Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

5-hydroxytryptamine receptor 7

Gene

HTR7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that stimulate adenylate cyclase.

GO - Molecular functioni

  • G-protein coupled serotonin receptor activity Source: ProtInc
  • neurotransmitter receptor activity Source: GO_Central

GO - Biological processi

  • adenylate cyclase-activating serotonin receptor signaling pathway Source: GO_Central
  • blood circulation Source: ProtInc
  • chemical synaptic transmission Source: ProtInc
  • circadian rhythm Source: ProtInc
  • G-protein coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger Source: ProtInc
  • smooth muscle contraction Source: InterPro
  • vasoconstriction Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

BioCyciZFISH:ENSG00000148680-MONOMER.
ReactomeiR-HSA-390666. Serotonin receptors.
R-HSA-418555. G alpha (s) signalling events.

Names & Taxonomyi

Protein namesi
Recommended name:
5-hydroxytryptamine receptor 7
Short name:
5-HT-7
Short name:
5-HT7
Alternative name(s):
5-HT-X
Serotonin receptor 7
Gene namesi
Name:HTR7
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

HGNCiHGNC:5302. HTR7.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 83ExtracellularBy similarityAdd BLAST83
Transmembranei84 – 104Helical; Name=1By similarityAdd BLAST21
Topological domaini105 – 117CytoplasmicBy similarityAdd BLAST13
Transmembranei118 – 138Helical; Name=2By similarityAdd BLAST21
Topological domaini139 – 157ExtracellularBy similarityAdd BLAST19
Transmembranei158 – 178Helical; Name=3By similarityAdd BLAST21
Topological domaini179 – 201CytoplasmicBy similarityAdd BLAST23
Transmembranei202 – 222Helical; Name=4By similarityAdd BLAST21
Topological domaini223 – 236ExtracellularBy similarityAdd BLAST14
Transmembranei237 – 257Helical; Name=5By similarityAdd BLAST21
Topological domaini258 – 325CytoplasmicBy similarityAdd BLAST68
Transmembranei326 – 346Helical; Name=6By similarityAdd BLAST21
Topological domaini347 – 367ExtracellularBy similarityAdd BLAST21
Transmembranei368 – 388Helical; Name=7By similarityAdd BLAST21
Topological domaini389 – 479CytoplasmicBy similarityAdd BLAST91

GO - Cellular componenti

  • dendrite Source: GO_Central
  • integral component of plasma membrane Source: ProtInc
  • plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi3363.
OpenTargetsiENSG00000148680.
PharmGKBiPA29561.

Chemistry databases

ChEMBLiCHEMBL3155.
DrugBankiDB06288. Amisulpride.
DB00321. Amitriptyline.
DB00543. Amoxapine.
DB01238. Aripiprazole.
DB06216. Asenapine.
DB01200. Bromocriptine.
DB00248. Cabergoline.
DB00477. Chlorpromazine.
DB00363. Clozapine.
DB00988. Dopamine.
DB00216. Eletriptan.
DB00751. Epinastine.
DB01049. Ergoloid mesylate.
DB04946. Iloperidone.
DB00458. Imipramine.
DB00408. Loxapine.
DB08815. Lurasidone.
DB00934. Maprotiline.
DB00247. Methysergide.
DB06148. Mianserin.
DB00370. Mirtazapine.
DB00334. Olanzapine.
DB01224. Quetiapine.
DB09068. Vortioxetine.
DB00246. Ziprasidone.
GuidetoPHARMACOLOGYi12.

Polymorphism and mutation databases

BioMutaiHTR7.
DMDMi8488960.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000689791 – 4795-hydroxytryptamine receptor 7Add BLAST479

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi5N-linked (GlcNAc...)1 Publication1
Glycosylationi66N-linked (GlcNAc...)1 Publication1
Disulfide bondi155 ↔ 231PROSITE-ProRule annotation
Lipidationi401S-palmitoyl cysteineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein, Lipoprotein, Palmitate

Proteomic databases

PaxDbiP34969.
PeptideAtlasiP34969.
PRIDEiP34969.

PTM databases

iPTMnetiP34969.
PhosphoSitePlusiP34969.

Expressioni

Tissue specificityi

Isoform A is the predominant isoform in spleen, caudate and hippocampus. Isoform B is expressed at lower levels. Isoform D is a minor isoform in term of expression.1 Publication

Gene expression databases

BgeeiENSG00000148680.
CleanExiHS_HTR7.
GenevisibleiP34969. HS.

Organism-specific databases

HPAiCAB022708.

Interactioni

Protein-protein interaction databases

BioGridi109595. 4 interactors.
IntActiP34969. 77 interactors.
STRINGi9606.ENSP00000337949.

Chemistry databases

BindingDBiP34969.

Structurei

3D structure databases

ProteinModelPortaliP34969.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3656. Eukaryota.
ENOG410XRW9. LUCA.
GeneTreeiENSGT00760000118795.
HOVERGENiHBG106962.
InParanoidiP34969.
KOiK04163.
OMAiTWDAPPD.
OrthoDBiEOG091G06VI.
PhylomeDBiP34969.
TreeFamiTF331895.

Family and domain databases

InterProiIPR001069. 5HT_7_rcpt.
IPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
[Graphical view]
PfamiPF00001. 7tm_1. 1 hit.
[Graphical view]
PRINTSiPR00652. 5HT7RECEPTR.
PR00237. GPCRRHODOPSN.
PROSITEiPS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Isoform A and isoform B appear to be expressed at higher levels.
Isoform D (identifier: P34969-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MMDVNSSGRP DLYGHLRSFL LPEVGRGLPD LSPDGGADPV AGSWAPHLLS
60 70 80 90 100
EVTASPAPTW DAPPDNASGC GEQINYGRVE KVVIGSILTL ITLLTIAGNC
110 120 130 140 150
LVVISVCFVK KLRQPSNYLI VSLALADLSV AVAVMPFVSV TDLIGGKWIF
160 170 180 190 200
GHFFCNVFIA MDVMCCTASI MTLCVISIDR YLGITRPLTY PVRQNGKCMA
210 220 230 240 250
KMILSVWLLS ASITLPPLFG WAQNVNDDKV CLISQDFGYT IYSTAVAFYI
260 270 280 290 300
PMSVMLFMYY QIYKAARKSA AKHKFPGFPR VEPDSVIALN GIVKLQKEVE
310 320 330 340 350
ECANLSRLLK HERKNISIFK REQKAATTLG IIVGAFTVCW LPFFLLSTAR
360 370 380 390 400
PFICGTSCSC IPLWVERTFL WLGYANSLIN PFIYAFFNRD LRTTYRSLLQ
410 420 430 440 450
CQYRNINRKL SAAGMHEALK LAERPERPEF VLRACTRRVL LRPEKRPPVS
460 470
VWVLQSPDHH NWLADKMLTT VEKKVMIHD
Length:479
Mass (Da):53,555
Last modified:May 30, 2000 - v2
Checksum:i1F62E985EADE1F23
GO
Isoform A (identifier: P34969-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     433-479: RACTRRVLLRPEKRPPVSVWVLQSPDHHNWLADKMLTTVEKKVMIHD → QNADYCRKKGHDS

Show »
Length:445
Mass (Da):49,488
Checksum:iA09BE5E3CBCAB232
GO
Isoform B (identifier: P34969-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     433-479: Missing.

Show »
Length:432
Mass (Da):47,984
Checksum:iD6202D8C921D627E
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01299592T → K.1 Publication1
Natural variantiVAR_012996279P → L.1 PublicationCorresponds to variant rs114969659dbSNPEnsembl.1
Natural variantiVAR_049365448P → Q.Corresponds to variant rs33954285dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_001857433 – 479RACTR…VMIHD → QNADYCRKKGHDS in isoform A. 2 PublicationsAdd BLAST47
Alternative sequenceiVSP_001856433 – 479Missing in isoform B. 2 PublicationsAdd BLAST47

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U68487 mRNA. Translation: AAB48393.1.
U68488 mRNA. Translation: AAB48394.1.
U68492 Genomic DNA. Translation: AAF07218.1.
U68493, U68492 Genomic DNA. Translation: AAF07217.1.
U68493, U68492 Genomic DNA. Translation: AAB48397.2.
L21195 mRNA. Translation: AAC37538.1.
AY493988 mRNA. Translation: AAR87480.1.
AK292606 mRNA. Translation: BAF85295.1.
AB451482 mRNA. Translation: BAG70296.1.
AL360011 Genomic DNA. Translation: CAH69966.1.
AL360011 Genomic DNA. Translation: CAH69967.1.
AL360011 Genomic DNA. Translation: CAH69968.1.
CH471066 Genomic DNA. Translation: EAW50118.1.
CH471066 Genomic DNA. Translation: EAW50119.1.
CH471066 Genomic DNA. Translation: EAW50120.1.
BC047526 mRNA. Translation: AAH47526.1.
CCDSiCCDS7408.1. [P34969-1]
CCDS7409.1. [P34969-2]
CCDS7410.1. [P34969-3]
PIRiA48881.
RefSeqiNP_000863.1. NM_000872.4. [P34969-2]
NP_062873.1. NM_019859.3. [P34969-1]
NP_062874.1. NM_019860.3. [P34969-3]
UniGeneiHs.73739.

Genome annotation databases

EnsembliENST00000277874; ENSP00000277874; ENSG00000148680. [P34969-2]
ENST00000336152; ENSP00000337949; ENSG00000148680. [P34969-1]
ENST00000371719; ENSP00000360784; ENSG00000148680. [P34969-3]
GeneIDi3363.
KEGGihsa:3363.
UCSCiuc001kgz.4. human. [P34969-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U68487 mRNA. Translation: AAB48393.1.
U68488 mRNA. Translation: AAB48394.1.
U68492 Genomic DNA. Translation: AAF07218.1.
U68493, U68492 Genomic DNA. Translation: AAF07217.1.
U68493, U68492 Genomic DNA. Translation: AAB48397.2.
L21195 mRNA. Translation: AAC37538.1.
AY493988 mRNA. Translation: AAR87480.1.
AK292606 mRNA. Translation: BAF85295.1.
AB451482 mRNA. Translation: BAG70296.1.
AL360011 Genomic DNA. Translation: CAH69966.1.
AL360011 Genomic DNA. Translation: CAH69967.1.
AL360011 Genomic DNA. Translation: CAH69968.1.
CH471066 Genomic DNA. Translation: EAW50118.1.
CH471066 Genomic DNA. Translation: EAW50119.1.
CH471066 Genomic DNA. Translation: EAW50120.1.
BC047526 mRNA. Translation: AAH47526.1.
CCDSiCCDS7408.1. [P34969-1]
CCDS7409.1. [P34969-2]
CCDS7410.1. [P34969-3]
PIRiA48881.
RefSeqiNP_000863.1. NM_000872.4. [P34969-2]
NP_062873.1. NM_019859.3. [P34969-1]
NP_062874.1. NM_019860.3. [P34969-3]
UniGeneiHs.73739.

3D structure databases

ProteinModelPortaliP34969.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi109595. 4 interactors.
IntActiP34969. 77 interactors.
STRINGi9606.ENSP00000337949.

Chemistry databases

BindingDBiP34969.
ChEMBLiCHEMBL3155.
DrugBankiDB06288. Amisulpride.
DB00321. Amitriptyline.
DB00543. Amoxapine.
DB01238. Aripiprazole.
DB06216. Asenapine.
DB01200. Bromocriptine.
DB00248. Cabergoline.
DB00477. Chlorpromazine.
DB00363. Clozapine.
DB00988. Dopamine.
DB00216. Eletriptan.
DB00751. Epinastine.
DB01049. Ergoloid mesylate.
DB04946. Iloperidone.
DB00458. Imipramine.
DB00408. Loxapine.
DB08815. Lurasidone.
DB00934. Maprotiline.
DB00247. Methysergide.
DB06148. Mianserin.
DB00370. Mirtazapine.
DB00334. Olanzapine.
DB01224. Quetiapine.
DB09068. Vortioxetine.
DB00246. Ziprasidone.
GuidetoPHARMACOLOGYi12.

Protein family/group databases

GPCRDBiSearch...

PTM databases

iPTMnetiP34969.
PhosphoSitePlusiP34969.

Polymorphism and mutation databases

BioMutaiHTR7.
DMDMi8488960.

Proteomic databases

PaxDbiP34969.
PeptideAtlasiP34969.
PRIDEiP34969.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000277874; ENSP00000277874; ENSG00000148680. [P34969-2]
ENST00000336152; ENSP00000337949; ENSG00000148680. [P34969-1]
ENST00000371719; ENSP00000360784; ENSG00000148680. [P34969-3]
GeneIDi3363.
KEGGihsa:3363.
UCSCiuc001kgz.4. human. [P34969-1]

Organism-specific databases

CTDi3363.
DisGeNETi3363.
GeneCardsiHTR7.
HGNCiHGNC:5302. HTR7.
HPAiCAB022708.
MIMi182137. gene.
neXtProtiNX_P34969.
OpenTargetsiENSG00000148680.
PharmGKBiPA29561.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3656. Eukaryota.
ENOG410XRW9. LUCA.
GeneTreeiENSGT00760000118795.
HOVERGENiHBG106962.
InParanoidiP34969.
KOiK04163.
OMAiTWDAPPD.
OrthoDBiEOG091G06VI.
PhylomeDBiP34969.
TreeFamiTF331895.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000148680-MONOMER.
ReactomeiR-HSA-390666. Serotonin receptors.
R-HSA-418555. G alpha (s) signalling events.

Miscellaneous databases

GeneWikii5-HT7_receptor.
GenomeRNAii3363.
PROiP34969.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000148680.
CleanExiHS_HTR7.
GenevisibleiP34969. HS.

Family and domain databases

InterProiIPR001069. 5HT_7_rcpt.
IPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
[Graphical view]
PfamiPF00001. 7tm_1. 1 hit.
[Graphical view]
PRINTSiPR00652. 5HT7RECEPTR.
PR00237. GPCRRHODOPSN.
PROSITEiPS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry namei5HT7R_HUMAN
AccessioniPrimary (citable) accession number: P34969
Secondary accession number(s): B5BUP6
, P78336, P78372, P78516, Q5VX01, Q5VX02, Q5VX03
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: May 30, 2000
Last modified: November 2, 2016
This is version 159 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.