bromocriptine.
DB00248. Cabergoline.
DB00477. Chlorpromazine.
DB00363. Clozapine.
DB00988. Dopamine.
DB00216. Eletriptan.
DB00751. Epinastine.
DB01049. Ergoloid mesylate.
DB04946. Iloperidone.
DB00458. Imipramine.
DB00408. Loxapine.
DB08815. Lurasidone.
DB00934. Maprotiline.
DB00247. Methysergide.
DB06148. Mianserin.
DB00370. Mirtazapine.
DB00334. Olanzapine.
DB01224. Quetiapine.
DB09068. Vortioxetine.
DB00246. Ziprasidone.
GuidetoPHARMACOLOGYi12.

Polymorphism and mutation databases

BioMutaiHTR7.
DMDMi8488960.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 4794795-hydroxytryptamine receptor 7PRO_0000068979Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi5 – 51N-linked (GlcNAc...)1 Publication
Glycosylationi66 – 661N-linked (GlcNAc...)1 Publication
Disulfide bondi155 ↔ 231PROSITE-ProRule annotation
Lipidationi401 – 4011S-palmitoyl cysteineSequence analysis

Keywords - PTMi

Disulfide bond, Glycoprotein, Lipoprotein, Palmitate

Proteomic databases

PaxDbiP34969.
PeptideAtlasiP34969.
PRIDEiP34969.

PTM databases

iPTMnetiP34969.

Expressioni

Tissue specificityi

Isoform A is the predominant isoform in spleen, caudate and hippocampus. Isoform B is expressed at lower levels. Isoform D is a minor isoform in term of expression.1 Publication

Gene expression databases

BgeeiP34969.
CleanExiHS_HTR7.
GenevisibleiP34969. HS.

Organism-specific databases

HPAiCAB022708.

Interactioni

Protein-protein interaction databases

BioGridi109595. 4 interactions.
IntActiP34969. 77 interactions.
STRINGi9606.ENSP00000337949.

Chemistry

BindingDBiP34969.

Structurei

3D structure databases

ProteinModelPortaliP34969.
SMRiP34969. Positions 81-401.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3656. Eukaryota.
ENOG410XRW9. LUCA.
GeneTreeiENSGT00760000118795.
HOVERGENiHBG106962.
InParanoidiP34969.
KOiK04163.
OMAiDHHNWLA.
OrthoDBiEOG7S7SDT.
PhylomeDBiP34969.
TreeFamiTF331895.

Family and domain databases

InterProiIPR001069. 5HT_7_rcpt.
IPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
[Graphical view]
PfamiPF00001. 7tm_1. 1 hit.
[Graphical view]
PRINTSiPR00652. 5HT7RECEPTR.
PR00237. GPCRRHODOPSN.
PROSITEiPS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Isoform A and isoform B appear to be expressed at higher levels.

Isoform D (identifier: P34969-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MMDVNSSGRP DLYGHLRSFL LPEVGRGLPD LSPDGGADPV AGSWAPHLLS
60 70 80 90 100
EVTASPAPTW DAPPDNASGC GEQINYGRVE KVVIGSILTL ITLLTIAGNC
110 120 130 140 150
LVVISVCFVK KLRQPSNYLI VSLALADLSV AVAVMPFVSV TDLIGGKWIF
160 170 180 190 200
GHFFCNVFIA MDVMCCTASI MTLCVISIDR YLGITRPLTY PVRQNGKCMA
210 220 230 240 250
KMILSVWLLS ASITLPPLFG WAQNVNDDKV CLISQDFGYT IYSTAVAFYI
260 270 280 290 300
PMSVMLFMYY QIYKAARKSA AKHKFPGFPR VEPDSVIALN GIVKLQKEVE
310 320 330 340 350
ECANLSRLLK HERKNISIFK REQKAATTLG IIVGAFTVCW LPFFLLSTAR
360 370 380 390 400
PFICGTSCSC IPLWVERTFL WLGYANSLIN PFIYAFFNRD LRTTYRSLLQ
410 420 430 440 450
CQYRNINRKL SAAGMHEALK LAERPERPEF VLRACTRRVL LRPEKRPPVS
460 470
VWVLQSPDHH NWLADKMLTT VEKKVMIHD
Length:479
Mass (Da):53,555
Last modified:May 30, 2000 - v2
Checksum:i1F62E985EADE1F23
GO
Isoform A (identifier: P34969-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     433-479: RACTRRVLLRPEKRPPVSVWVLQSPDHHNWLADKMLTTVEKKVMIHD → QNADYCRKKGHDS

Show »
Length:445
Mass (Da):49,488
Checksum:iA09BE5E3CBCAB232
GO
Isoform B (identifier: P34969-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     433-479: Missing.

Show »
Length:432
Mass (Da):47,984
Checksum:iD6202D8C921D627E
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti92 – 921T → K.1 Publication
VAR_012995
Natural varianti279 – 2791P → L.1 Publication
Corresponds to variant rs114969659 [ dbSNP | Ensembl ].
VAR_012996
Natural varianti448 – 4481P → Q.
Corresponds to variant rs33954285 [ dbSNP | Ensembl ].
VAR_049365

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei433 – 47947RACTR…VMIHD → QNADYCRKKGHDS in isoform A. 2 PublicationsVSP_001857Add
BLAST
Alternative sequencei433 – 47947Missing in isoform B. 2 PublicationsVSP_001856Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U68487 mRNA. Translation: AAB48393.1.
U68488 mRNA. Translation: AAB48394.1.
U68492 Genomic DNA. Translation: AAF07218.1.
U68493, U68492 Genomic DNA. Translation: AAF07217.1.
U68493, U68492 Genomic DNA. Translation: AAB48397.2.
L21195 mRNA. Translation: AAC37538.1.
AY493988 mRNA. Translation: AAR87480.1.
AK292606 mRNA. Translation: BAF85295.1.
AB451482 mRNA. Translation: BAG70296.1.
AL360011 Genomic DNA. Translation: CAH69966.1.
AL360011 Genomic DNA. Translation: CAH69967.1.
AL360011 Genomic DNA. Translation: CAH69968.1.
CH471066 Genomic DNA. Translation: EAW50118.1.
CH471066 Genomic DNA. Translation: EAW50119.1.
CH471066 Genomic DNA. Translation: EAW50120.1.
BC047526 mRNA. Translation: AAH47526.1.
CCDSiCCDS7408.1. [P34969-1]
CCDS7409.1. [P34969-2]
CCDS7410.1. [P34969-3]
PIRiA48881.
RefSeqiNP_000863.1. NM_000872.4. [P34969-2]
NP_062873.1. NM_019859.3. [P34969-1]
NP_062874.1. NM_019860.3. [P34969-3]
UniGeneiHs.73739.

Genome annotation databases

EnsembliENST00000277874; ENSP00000277874; ENSG00000148680. [P34969-2]
ENST00000336152; ENSP00000337949; ENSG00000148680. [P34969-1]
ENST00000371719; ENSP00000360784; ENSG00000148680. [P34969-3]
GeneIDi3363.
KEGGihsa:3363.
UCSCiuc001kgz.4. human. [P34969-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U68487 mRNA. Translation: AAB48393.1.
U68488 mRNA. Translation: AAB48394.1.
U68492 Genomic DNA. Translation: AAF07218.1.
U68493, U68492 Genomic DNA. Translation: AAF07217.1.
U68493, U68492 Genomic DNA. Translation: AAB48397.2.
L21195 mRNA. Translation: AAC37538.1.
AY493988 mRNA. Translation: AAR87480.1.
AK292606 mRNA. Translation: BAF85295.1.
AB451482 mRNA. Translation: BAG70296.1.
AL360011 Genomic DNA. Translation: CAH69966.1.
AL360011 Genomic DNA. Translation: CAH69967.1.
AL360011 Genomic DNA. Translation: CAH69968.1.
CH471066 Genomic DNA. Translation: EAW50118.1.
CH471066 Genomic DNA. Translation: EAW50119.1.
CH471066 Genomic DNA. Translation: EAW50120.1.
BC047526 mRNA. Translation: AAH47526.1.
CCDSiCCDS7408.1. [P34969-1]
CCDS7409.1. [P34969-2]
CCDS7410.1. [P34969-3]
PIRiA48881.
RefSeqiNP_000863.1. NM_000872.4. [P34969-2]
NP_062873.1. NM_019859.3. [P34969-1]
NP_062874.1. NM_019860.3. [P34969-3]
UniGeneiHs.73739.

3D structure databases

ProteinModelPortaliP34969.
SMRiP34969. Positions 81-401.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi109595. 4 interactions.
IntActiP34969. 77 interactions.
STRINGi9606.ENSP00000337949.

Chemistry

BindingDBiP34969.
ChEMBLiCHEMBL2096904.
DrugBankiDB06288. Amisulpride.
DB00321. Amitriptyline.
DB00543. Amoxapine.
DB01238. Aripiprazole.
DB06216. Asenapine.
DB01200. Bromocriptine.
DB00248. Cabergoline.
DB00477. Chlorpromazine.
DB00363. Clozapine.
DB00988. Dopamine.
DB00216. Eletriptan.
DB00751. Epinastine.
DB01049. Ergoloid mesylate.
DB04946. Iloperidone.
DB00458. Imipramine.
DB00408. Loxapine.
DB08815. Lurasidone.
DB00934. Maprotiline.
DB00247. Methysergide.
DB06148. Mianserin.
DB00370. Mirtazapine.
DB00334. Olanzapine.
DB01224. Quetiapine.
DB09068. Vortioxetine.
DB00246. Ziprasidone.
GuidetoPHARMACOLOGYi12.

Protein family/group databases

GPCRDBiSearch...

PTM databases

iPTMnetiP34969.

Polymorphism and mutation databases

BioMutaiHTR7.
DMDMi8488960.

Proteomic databases

PaxDbiP34969.
PeptideAtlasiP34969.
PRIDEiP34969.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000277874; ENSP00000277874; ENSG00000148680. [P34969-2]
ENST00000336152; ENSP00000337949; ENSG00000148680. [P34969-1]
ENST00000371719; ENSP00000360784; ENSG00000148680. [P34969-3]
GeneIDi3363.
KEGGihsa:3363.
UCSCiuc001kgz.4. human. [P34969-1]

Organism-specific databases

CTDi3363.
GeneCardsiHTR7.
HGNCiHGNC:5302. HTR7.
HPAiCAB022708.
MIMi182137. gene.
neXtProtiNX_P34969.
PharmGKBiPA29561.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3656. Eukaryota.
ENOG410XRW9. LUCA.
GeneTreeiENSGT00760000118795.
HOVERGENiHBG106962.
InParanoidiP34969.
KOiK04163.
OMAiDHHNWLA.
OrthoDBiEOG7S7SDT.
PhylomeDBiP34969.
TreeFamiTF331895.

Enzyme and pathway databases

ReactomeiR-HSA-390666. Serotonin receptors.
R-HSA-418555. G alpha (s) signalling events.

Miscellaneous databases

GeneWikii5-HT7_receptor.
GenomeRNAii3363.
PROiP34969.
SOURCEiSearch...

Gene expression databases

BgeeiP34969.
CleanExiHS_HTR7.
GenevisibleiP34969. HS.

Family and domain databases

InterProiIPR001069. 5HT_7_rcpt.
IPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
[Graphical view]
PfamiPF00001. 7tm_1. 1 hit.
[Graphical view]
PRINTSiPR00652. 5HT7RECEPTR.
PR00237. GPCRRHODOPSN.
PROSITEiPS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Four 5-hydroxytryptamine7 (5-HT7) receptor isoforms in human and rat produced by alternative splicing: species differences due to altered intron-exon organization."
    Heidmann D.E.A., Metcalf M.A., Kohen R., Hamblin M.W.
    J. Neurochem. 68:1372-1381(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA], ALTERNATIVE SPLICING, TISSUE SPECIFICITY.
  2. "Cloning of a novel human serotonin receptor (5-HT7) positively linked to adenylate cyclase."
    Bard J.A., Zgombick J.M., Adham N., Vaysse P., Branchek T.A., Weinshank R.L.
    J. Biol. Chem. 268:23422-23426(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A).
    Tissue: Fetal brain and Placenta.
  3. "Isolation of cDNA coding for 5-hydroxytryptamine receptor 7, transcript variant b (HTR7B)."
    King M.M., Aronstam R.S., Sharma S.V.
    Submitted (DEC-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM B).
    Tissue: Brain.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
    Tissue: Testis.
  5. "Human protein factory for converting the transcriptome into an in vitro-expressed proteome."
    Goshima N., Kawamura Y., Fukumoto A., Miura A., Honma R., Satoh R., Wakamatsu A., Yamamoto J., Kimura K., Nishikawa T., Andoh T., Iida Y., Ishikawa K., Ito E., Kagawa N., Kaminaga C., Kanehori K., Kawakami B.
    , Kenmochi K., Kimura R., Kobayashi M., Kuroita T., Kuwayama H., Maruyama Y., Matsuo K., Minami K., Mitsubori M., Mori M., Morishita R., Murase A., Nishikawa A., Nishikawa S., Okamoto T., Sakagami N., Sakamoto Y., Sasaki Y., Seki T., Sono S., Sugiyama A., Sumiya T., Takayama T., Takayama Y., Takeda H., Togashi T., Yahata K., Yamada H., Yanagisawa Y., Endo Y., Imamoto F., Kisu Y., Tanaka S., Isogai T., Imai J., Watanabe S., Nomura N.
    Nat. Methods 5:1011-1017(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM B).
  6. "The DNA sequence and comparative analysis of human chromosome 10."
    Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
    , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
    Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A).
    Tissue: Testis.
  9. "Biochemical and pharmacological study of N-linked glycosylation of the human serotonin 5-HT(7)a receptor."
    Gellynck E., Andressen K.W., Lintermans B., Haegeman G., Levy F.O., Vanhoenacker P., Van Craenenbroeck K.
    FEBS J. 279:1994-2003(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION AT ASN-5 AND ASN-66.
  10. "The human serotonin 7 (5-HT7) receptor gene: genomic organization and systematic mutation screening in schizophrenia and bipolar affective disorder."
    Erdmann J., Nothen M.M., Shimron-Abarbanell D., Rietschel M., Albus M., Borrmann M., Maier W., Franzek E., Korner J., Weigelt B., Fimmers R., Propping P.
    Mol. Psychiatry 1:392-397(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS LYS-92 AND LEU-279.

Entry informationi

Entry namei5HT7R_HUMAN
AccessioniPrimary (citable) accession number: P34969
Secondary accession number(s): B5BUP6
, P78336, P78372, P78516, Q5VX01, Q5VX02, Q5VX03
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: May 30, 2000
Last modified: July 6, 2016
This is version 156 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.