P34949 (MPI_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 144.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Mannose-6-phosphate isomerase EC=5.3.1.8 Alternative name(s): Phosphohexomutase Phosphomannose isomerase Short name=PMI | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 423 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Involved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions. |
| Catalytic activity | D-mannose 6-phosphate = D-fructose 6-phosphate. |
| Cofactor | Binds 1 zinc ion per subunit By similarity. |
| Pathway | |
| Subcellular location | Cytoplasm Probable. |
| Tissue specificity | Expressed in all tissues, but more abundant in heart, brain and skeletal muscle. |
| Involvement in disease | Congenital disorder of glycosylation 1B (CDG1B) [MIM:602579]: A multisystem disorder caused by a defect in glycoprotein biosynthesis and characterized by under-glycosylated serum glycoproteins. Congenital disorders of glycosylation result in a wide variety of clinical features, such as defects in the nervous system development, psychomotor retardation, dysmorphic features, hypotonia, coagulation disorders, and immunodeficiency. The broad spectrum of features reflects the critical role of N-glycoproteins during embryonic development, differentiation, and maintenance of cell functions. Congenital disorder of glycosylation type 1B is clinically characterized by protein-losing enteropathy. |
| Sequence similarities | Belongs to the mannose-6-phosphate isomerase type 1 family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing |
| Disease | Congenital disorder of glycosylation Disease mutation |
| Ligand | Metal-binding Zinc |
| Molecular function | Isomerase |
| Technical term | Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | GDP-mannose biosynthetic process Traceable author statement. Source: Reactome dolichol-linked oligosaccharide biosynthetic processTraceable author statement. Source: Reactome post-translational protein modificationTraceable author statement. Source: Reactome protein N-linked glycosylation via asparagineTraceable author statement. Source: Reactome |
| Cellular_component | cytosol Traceable author statement. Source: Reactome |
| Molecular_function | mannose-6-phosphate isomerase activity Traceable author statement Ref.1. Source: ProtInc zinc ion bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P34949-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P34949-2) The sequence of this isoform differs from the canonical sequence as follows: 163-224: KVPEFQFLIGDEAATHLKQTMSHDSQAVASSLQSCFSHLMKSEKKVVVEQLNLLVKRISQQA → T | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 423 | 423 | Mannose-6-phosphate isomerase | PRO_0000194235 | |||||
Sites | |||||||||
| Active site | 295 | 1 | By similarity | ||||||
| Metal binding | 110 | 1 | Zinc By similarity | ||||||
| Metal binding | 112 | 1 | Zinc By similarity | ||||||
| Metal binding | 137 | 1 | Zinc By similarity | ||||||
| Metal binding | 276 | 1 | Zinc By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 163 – 224 | 62 | KVPEF…ISQQA → T in isoform 2. | VSP_013357 | |||||
| Natural variant | 51 | 1 | M → T in CDG1B. Ref.2 | VAR_022516 | |||||
| Natural variant | 102 | 1 | S → L in CDG1B. Ref.7 | VAR_012338 | |||||
| Natural variant | 129 | 1 | Y → C in CDG1B. Ref.11 | VAR_022517 | |||||
| Natural variant | 131 | 1 | D → N in CDG1B. Ref.2 | VAR_022518 | |||||
| Natural variant | 138 | 1 | M → T in CDG1B. Ref.7 | VAR_012339 | |||||
| Natural variant | 140 | 1 | I → T in CDG1B. Ref.10 | VAR_012345 | |||||
| Natural variant | 152 | 1 | R → Q in CDG1B. Ref.2 | VAR_022519 | |||||
| Natural variant | 219 | 1 | R → Q in CDG1B. Ref.8 Ref.10 | VAR_012340 | |||||
| Natural variant | 250 | 1 | G → S in CDG1B. Ref.2 | VAR_022520 | |||||
| Natural variant | 255 | 1 | Y → C in CDG1B. Ref.9 | VAR_022521 | |||||
| Natural variant | 295 | 1 | R → H in CDG1B. Ref.12 Corresponds to variant rs28928906 [ dbSNP | Ensembl ]. | VAR_022522 | |||||
| Natural variant | 398 | 1 | I → T in CDG1B. Ref.9 | VAR_022523 | |||||
| Natural variant | 418 | 1 | R → H in CDG1B. Ref.2 | VAR_022524 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Purification, cDNA cloning and heterologous expression of human phosphomannose isomerase." Proudfoot A.E.I., Turcatti G., Wells T.N.C., Payton M.A., Smith D.J. Eur. J. Biochem. 219:415-423(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PARTIAL PROTEIN SEQUENCE. Tissue: Placenta and Testis. |
| [2] | "Genomic organization of the human phosphomannose isomerase (MPI) gene and mutation analysis in patients with congenital disorders of glycosylation type Ib (CDG-Ib)." Schollen E., Dorland L., de Koning T.J., Van Diggelen O.P., Huijmans J.G.M., Marquardt T., Babovic-Vuksanovic D., Patterson M., Imtiaz F., Winchester B., Adamowicz M., Pronicka E., Freeze H., Matthijs G. Hum. Mutat. 16:247-252(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS CDG1B THR-51; ASN-131; GLN-152; SER-250 AND HIS-418. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Testis. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Blood and Brain. |
| [6] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [7] | "Phosphomannose isomerase deficiency: a carbohydrate-deficient glycoprotein syndrome with hepatic-intestinal presentation." Jaeken J., Matthijs G., Saudubray J.-M., Dionisi-Vici C., Bertini E., de Lonlay P., Henri H., Carchon H., Schollen E., Van Schaftingen E. Am. J. Hum. Genet. 62:1535-1539(1998) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS CDG1B LEU-102 AND THR-138. |
| [8] | "Carbohydrate-deficient glycoprotein syndrome type Ib: phosphomannose isomerase deficiency and mannose therapy." Niehues R., Hasilik M., Alton G., Koerner C., Schiebe-Sukumar M., Koch H.G., Zimmer K.-P., Wu R., Harms E., Reiter K., von Figura K., Freeze H.H., Harms H.K., Marquardt T. J. Clin. Invest. 101:1414-1420(1998) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT CDG1B GLN-219. |
| [9] | "A broad spectrum of clinical presentations in congenital disorders of glycosylation I: a series of 26 cases." de Lonlay P., Seta N., Barrot S., Chabrol B., Drouin V., Gabriel B.M., Journel H., Kretz M., Laurent J., Le Merrer M., Leroy A., Pedespan D., Sarda P., Villeneuve N., Schmitz J., van Schaftingen E., Matthijs G., Jaeken J. Cormier-Daire V.J. Med. Genet. 38:14-19(2001) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS CDG1B CYS-255 AND THR-398. |
| [10] | "Genetic and metabolic analysis of the first adult with congenital disorder of glycosylation type Ib: long-term outcome and effects of mannose supplementation." Westphal V., Kjaergaard S., Davis J.A., Peterson S.M., Skovby F., Freeze H.H. Mol. Genet. Metab. 73:77-85(2001) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS CDG1B THR-140 AND GLN-219. |
| [11] | "DHPLC analysis as a platform for molecular diagnosis of congenital disorders of glycosylation (CDG)." Schollen E., Martens K., Geuzens E., Matthijs G. Eur. J. Hum. Genet. 10:643-648(2002) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT CDG1B CYS-129. |
| [12] | "Protein losing enteropathy-hepatic fibrosis syndrome in Saguenay-Lac St-Jean, Quebec is a congenital disorder of glycosylation type Ib." Vuillaumier-Barrot S., Le Bizec C., de Lonlay P., Barnier A., Mitchell G., Pelletier V., Prevost C., Saudubray J.-M., Durand G., Seta N. J. Med. Genet. 39:849-851(2002) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT CDG1B HIS-295. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X76057 mRNA. Translation: CAA53657.1. AF227218, AF227216, AF227217 Genomic DNA. Translation: AAF37697.1. AK292374 mRNA. Translation: BAF85063.1. CH471136 Genomic DNA. Translation: EAW99296.1. BC017351 mRNA. Translation: AAH17351.1. BC046357 mRNA. Translation: AAH46357.1. |
| IPI | IPI00219358. IPI00332187. |
| PIR | S41122. |
| RefSeq | NP_002426.1. NM_002435.1. |
| UniGene | Hs.75694. |
3D structure databases | |
| ProteinModelPortal | P34949. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000318318. |
PTM databases | |
| PhosphoSite | P34949. |
Polymorphism databases | |
| DMDM | 462567. |
2D gel databases | |
| OGP | P34949. |
Proteomic databases | |
| PaxDb | P34949. |
| PRIDE | P34949. |
Protocols and materials databases | |
| DNASU | 4351. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000323744; ENSP00000318192; ENSG00000178802. ENST00000352410; ENSP00000318318; ENSG00000178802. |
| GeneID | 4351. |
| KEGG | hsa:4351. |
| UCSC | uc002azc.1. human. uc002aze.1. human. |
Organism-specific databases | |
| CTD | 4351. |
| GeneCards | GC15P075182. |
| HGNC | HGNC:7216. MPI. |
| HPA | HPA007200. |
| MIM | 154550. gene. 602579. phenotype. |
| neXtProt | NX_P34949. |
| Orphanet | 79319. CDG syndrome type Ib. |
| PharmGKB | PA30922. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG1482. |
| HOGENOM | HOG000241277. |
| HOVERGEN | HBG000367. |
| InParanoid | P34949. |
| KO | K01809. |
| OMA | VMKMEVP. |
| OrthoDB | EOG49CQ7M. |
| PhylomeDB | P34949. |
Enzyme and pathway databases | |
| Reactome | REACT_17015. Metabolism of proteins. |
| UniPathway | UPA00126; UER00423. |
Gene expression databases | |
| ArrayExpress | P34949. |
| Bgee | P34949. |
| CleanEx | HS_MPI. |
| Genevestigator | P34949. |
| GermOnline | ENSG00000178802. Homo sapiens. |
Family and domain databases | |
| Gene3D | 2.60.120.10. 3 hits. |
| InterPro | IPR001250. Man6P_Isoase-1. IPR016305. Mannose-6-P_Isomerase. IPR018050. Pmannose_isomerase-type1_CS. IPR014710. RmlC-like_jellyroll. IPR011051. RmlC_Cupin. [Graphical view] |
| PANTHER | PTHR10309. PTHR10309. 1 hit. |
| Pfam | PF01238. PMI_typeI. 1 hit. [Graphical view] |
| PIRSF | PIRSF001480. Mannose-6-phosphate_isomerase. 1 hit. |
| PRINTS | PR00714. MAN6PISMRASE. |
| SUPFAM | SSF51182. RmlC_like_cupin. 1 hit. |
| TIGRFAMs | TIGR00218. manA. 1 hit. |
| PROSITE | PS00965. PMI_I_1. 1 hit. PS00966. PMI_I_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | P34949. |
| ChEMBL | CHEMBL2758. |
| GenomeRNAi | 4351. |
| NextBio | 17118. |
| SOURCE | Search... |
Entry information
| Entry name | MPI_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P34949 Secondary accession number(s): A8K8K9, Q96AB0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 15 Human chromosome 15: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with
