SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P34308

- CAN_CAEEL

UniProt

P34308 - CAN_CAEEL

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Calpain clp-1
Gene
clp-1, C06G4.2/C06G4.3
Organism
Caenorhabditis elegans
Status
Reviewed - Annotation score: 4 out of 5 - Protein inferred from homologyi

Functioni

Calcium-regulated protease involved in necrotic cell death.1 Publication

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei371 – 3711 By similarity
Active sitei527 – 5271 By similarity
Active sitei551 – 5511 By similarity

GO - Molecular functioni

  1. calcium-dependent cysteine-type endopeptidase activity Source: RefGenome

GO - Biological processi

  1. positive regulation of necrotic cell death Source: WormBase
  2. proteolysis Source: RefGenome
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protease, Thiol protease

Protein family/group databases

MEROPSiC02.A03.

Names & Taxonomyi

Protein namesi
Recommended name:
Calpain clp-1 (EC:3.4.22.-)
Gene namesi
Name:clp-1
ORF Names:C06G4.2/C06G4.3
OrganismiCaenorhabditis elegans
Taxonomic identifieri6239 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
ProteomesiUP000001940: Chromosome III

Organism-specific databases

WormBaseiC06G4.2a; CE37743; WBGene00000542; clp-1.
C06G4.2b; CE37744; WBGene00000542; clp-1.
C06G4.2c; CE00517; WBGene00000542; clp-1.
C06G4.2d; CE30486; WBGene00000542; clp-1.

Subcellular locationi

GO - Cellular componenti

  1. M band Source: WormBase
  2. sarcomere Source: WormBase
Complete GO annotation...

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 780780Calpain clp-1
PRO_0000207734Add
BLAST

Proteomic databases

PaxDbiP34308.
PRIDEiP34308.

Structurei

3D structure databases

ProteinModelPortaliP34308.
SMRiP34308. Positions 301-771.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini316 – 611296Calpain catalytic
Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi21 – 288268Gly-rich
Add
BLAST

Sequence similaritiesi

Belongs to the peptidase C2 family.

Phylogenomic databases

eggNOGiNOG327523.
GeneTreeiENSGT00750000117383.
HOGENOMiHOG000020136.
InParanoidiP34308.
KOiK08585.
OMAiHSRFDVI.
OrthoDBiEOG7RV9FM.
PhylomeDBiP34308.

Family and domain databases

InterProiIPR022684. Calpain_cysteine_protease.
IPR022682. Calpain_domain_III.
IPR022683. Calpain_III.
IPR000169. Pept_cys_AS.
IPR001300. Peptidase_C2_calpain_cat.
[Graphical view]
PfamiPF01067. Calpain_III. 1 hit.
PF00648. Peptidase_C2. 1 hit.
[Graphical view]
PRINTSiPR00704. CALPAIN.
SMARTiSM00720. calpain_III. 1 hit.
SM00230. CysPc. 1 hit.
[Graphical view]
SUPFAMiSSF49758. SSF49758. 1 hit.
PROSITEiPS50203. CALPAIN_CAT. 1 hit.
PS00139. THIOL_PROTEASE_CYS. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Note: Experimental confirmation may be lacking for some isoforms.

Isoform a (identifier: P34308-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MADDEEEIIQ KVEVKPDEFN GLIGSIAGNL IRDKVGGAGG DILGGLASNF    50
FGGGGGGGGG GGGGGFGGGN GGFGGGSNYD QGGNGNSGDQ QKRKRDMAKD 100
LIGGIFDNVV NRKGKKEQDN YGGGGNYGGG GGNQGGGGGG GFNFNDIGGL 150
INSMGGGGGG GQRQGGGGGG FGDILGGIGS LIGGGGGGQY NGGGGNVNPN 200
NLNGGMVNVI GNLIGEAAHR FLGVDPGTGR IIGAVAGNVI MGLGGKDNSL 250
GNIGKVILDN IISGKFRRDV DPFVRPGPDP DRGGGGSGPS PISPRPTTEP 300
QDFYELRDQC LESKRLFEDP QFLANDSSLF FSKRPPKRVE WLRPGEITRE 350
PQLITEGHSR FDVIQGELGD CWLLAAAANL TLKDELFYRV VPPDQSFTEN 400
YAGIFHFQFW QYGKWVDVVI DDRLPTSNGE LLYMHSASNN EFWSALLEKA 450
YAKLFGSYEA LKGGTTSEAL EDMTGGLTEF IDLKNPPRNL MQMMMRGFEM 500
GSLFGCSIEA DPNVWEAKMS NGLVKGHAYS ITGCRIVDGP NGQTCILRIR 550
NPWGNEQEWN GPWSDNSREW RSVPDSVKQD MGLKFDHDGE FWMSFDDFMR 600
NFEKMEICNL GPDVMDEVYQ MTGVKAAGMV WAANTHDGAW VRNQTAGGCR 650
NYINTFANNP QFRVQLTDSD PDDDDELCTV IFAVLQKYRR NLKQDGLDNV 700
PIGFAVYDAG NNRGRLSKQF FAANKSAMRS AAFINLREMT GRFRVPPGNY 750
VVVPSTFEPN EEAEFMLRVY TNGFIESEEL 780

Note: No experimental confirmation available.

Length:780
Mass (Da):83,643
Last modified:July 5, 2005 - v4
Checksum:iC1DFA4E5671F7835
GO
Isoform b (identifier: P34308-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     76-121: Missing.
     708-708: D → DMNN

Note: No experimental confirmation available.

Show »
Length:737
Mass (Da):78,904
Checksum:i0B91CF87AD6FA281
GO
Isoform c (identifier: P34308-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     77-113: SNYDQGGNGNSGDQQKRKRDMAKDLIGGIFDNVVNRK → IFIFKIVRQKFPKNSSSFFCVRKHLDSLKTSPCGLDQ
     114-780: Missing.

Note: No experimental confirmation available.

Show »
Length:113
Mass (Da):11,283
Checksum:i2DDF5D0C0A40C297
GO
Isoform d (identifier: P34308-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     77-100: SNYDQGGNGNSGDQQKRKRDMAKD → GGGSGGGGGGNNIGSLVGSLIGGG
     101-121: Missing.

Note: No experimental confirmation available.

Show »
Length:759
Mass (Da):80,442
Checksum:i5CC728E8C5372689
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei76 – 12146Missing in isoform b.
VSP_005247Add
BLAST
Alternative sequencei77 – 11337SNYDQ…VVNRK → IFIFKIVRQKFPKNSSSFFC VRKHLDSLKTSPCGLDQ in isoform c.
VSP_005249Add
BLAST
Alternative sequencei77 – 10024SNYDQ…DMAKD → GGGSGGGGGGNNIGSLVGSL IGGG in isoform d.
VSP_005248Add
BLAST
Alternative sequencei101 – 12121Missing in isoform d.
VSP_005250Add
BLAST
Alternative sequencei114 – 780667Missing in isoform c.
VSP_005251Add
BLAST
Alternative sequencei708 – 7081D → DMNN in isoform b.
VSP_005252

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
FO080399 Genomic DNA. Translation: CCD63432.1.
FO080399 Genomic DNA. Translation: CCD63433.1.
FO080399 Genomic DNA. Translation: CCD63434.1.
FO080399 Genomic DNA. Translation: CCD63435.1.
PIRiS44749.
S44750.
RefSeqiNP_498740.2. NM_066339.5. [P34308-2]
NP_498741.3. NM_066340.4. [P34308-1]
NP_741237.1. NM_171886.4. [P34308-4]
NP_741238.1. NM_171201.1. [P34308-3]
UniGeneiCel.17311.

Genome annotation databases

EnsemblMetazoaiC06G4.2a; C06G4.2a; WBGene00000542. [P34308-1]
GeneIDi176122.
KEGGicel:CELE_C06G4.2.
UCSCiC06G4.2a.1. c. elegans. [P34308-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
FO080399 Genomic DNA. Translation: CCD63432.1 .
FO080399 Genomic DNA. Translation: CCD63433.1 .
FO080399 Genomic DNA. Translation: CCD63434.1 .
FO080399 Genomic DNA. Translation: CCD63435.1 .
PIRi S44749.
S44750.
RefSeqi NP_498740.2. NM_066339.5. [P34308-2 ]
NP_498741.3. NM_066340.4. [P34308-1 ]
NP_741237.1. NM_171886.4. [P34308-4 ]
NP_741238.1. NM_171201.1. [P34308-3 ]
UniGenei Cel.17311.

3D structure databases

ProteinModelPortali P34308.
SMRi P34308. Positions 301-771.
ModBasei Search...
MobiDBi Search...

Protein family/group databases

MEROPSi C02.A03.

Proteomic databases

PaxDbi P34308.
PRIDEi P34308.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

EnsemblMetazoai C06G4.2a ; C06G4.2a ; WBGene00000542 . [P34308-1 ]
GeneIDi 176122.
KEGGi cel:CELE_C06G4.2.
UCSCi C06G4.2a.1. c. elegans. [P34308-1 ]

Organism-specific databases

CTDi 176122.
WormBasei C06G4.2a ; CE37743 ; WBGene00000542 ; clp-1.
C06G4.2b ; CE37744 ; WBGene00000542 ; clp-1.
C06G4.2c ; CE00517 ; WBGene00000542 ; clp-1.
C06G4.2d ; CE30486 ; WBGene00000542 ; clp-1.

Phylogenomic databases

eggNOGi NOG327523.
GeneTreei ENSGT00750000117383.
HOGENOMi HOG000020136.
InParanoidi P34308.
KOi K08585.
OMAi HSRFDVI.
OrthoDBi EOG7RV9FM.
PhylomeDBi P34308.

Miscellaneous databases

NextBioi 891208.

Family and domain databases

InterProi IPR022684. Calpain_cysteine_protease.
IPR022682. Calpain_domain_III.
IPR022683. Calpain_III.
IPR000169. Pept_cys_AS.
IPR001300. Peptidase_C2_calpain_cat.
[Graphical view ]
Pfami PF01067. Calpain_III. 1 hit.
PF00648. Peptidase_C2. 1 hit.
[Graphical view ]
PRINTSi PR00704. CALPAIN.
SMARTi SM00720. calpain_III. 1 hit.
SM00230. CysPc. 1 hit.
[Graphical view ]
SUPFAMi SSF49758. SSF49758. 1 hit.
PROSITEi PS50203. CALPAIN_CAT. 1 hit.
PS00139. THIOL_PROTEASE_CYS. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: Bristol N2.
  2. "Genome sequence of the nematode C. elegans: a platform for investigating biology."
    The C. elegans sequencing consortium
    Science 282:2012-2018(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING.
    Strain: Bristol N2.
  3. "Specific aspartyl and calpain proteases are required for neurodegeneration in C. elegans."
    Syntichaki P., Xu K., Driscoll M., Tavernarakis N.
    Nature 419:939-944(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.

Entry informationi

Entry nameiCAN_CAEEL
AccessioniPrimary (citable) accession number: P34308
Secondary accession number(s): P34309, Q5DX51, Q5DX52
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: July 5, 2005
Last modified: June 11, 2014
This is version 114 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
  2. Peptidase families
    Classification of peptidase families and list of entries
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi