SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P34949

- MPI_HUMAN

UniProt

P34949 - MPI_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Mannose-6-phosphate isomerase

Gene
MPI, PMI1
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Involved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions.

Catalytic activityi

D-mannose 6-phosphate = D-fructose 6-phosphate.

Cofactori

Binds 1 zinc ion per subunit By similarity.

Pathwayi

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi110 – 1101Zinc By similarity
Metal bindingi112 – 1121Zinc By similarity
Metal bindingi137 – 1371Zinc By similarity
Metal bindingi276 – 2761Zinc By similarity
Active sitei295 – 2951 By similarity

GO - Molecular functioni

  1. mannose-6-phosphate isomerase activity Source: ProtInc
  2. zinc ion binding Source: InterPro

GO - Biological processi

  1. cellular protein metabolic process Source: Reactome
  2. dolichol-linked oligosaccharide biosynthetic process Source: Reactome
  3. GDP-mannose biosynthetic process Source: Reactome
  4. post-translational protein modification Source: Reactome
  5. protein N-linked glycosylation via asparagine Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Isomerase

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiREACT_22423. Synthesis of GDP-mannose.
UniPathwayiUPA00126; UER00423.

Names & Taxonomyi

Protein namesi
Recommended name:
Mannose-6-phosphate isomerase (EC:5.3.1.8)
Alternative name(s):
Phosphohexomutase
Phosphomannose isomerase
Short name:
PMI
Gene namesi
Name:MPI
Synonyms:PMI1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 15

Organism-specific databases

HGNCiHGNC:7216. MPI.

Subcellular locationi

Cytoplasm Inferred

GO - Cellular componenti

  1. cytosol Source: Reactome
  2. extracellular vesicular exosome Source: UniProt
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Involvement in diseasei

Congenital disorder of glycosylation 1B (CDG1B) [MIM:602579]: A multisystem disorder caused by a defect in glycoprotein biosynthesis and characterized by under-glycosylated serum glycoproteins. Congenital disorders of glycosylation result in a wide variety of clinical features, such as defects in the nervous system development, psychomotor retardation, dysmorphic features, hypotonia, coagulation disorders, and immunodeficiency. The broad spectrum of features reflects the critical role of N-glycoproteins during embryonic development, differentiation, and maintenance of cell functions. Congenital disorder of glycosylation type 1B is clinically characterized by protein-losing enteropathy.
Note: The disease is caused by mutations affecting the gene represented in this entry.7 Publications
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti51 – 511M → T in CDG1B. 1 Publication
VAR_022516
Natural varianti102 – 1021S → L in CDG1B. 1 Publication
VAR_012338
Natural varianti129 – 1291Y → C in CDG1B. 1 Publication
VAR_022517
Natural varianti131 – 1311D → N in CDG1B. 1 Publication
VAR_022518
Natural varianti138 – 1381M → T in CDG1B. 1 Publication
VAR_012339
Natural varianti140 – 1401I → T in CDG1B. 1 Publication
VAR_012345
Natural varianti152 – 1521R → Q in CDG1B. 1 Publication
VAR_022519
Natural varianti219 – 2191R → Q in CDG1B. 2 Publications
VAR_012340
Natural varianti250 – 2501G → S in CDG1B. 1 Publication
VAR_022520
Natural varianti255 – 2551Y → C in CDG1B. 1 Publication
VAR_022521
Natural varianti295 – 2951R → H in CDG1B. 1 Publication
Corresponds to variant rs28928906 [ dbSNP | Ensembl ].
VAR_022522
Natural varianti398 – 3981I → T in CDG1B. 1 Publication
VAR_022523
Natural varianti418 – 4181R → H in CDG1B. 1 Publication
VAR_022524

Keywords - Diseasei

Congenital disorder of glycosylation, Disease mutation

Organism-specific databases

MIMi602579. phenotype.
Orphaneti79319. MPI-CDG.
PharmGKBiPA30922.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11Removed1 Publication
Chaini2 – 423422Mannose-6-phosphate isomerasePRO_0000194235Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylalanine1 Publication

Keywords - PTMi

Acetylation

Proteomic databases

MaxQBiP34949.
PaxDbiP34949.
PRIDEiP34949.

2D gel databases

OGPiP34949.

PTM databases

PhosphoSiteiP34949.

Expressioni

Tissue specificityi

Expressed in all tissues, but more abundant in heart, brain and skeletal muscle.

Gene expression databases

ArrayExpressiP34949.
BgeeiP34949.
CleanExiHS_MPI.
GenevestigatoriP34949.

Organism-specific databases

HPAiHPA007200.

Interactioni

Protein-protein interaction databases

BioGridi110491. 3 interactions.
STRINGi9606.ENSP00000318318.

Structurei

3D structure databases

ProteinModelPortaliP34949.
SMRiP34949. Positions 2-419.

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiCOG1482.
HOGENOMiHOG000241277.
HOVERGENiHBG000367.
InParanoidiP34949.
KOiK01809.
OMAiPYAEFWV.
PhylomeDBiP34949.
TreeFamiTF312831.

Family and domain databases

Gene3Di2.60.120.10. 3 hits.
InterProiIPR001250. Man6P_Isoase-1.
IPR016305. Mannose-6-P_Isomerase.
IPR018050. Pmannose_isomerase-type1_CS.
IPR014710. RmlC-like_jellyroll.
IPR011051. RmlC_Cupin.
[Graphical view]
PANTHERiPTHR10309. PTHR10309. 1 hit.
PfamiPF01238. PMI_typeI. 1 hit.
[Graphical view]
PIRSFiPIRSF001480. Mannose-6-phosphate_isomerase. 1 hit.
PRINTSiPR00714. MAN6PISMRASE.
SUPFAMiSSF51182. SSF51182. 1 hit.
TIGRFAMsiTIGR00218. manA. 1 hit.
PROSITEiPS00965. PMI_I_1. 1 hit.
PS00966. PMI_I_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P34949-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAAPRVFPLS CAVQQYAWGK MGSNSEVARL LASSDPLAQI AEDKPYAELW    50
MGTHPRGDAK ILDNRISQKT LSQWIAENQD SLGSKVKDTF NGNLPFLFKV 100
LSVETPLSIQ AHPNKELAEK LHLQAPQHYP DANHKPEMAI ALTPFQGLCG 150
FRPVEEIVTF LKKVPEFQFL IGDEAATHLK QTMSHDSQAV ASSLQSCFSH 200
LMKSEKKVVV EQLNLLVKRI SQQAAAGNNM EDIFGELLLQ LHQQYPGDIG 250
CFAIYFLNLL TLKPGEAMFL EANVPHAYLK GDCVECMACS DNTVRAGLTP 300
KFIDVPTLCE MLSYTPSSSK DRLFLPTRSQ EDPYLSIYDP PVPDFTIMKT 350
EVPGSVTEYK VLALDSASIL LMVQGTVIAS TPTTQTPIPL QRGGVLFIGA 400
NESVSLKLTE PKDLLIFRAC CLL 423
Length:423
Mass (Da):46,656
Last modified:January 23, 2007 - v2
Checksum:i1612DD966B86D3AC
GO
Isoform 2 (identifier: P34949-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     163-224: KVPEFQFLIGDEAATHLKQTMSHDSQAVASSLQSCFSHLMKSEKKVVVEQLNLLVKRISQQA → T

Note: No experimental confirmation available.

Show »
Length:362
Mass (Da):39,834
Checksum:i58CA9B39BF20C459
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti51 – 511M → T in CDG1B. 1 Publication
VAR_022516
Natural varianti102 – 1021S → L in CDG1B. 1 Publication
VAR_012338
Natural varianti129 – 1291Y → C in CDG1B. 1 Publication
VAR_022517
Natural varianti131 – 1311D → N in CDG1B. 1 Publication
VAR_022518
Natural varianti138 – 1381M → T in CDG1B. 1 Publication
VAR_012339
Natural varianti140 – 1401I → T in CDG1B. 1 Publication
VAR_012345
Natural varianti152 – 1521R → Q in CDG1B. 1 Publication
VAR_022519
Natural varianti219 – 2191R → Q in CDG1B. 2 Publications
VAR_012340
Natural varianti250 – 2501G → S in CDG1B. 1 Publication
VAR_022520
Natural varianti255 – 2551Y → C in CDG1B. 1 Publication
VAR_022521
Natural varianti295 – 2951R → H in CDG1B. 1 Publication
Corresponds to variant rs28928906 [ dbSNP | Ensembl ].
VAR_022522
Natural varianti398 – 3981I → T in CDG1B. 1 Publication
VAR_022523
Natural varianti418 – 4181R → H in CDG1B. 1 Publication
VAR_022524

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei163 – 22462KVPEF…ISQQA → T in isoform 2. VSP_013357Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X76057 mRNA. Translation: CAA53657.1.
AF227218, AF227216, AF227217 Genomic DNA. Translation: AAF37697.1.
AK292374 mRNA. Translation: BAF85063.1.
CH471136 Genomic DNA. Translation: EAW99296.1.
BC017351 mRNA. Translation: AAH17351.1.
BC046357 mRNA. Translation: AAH46357.1.
CCDSiCCDS10272.1. [P34949-1]
PIRiS41122.
RefSeqiNP_001276085.1. NM_001289156.1.
NP_001276086.1. NM_001289157.1. [P34949-2]
NP_002426.1. NM_002435.2. [P34949-1]
UniGeneiHs.75694.

Genome annotation databases

EnsembliENST00000323744; ENSP00000318192; ENSG00000178802. [P34949-2]
ENST00000352410; ENSP00000318318; ENSG00000178802. [P34949-1]
GeneIDi4351.
KEGGihsa:4351.
UCSCiuc002azc.1. human. [P34949-1]
uc002aze.1. human. [P34949-2]

Polymorphism databases

DMDMi462567.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X76057 mRNA. Translation: CAA53657.1 .
AF227218 , AF227216 , AF227217 Genomic DNA. Translation: AAF37697.1 .
AK292374 mRNA. Translation: BAF85063.1 .
CH471136 Genomic DNA. Translation: EAW99296.1 .
BC017351 mRNA. Translation: AAH17351.1 .
BC046357 mRNA. Translation: AAH46357.1 .
CCDSi CCDS10272.1. [P34949-1 ]
PIRi S41122.
RefSeqi NP_001276085.1. NM_001289156.1.
NP_001276086.1. NM_001289157.1. [P34949-2 ]
NP_002426.1. NM_002435.2. [P34949-1 ]
UniGenei Hs.75694.

3D structure databases

ProteinModelPortali P34949.
SMRi P34949. Positions 2-419.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 110491. 3 interactions.
STRINGi 9606.ENSP00000318318.

Chemistry

BindingDBi P34949.
ChEMBLi CHEMBL2758.

PTM databases

PhosphoSitei P34949.

Polymorphism databases

DMDMi 462567.

2D gel databases

OGPi P34949.

Proteomic databases

MaxQBi P34949.
PaxDbi P34949.
PRIDEi P34949.

Protocols and materials databases

DNASUi 4351.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000323744 ; ENSP00000318192 ; ENSG00000178802 . [P34949-2 ]
ENST00000352410 ; ENSP00000318318 ; ENSG00000178802 . [P34949-1 ]
GeneIDi 4351.
KEGGi hsa:4351.
UCSCi uc002azc.1. human. [P34949-1 ]
uc002aze.1. human. [P34949-2 ]

Organism-specific databases

CTDi 4351.
GeneCardsi GC15P075182.
GeneReviewsi MPI.
HGNCi HGNC:7216. MPI.
HPAi HPA007200.
MIMi 154550. gene.
602579. phenotype.
neXtProti NX_P34949.
Orphaneti 79319. MPI-CDG.
PharmGKBi PA30922.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG1482.
HOGENOMi HOG000241277.
HOVERGENi HBG000367.
InParanoidi P34949.
KOi K01809.
OMAi PYAEFWV.
PhylomeDBi P34949.
TreeFami TF312831.

Enzyme and pathway databases

UniPathwayi UPA00126 ; UER00423 .
Reactomei REACT_22423. Synthesis of GDP-mannose.

Miscellaneous databases

GenomeRNAii 4351.
NextBioi 17118.
PROi P34949.
SOURCEi Search...

Gene expression databases

ArrayExpressi P34949.
Bgeei P34949.
CleanExi HS_MPI.
Genevestigatori P34949.

Family and domain databases

Gene3Di 2.60.120.10. 3 hits.
InterProi IPR001250. Man6P_Isoase-1.
IPR016305. Mannose-6-P_Isomerase.
IPR018050. Pmannose_isomerase-type1_CS.
IPR014710. RmlC-like_jellyroll.
IPR011051. RmlC_Cupin.
[Graphical view ]
PANTHERi PTHR10309. PTHR10309. 1 hit.
Pfami PF01238. PMI_typeI. 1 hit.
[Graphical view ]
PIRSFi PIRSF001480. Mannose-6-phosphate_isomerase. 1 hit.
PRINTSi PR00714. MAN6PISMRASE.
SUPFAMi SSF51182. SSF51182. 1 hit.
TIGRFAMsi TIGR00218. manA. 1 hit.
PROSITEi PS00965. PMI_I_1. 1 hit.
PS00966. PMI_I_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Purification, cDNA cloning and heterologous expression of human phosphomannose isomerase."
    Proudfoot A.E.I., Turcatti G., Wells T.N.C., Payton M.A., Smith D.J.
    Eur. J. Biochem. 219:415-423(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PARTIAL PROTEIN SEQUENCE.
    Tissue: Placenta and Testis.
  2. "Genomic organization of the human phosphomannose isomerase (MPI) gene and mutation analysis in patients with congenital disorders of glycosylation type Ib (CDG-Ib)."
    Schollen E., Dorland L., de Koning T.J., Van Diggelen O.P., Huijmans J.G.M., Marquardt T., Babovic-Vuksanovic D., Patterson M., Imtiaz F., Winchester B., Adamowicz M., Pronicka E., Freeze H., Matthijs G.
    Hum. Mutat. 16:247-252(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS CDG1B THR-51; ASN-131; GLN-152; SER-250 AND HIS-418.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Testis.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Blood and Brain.
  6. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].
  7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  8. "Phosphomannose isomerase deficiency: a carbohydrate-deficient glycoprotein syndrome with hepatic-intestinal presentation."
    Jaeken J., Matthijs G., Saudubray J.-M., Dionisi-Vici C., Bertini E., de Lonlay P., Henri H., Carchon H., Schollen E., Van Schaftingen E.
    Am. J. Hum. Genet. 62:1535-1539(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS CDG1B LEU-102 AND THR-138.
  9. "Carbohydrate-deficient glycoprotein syndrome type Ib: phosphomannose isomerase deficiency and mannose therapy."
    Niehues R., Hasilik M., Alton G., Koerner C., Schiebe-Sukumar M., Koch H.G., Zimmer K.-P., Wu R., Harms E., Reiter K., von Figura K., Freeze H.H., Harms H.K., Marquardt T.
    J. Clin. Invest. 101:1414-1420(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT CDG1B GLN-219.
  10. Cited for: VARIANTS CDG1B CYS-255 AND THR-398.
  11. "Genetic and metabolic analysis of the first adult with congenital disorder of glycosylation type Ib: long-term outcome and effects of mannose supplementation."
    Westphal V., Kjaergaard S., Davis J.A., Peterson S.M., Skovby F., Freeze H.H.
    Mol. Genet. Metab. 73:77-85(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS CDG1B THR-140 AND GLN-219.
  12. "DHPLC analysis as a platform for molecular diagnosis of congenital disorders of glycosylation (CDG)."
    Schollen E., Martens K., Geuzens E., Matthijs G.
    Eur. J. Hum. Genet. 10:643-648(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT CDG1B CYS-129.
  13. "Protein losing enteropathy-hepatic fibrosis syndrome in Saguenay-Lac St-Jean, Quebec is a congenital disorder of glycosylation type Ib."
    Vuillaumier-Barrot S., Le Bizec C., de Lonlay P., Barnier A., Mitchell G., Pelletier V., Prevost C., Saudubray J.-M., Durand G., Seta N.
    J. Med. Genet. 39:849-851(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT CDG1B HIS-295.

Entry informationi

Entry nameiMPI_HUMAN
AccessioniPrimary (citable) accession number: P34949
Secondary accession number(s): A8K8K9, Q96AB0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: January 23, 2007
Last modified: September 3, 2014
This is version 157 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi