Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P34949

- MPI_HUMAN

UniProt

P34949 - MPI_HUMAN

Protein

Mannose-6-phosphate isomerase

Gene

MPI

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 158 (01 Oct 2014)
      Sequence version 2 (23 Jan 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Involved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions.

    Catalytic activityi

    D-mannose 6-phosphate = D-fructose 6-phosphate.

    Cofactori

    Binds 1 zinc ion per subunit.By similarity

    Pathwayi

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Metal bindingi110 – 1101ZincBy similarity
    Metal bindingi112 – 1121ZincBy similarity
    Metal bindingi137 – 1371ZincBy similarity
    Metal bindingi276 – 2761ZincBy similarity
    Active sitei295 – 2951By similarity

    GO - Molecular functioni

    1. mannose-6-phosphate isomerase activity Source: ProtInc
    2. zinc ion binding Source: InterPro

    GO - Biological processi

    1. cellular protein metabolic process Source: Reactome
    2. dolichol-linked oligosaccharide biosynthetic process Source: Reactome
    3. GDP-mannose biosynthetic process Source: Reactome
    4. post-translational protein modification Source: Reactome
    5. protein N-linked glycosylation via asparagine Source: Reactome

    Keywords - Molecular functioni

    Isomerase

    Keywords - Ligandi

    Metal-binding, Zinc

    Enzyme and pathway databases

    ReactomeiREACT_22423. Synthesis of GDP-mannose.
    UniPathwayiUPA00126; UER00423.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Mannose-6-phosphate isomerase (EC:5.3.1.8)
    Alternative name(s):
    Phosphohexomutase
    Phosphomannose isomerase
    Short name:
    PMI
    Gene namesi
    Name:MPI
    Synonyms:PMI1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 15

    Organism-specific databases

    HGNCiHGNC:7216. MPI.

    Subcellular locationi

    Cytoplasm Curated

    GO - Cellular componenti

    1. cytosol Source: Reactome
    2. extracellular vesicular exosome Source: UniProt

    Keywords - Cellular componenti

    Cytoplasm

    Pathology & Biotechi

    Involvement in diseasei

    Congenital disorder of glycosylation 1B (CDG1B) [MIM:602579]: A multisystem disorder caused by a defect in glycoprotein biosynthesis and characterized by under-glycosylated serum glycoproteins. Congenital disorders of glycosylation result in a wide variety of clinical features, such as defects in the nervous system development, psychomotor retardation, dysmorphic features, hypotonia, coagulation disorders, and immunodeficiency. The broad spectrum of features reflects the critical role of N-glycoproteins during embryonic development, differentiation, and maintenance of cell functions. Congenital disorder of glycosylation type 1B is clinically characterized by protein-losing enteropathy.7 Publications
    Note: The disease is caused by mutations affecting the gene represented in this entry.
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti51 – 511M → T in CDG1B. 1 Publication
    VAR_022516
    Natural varianti102 – 1021S → L in CDG1B. 1 Publication
    VAR_012338
    Natural varianti129 – 1291Y → C in CDG1B. 1 Publication
    VAR_022517
    Natural varianti131 – 1311D → N in CDG1B. 1 Publication
    VAR_022518
    Natural varianti138 – 1381M → T in CDG1B. 1 Publication
    VAR_012339
    Natural varianti140 – 1401I → T in CDG1B. 1 Publication
    VAR_012345
    Natural varianti152 – 1521R → Q in CDG1B. 1 Publication
    VAR_022519
    Natural varianti219 – 2191R → Q in CDG1B. 2 Publications
    VAR_012340
    Natural varianti250 – 2501G → S in CDG1B. 1 Publication
    VAR_022520
    Natural varianti255 – 2551Y → C in CDG1B. 1 Publication
    VAR_022521
    Natural varianti295 – 2951R → H in CDG1B. 1 Publication
    Corresponds to variant rs28928906 [ dbSNP | Ensembl ].
    VAR_022522
    Natural varianti398 – 3981I → T in CDG1B. 1 Publication
    VAR_022523
    Natural varianti418 – 4181R → H in CDG1B. 1 Publication
    VAR_022524

    Keywords - Diseasei

    Congenital disorder of glycosylation, Disease mutation

    Organism-specific databases

    MIMi602579. phenotype.
    Orphaneti79319. MPI-CDG.
    PharmGKBiPA30922.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Initiator methioninei1 – 11Removed1 Publication
    Chaini2 – 423422Mannose-6-phosphate isomerasePRO_0000194235Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei2 – 21N-acetylalanine1 Publication

    Keywords - PTMi

    Acetylation

    Proteomic databases

    MaxQBiP34949.
    PaxDbiP34949.
    PRIDEiP34949.

    2D gel databases

    OGPiP34949.

    PTM databases

    PhosphoSiteiP34949.

    Expressioni

    Tissue specificityi

    Expressed in all tissues, but more abundant in heart, brain and skeletal muscle.

    Gene expression databases

    ArrayExpressiP34949.
    BgeeiP34949.
    CleanExiHS_MPI.
    GenevestigatoriP34949.

    Organism-specific databases

    HPAiHPA007200.

    Interactioni

    Protein-protein interaction databases

    BioGridi110491. 3 interactions.
    STRINGi9606.ENSP00000318318.

    Structurei

    3D structure databases

    ProteinModelPortaliP34949.
    SMRiP34949. Positions 2-419.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Phylogenomic databases

    eggNOGiCOG1482.
    HOGENOMiHOG000241277.
    HOVERGENiHBG000367.
    InParanoidiP34949.
    KOiK01809.
    OMAiPYAEFWV.
    PhylomeDBiP34949.
    TreeFamiTF312831.

    Family and domain databases

    Gene3Di2.60.120.10. 3 hits.
    InterProiIPR001250. Man6P_Isoase-1.
    IPR016305. Mannose-6-P_Isomerase.
    IPR018050. Pmannose_isomerase-type1_CS.
    IPR014710. RmlC-like_jellyroll.
    IPR011051. RmlC_Cupin.
    [Graphical view]
    PANTHERiPTHR10309. PTHR10309. 1 hit.
    PfamiPF01238. PMI_typeI. 1 hit.
    [Graphical view]
    PIRSFiPIRSF001480. Mannose-6-phosphate_isomerase. 1 hit.
    PRINTSiPR00714. MAN6PISMRASE.
    SUPFAMiSSF51182. SSF51182. 1 hit.
    TIGRFAMsiTIGR00218. manA. 1 hit.
    PROSITEiPS00965. PMI_I_1. 1 hit.
    PS00966. PMI_I_2. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P34949-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAAPRVFPLS CAVQQYAWGK MGSNSEVARL LASSDPLAQI AEDKPYAELW    50
    MGTHPRGDAK ILDNRISQKT LSQWIAENQD SLGSKVKDTF NGNLPFLFKV 100
    LSVETPLSIQ AHPNKELAEK LHLQAPQHYP DANHKPEMAI ALTPFQGLCG 150
    FRPVEEIVTF LKKVPEFQFL IGDEAATHLK QTMSHDSQAV ASSLQSCFSH 200
    LMKSEKKVVV EQLNLLVKRI SQQAAAGNNM EDIFGELLLQ LHQQYPGDIG 250
    CFAIYFLNLL TLKPGEAMFL EANVPHAYLK GDCVECMACS DNTVRAGLTP 300
    KFIDVPTLCE MLSYTPSSSK DRLFLPTRSQ EDPYLSIYDP PVPDFTIMKT 350
    EVPGSVTEYK VLALDSASIL LMVQGTVIAS TPTTQTPIPL QRGGVLFIGA 400
    NESVSLKLTE PKDLLIFRAC CLL 423
    Length:423
    Mass (Da):46,656
    Last modified:January 23, 2007 - v2
    Checksum:i1612DD966B86D3AC
    GO
    Isoform 2 (identifier: P34949-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         163-224: KVPEFQFLIGDEAATHLKQTMSHDSQAVASSLQSCFSHLMKSEKKVVVEQLNLLVKRISQQA → T

    Note: No experimental confirmation available.

    Show »
    Length:362
    Mass (Da):39,834
    Checksum:i58CA9B39BF20C459
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti51 – 511M → T in CDG1B. 1 Publication
    VAR_022516
    Natural varianti102 – 1021S → L in CDG1B. 1 Publication
    VAR_012338
    Natural varianti129 – 1291Y → C in CDG1B. 1 Publication
    VAR_022517
    Natural varianti131 – 1311D → N in CDG1B. 1 Publication
    VAR_022518
    Natural varianti138 – 1381M → T in CDG1B. 1 Publication
    VAR_012339
    Natural varianti140 – 1401I → T in CDG1B. 1 Publication
    VAR_012345
    Natural varianti152 – 1521R → Q in CDG1B. 1 Publication
    VAR_022519
    Natural varianti219 – 2191R → Q in CDG1B. 2 Publications
    VAR_012340
    Natural varianti250 – 2501G → S in CDG1B. 1 Publication
    VAR_022520
    Natural varianti255 – 2551Y → C in CDG1B. 1 Publication
    VAR_022521
    Natural varianti295 – 2951R → H in CDG1B. 1 Publication
    Corresponds to variant rs28928906 [ dbSNP | Ensembl ].
    VAR_022522
    Natural varianti398 – 3981I → T in CDG1B. 1 Publication
    VAR_022523
    Natural varianti418 – 4181R → H in CDG1B. 1 Publication
    VAR_022524

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei163 – 22462KVPEF…ISQQA → T in isoform 2. 1 PublicationVSP_013357Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X76057 mRNA. Translation: CAA53657.1.
    AF227218, AF227216, AF227217 Genomic DNA. Translation: AAF37697.1.
    AK292374 mRNA. Translation: BAF85063.1.
    CH471136 Genomic DNA. Translation: EAW99296.1.
    BC017351 mRNA. Translation: AAH17351.1.
    BC046357 mRNA. Translation: AAH46357.1.
    CCDSiCCDS10272.1. [P34949-1]
    PIRiS41122.
    RefSeqiNP_001276085.1. NM_001289156.1.
    NP_001276086.1. NM_001289157.1. [P34949-2]
    NP_002426.1. NM_002435.2. [P34949-1]
    UniGeneiHs.75694.

    Genome annotation databases

    EnsembliENST00000323744; ENSP00000318192; ENSG00000178802. [P34949-2]
    ENST00000352410; ENSP00000318318; ENSG00000178802. [P34949-1]
    GeneIDi4351.
    KEGGihsa:4351.
    UCSCiuc002azc.1. human. [P34949-1]
    uc002aze.1. human. [P34949-2]

    Polymorphism databases

    DMDMi462567.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X76057 mRNA. Translation: CAA53657.1 .
    AF227218 , AF227216 , AF227217 Genomic DNA. Translation: AAF37697.1 .
    AK292374 mRNA. Translation: BAF85063.1 .
    CH471136 Genomic DNA. Translation: EAW99296.1 .
    BC017351 mRNA. Translation: AAH17351.1 .
    BC046357 mRNA. Translation: AAH46357.1 .
    CCDSi CCDS10272.1. [P34949-1 ]
    PIRi S41122.
    RefSeqi NP_001276085.1. NM_001289156.1.
    NP_001276086.1. NM_001289157.1. [P34949-2 ]
    NP_002426.1. NM_002435.2. [P34949-1 ]
    UniGenei Hs.75694.

    3D structure databases

    ProteinModelPortali P34949.
    SMRi P34949. Positions 2-419.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 110491. 3 interactions.
    STRINGi 9606.ENSP00000318318.

    Chemistry

    BindingDBi P34949.
    ChEMBLi CHEMBL2758.

    PTM databases

    PhosphoSitei P34949.

    Polymorphism databases

    DMDMi 462567.

    2D gel databases

    OGPi P34949.

    Proteomic databases

    MaxQBi P34949.
    PaxDbi P34949.
    PRIDEi P34949.

    Protocols and materials databases

    DNASUi 4351.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000323744 ; ENSP00000318192 ; ENSG00000178802 . [P34949-2 ]
    ENST00000352410 ; ENSP00000318318 ; ENSG00000178802 . [P34949-1 ]
    GeneIDi 4351.
    KEGGi hsa:4351.
    UCSCi uc002azc.1. human. [P34949-1 ]
    uc002aze.1. human. [P34949-2 ]

    Organism-specific databases

    CTDi 4351.
    GeneCardsi GC15P075182.
    GeneReviewsi MPI.
    HGNCi HGNC:7216. MPI.
    HPAi HPA007200.
    MIMi 154550. gene.
    602579. phenotype.
    neXtProti NX_P34949.
    Orphaneti 79319. MPI-CDG.
    PharmGKBi PA30922.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG1482.
    HOGENOMi HOG000241277.
    HOVERGENi HBG000367.
    InParanoidi P34949.
    KOi K01809.
    OMAi PYAEFWV.
    PhylomeDBi P34949.
    TreeFami TF312831.

    Enzyme and pathway databases

    UniPathwayi UPA00126 ; UER00423 .
    Reactomei REACT_22423. Synthesis of GDP-mannose.

    Miscellaneous databases

    GenomeRNAii 4351.
    NextBioi 17118.
    PROi P34949.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P34949.
    Bgeei P34949.
    CleanExi HS_MPI.
    Genevestigatori P34949.

    Family and domain databases

    Gene3Di 2.60.120.10. 3 hits.
    InterProi IPR001250. Man6P_Isoase-1.
    IPR016305. Mannose-6-P_Isomerase.
    IPR018050. Pmannose_isomerase-type1_CS.
    IPR014710. RmlC-like_jellyroll.
    IPR011051. RmlC_Cupin.
    [Graphical view ]
    PANTHERi PTHR10309. PTHR10309. 1 hit.
    Pfami PF01238. PMI_typeI. 1 hit.
    [Graphical view ]
    PIRSFi PIRSF001480. Mannose-6-phosphate_isomerase. 1 hit.
    PRINTSi PR00714. MAN6PISMRASE.
    SUPFAMi SSF51182. SSF51182. 1 hit.
    TIGRFAMsi TIGR00218. manA. 1 hit.
    PROSITEi PS00965. PMI_I_1. 1 hit.
    PS00966. PMI_I_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Purification, cDNA cloning and heterologous expression of human phosphomannose isomerase."
      Proudfoot A.E.I., Turcatti G., Wells T.N.C., Payton M.A., Smith D.J.
      Eur. J. Biochem. 219:415-423(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PARTIAL PROTEIN SEQUENCE.
      Tissue: Placenta and Testis.
    2. "Genomic organization of the human phosphomannose isomerase (MPI) gene and mutation analysis in patients with congenital disorders of glycosylation type Ib (CDG-Ib)."
      Schollen E., Dorland L., de Koning T.J., Van Diggelen O.P., Huijmans J.G.M., Marquardt T., Babovic-Vuksanovic D., Patterson M., Imtiaz F., Winchester B., Adamowicz M., Pronicka E., Freeze H., Matthijs G.
      Hum. Mutat. 16:247-252(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS CDG1B THR-51; ASN-131; GLN-152; SER-250 AND HIS-418.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Testis.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Blood and Brain.
    6. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
      Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
      Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].
    7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    8. "Phosphomannose isomerase deficiency: a carbohydrate-deficient glycoprotein syndrome with hepatic-intestinal presentation."
      Jaeken J., Matthijs G., Saudubray J.-M., Dionisi-Vici C., Bertini E., de Lonlay P., Henri H., Carchon H., Schollen E., Van Schaftingen E.
      Am. J. Hum. Genet. 62:1535-1539(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANTS CDG1B LEU-102 AND THR-138.
    9. "Carbohydrate-deficient glycoprotein syndrome type Ib: phosphomannose isomerase deficiency and mannose therapy."
      Niehues R., Hasilik M., Alton G., Koerner C., Schiebe-Sukumar M., Koch H.G., Zimmer K.-P., Wu R., Harms E., Reiter K., von Figura K., Freeze H.H., Harms H.K., Marquardt T.
      J. Clin. Invest. 101:1414-1420(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANT CDG1B GLN-219.
    10. Cited for: VARIANTS CDG1B CYS-255 AND THR-398.
    11. "Genetic and metabolic analysis of the first adult with congenital disorder of glycosylation type Ib: long-term outcome and effects of mannose supplementation."
      Westphal V., Kjaergaard S., Davis J.A., Peterson S.M., Skovby F., Freeze H.H.
      Mol. Genet. Metab. 73:77-85(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANTS CDG1B THR-140 AND GLN-219.
    12. "DHPLC analysis as a platform for molecular diagnosis of congenital disorders of glycosylation (CDG)."
      Schollen E., Martens K., Geuzens E., Matthijs G.
      Eur. J. Hum. Genet. 10:643-648(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANT CDG1B CYS-129.
    13. "Protein losing enteropathy-hepatic fibrosis syndrome in Saguenay-Lac St-Jean, Quebec is a congenital disorder of glycosylation type Ib."
      Vuillaumier-Barrot S., Le Bizec C., de Lonlay P., Barnier A., Mitchell G., Pelletier V., Prevost C., Saudubray J.-M., Durand G., Seta N.
      J. Med. Genet. 39:849-851(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANT CDG1B HIS-295.

    Entry informationi

    Entry nameiMPI_HUMAN
    AccessioniPrimary (citable) accession number: P34949
    Secondary accession number(s): A8K8K9, Q96AB0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 1, 1994
    Last sequence update: January 23, 2007
    Last modified: October 1, 2014
    This is version 158 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human chromosome 15
      Human chromosome 15: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3