Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P34308

- CAN_CAEEL

UniProt

P34308 - CAN_CAEEL

Protein

Calpain clp-1

Gene

clp-1

Organism
Caenorhabditis elegans
Status
Reviewed - Annotation score: 4 out of 5- Protein inferred from homologyi
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 115 (01 Oct 2014)
      Sequence version 4 (05 Jul 2005)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Calcium-regulated protease involved in necrotic cell death.1 Publication

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei371 – 3711By similarity
    Active sitei527 – 5271By similarity
    Active sitei551 – 5511By similarity

    GO - Molecular functioni

    1. calcium-dependent cysteine-type endopeptidase activity Source: RefGenome

    GO - Biological processi

    1. positive regulation of necrotic cell death Source: WormBase
    2. proteolysis Source: RefGenome

    Keywords - Molecular functioni

    Hydrolase, Protease, Thiol protease

    Protein family/group databases

    MEROPSiC02.A03.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Calpain clp-1 (EC:3.4.22.-)
    Gene namesi
    Name:clp-1
    ORF Names:C06G4.2/C06G4.3
    OrganismiCaenorhabditis elegans
    Taxonomic identifieri6239 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
    ProteomesiUP000001940: Chromosome III

    Organism-specific databases

    WormBaseiC06G4.2a; CE37743; WBGene00000542; clp-1.
    C06G4.2b; CE37744; WBGene00000542; clp-1.
    C06G4.2c; CE00517; WBGene00000542; clp-1.
    C06G4.2d; CE30486; WBGene00000542; clp-1.

    Subcellular locationi

    GO - Cellular componenti

    1. M band Source: WormBase
    2. sarcomere Source: WormBase

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 780780Calpain clp-1PRO_0000207734Add
    BLAST

    Proteomic databases

    PaxDbiP34308.
    PRIDEiP34308.

    Structurei

    3D structure databases

    ProteinModelPortaliP34308.
    SMRiP34308. Positions 301-771.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini316 – 611296Calpain catalyticPROSITE-ProRule annotationAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi21 – 288268Gly-richAdd
    BLAST

    Sequence similaritiesi

    Belongs to the peptidase C2 family.Curated
    Contains 1 calpain catalytic domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiNOG327523.
    GeneTreeiENSGT00750000117383.
    HOGENOMiHOG000020136.
    InParanoidiP34308.
    KOiK08585.
    OMAiHSRFDVI.
    OrthoDBiEOG7RV9FM.
    PhylomeDBiP34308.

    Family and domain databases

    InterProiIPR022684. Calpain_cysteine_protease.
    IPR022682. Calpain_domain_III.
    IPR022683. Calpain_III.
    IPR000169. Pept_cys_AS.
    IPR001300. Peptidase_C2_calpain_cat.
    [Graphical view]
    PfamiPF01067. Calpain_III. 1 hit.
    PF00648. Peptidase_C2. 1 hit.
    [Graphical view]
    PRINTSiPR00704. CALPAIN.
    SMARTiSM00720. calpain_III. 1 hit.
    SM00230. CysPc. 1 hit.
    [Graphical view]
    SUPFAMiSSF49758. SSF49758. 1 hit.
    PROSITEiPS50203. CALPAIN_CAT. 1 hit.
    PS00139. THIOL_PROTEASE_CYS. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Note: Experimental confirmation may be lacking for some isoforms.

    Isoform a (identifier: P34308-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MADDEEEIIQ KVEVKPDEFN GLIGSIAGNL IRDKVGGAGG DILGGLASNF    50
    FGGGGGGGGG GGGGGFGGGN GGFGGGSNYD QGGNGNSGDQ QKRKRDMAKD 100
    LIGGIFDNVV NRKGKKEQDN YGGGGNYGGG GGNQGGGGGG GFNFNDIGGL 150
    INSMGGGGGG GQRQGGGGGG FGDILGGIGS LIGGGGGGQY NGGGGNVNPN 200
    NLNGGMVNVI GNLIGEAAHR FLGVDPGTGR IIGAVAGNVI MGLGGKDNSL 250
    GNIGKVILDN IISGKFRRDV DPFVRPGPDP DRGGGGSGPS PISPRPTTEP 300
    QDFYELRDQC LESKRLFEDP QFLANDSSLF FSKRPPKRVE WLRPGEITRE 350
    PQLITEGHSR FDVIQGELGD CWLLAAAANL TLKDELFYRV VPPDQSFTEN 400
    YAGIFHFQFW QYGKWVDVVI DDRLPTSNGE LLYMHSASNN EFWSALLEKA 450
    YAKLFGSYEA LKGGTTSEAL EDMTGGLTEF IDLKNPPRNL MQMMMRGFEM 500
    GSLFGCSIEA DPNVWEAKMS NGLVKGHAYS ITGCRIVDGP NGQTCILRIR 550
    NPWGNEQEWN GPWSDNSREW RSVPDSVKQD MGLKFDHDGE FWMSFDDFMR 600
    NFEKMEICNL GPDVMDEVYQ MTGVKAAGMV WAANTHDGAW VRNQTAGGCR 650
    NYINTFANNP QFRVQLTDSD PDDDDELCTV IFAVLQKYRR NLKQDGLDNV 700
    PIGFAVYDAG NNRGRLSKQF FAANKSAMRS AAFINLREMT GRFRVPPGNY 750
    VVVPSTFEPN EEAEFMLRVY TNGFIESEEL 780

    Note: No experimental confirmation available.

    Length:780
    Mass (Da):83,643
    Last modified:July 5, 2005 - v4
    Checksum:iC1DFA4E5671F7835
    GO
    Isoform b (identifier: P34308-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         76-121: Missing.
         708-708: D → DMNN

    Note: No experimental confirmation available.

    Show »
    Length:737
    Mass (Da):78,904
    Checksum:i0B91CF87AD6FA281
    GO
    Isoform c (identifier: P34308-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         77-113: SNYDQGGNGNSGDQQKRKRDMAKDLIGGIFDNVVNRK → IFIFKIVRQKFPKNSSSFFCVRKHLDSLKTSPCGLDQ
         114-780: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:113
    Mass (Da):11,283
    Checksum:i2DDF5D0C0A40C297
    GO
    Isoform d (identifier: P34308-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         77-100: SNYDQGGNGNSGDQQKRKRDMAKD → GGGSGGGGGGNNIGSLVGSLIGGG
         101-121: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:759
    Mass (Da):80,442
    Checksum:i5CC728E8C5372689
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei76 – 12146Missing in isoform b. CuratedVSP_005247Add
    BLAST
    Alternative sequencei77 – 11337SNYDQ…VVNRK → IFIFKIVRQKFPKNSSSFFC VRKHLDSLKTSPCGLDQ in isoform c. CuratedVSP_005249Add
    BLAST
    Alternative sequencei77 – 10024SNYDQ…DMAKD → GGGSGGGGGGNNIGSLVGSL IGGG in isoform d. CuratedVSP_005248Add
    BLAST
    Alternative sequencei101 – 12121Missing in isoform d. CuratedVSP_005250Add
    BLAST
    Alternative sequencei114 – 780667Missing in isoform c. CuratedVSP_005251Add
    BLAST
    Alternative sequencei708 – 7081D → DMNN in isoform b. CuratedVSP_005252

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    FO080399 Genomic DNA. Translation: CCD63432.1.
    FO080399 Genomic DNA. Translation: CCD63433.1.
    FO080399 Genomic DNA. Translation: CCD63434.1.
    FO080399 Genomic DNA. Translation: CCD63435.1.
    PIRiS44749.
    S44750.
    RefSeqiNP_498740.2. NM_066339.5. [P34308-2]
    NP_498741.3. NM_066340.4. [P34308-1]
    NP_741237.1. NM_171886.4. [P34308-4]
    NP_741238.1. NM_171201.1. [P34308-3]
    UniGeneiCel.17311.

    Genome annotation databases

    EnsemblMetazoaiC06G4.2a; C06G4.2a; WBGene00000542. [P34308-1]
    GeneIDi176122.
    KEGGicel:CELE_C06G4.2.
    UCSCiC06G4.2a.1. c. elegans. [P34308-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    FO080399 Genomic DNA. Translation: CCD63432.1 .
    FO080399 Genomic DNA. Translation: CCD63433.1 .
    FO080399 Genomic DNA. Translation: CCD63434.1 .
    FO080399 Genomic DNA. Translation: CCD63435.1 .
    PIRi S44749.
    S44750.
    RefSeqi NP_498740.2. NM_066339.5. [P34308-2 ]
    NP_498741.3. NM_066340.4. [P34308-1 ]
    NP_741237.1. NM_171886.4. [P34308-4 ]
    NP_741238.1. NM_171201.1. [P34308-3 ]
    UniGenei Cel.17311.

    3D structure databases

    ProteinModelPortali P34308.
    SMRi P34308. Positions 301-771.
    ModBasei Search...
    MobiDBi Search...

    Protein family/group databases

    MEROPSi C02.A03.

    Proteomic databases

    PaxDbi P34308.
    PRIDEi P34308.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    EnsemblMetazoai C06G4.2a ; C06G4.2a ; WBGene00000542 . [P34308-1 ]
    GeneIDi 176122.
    KEGGi cel:CELE_C06G4.2.
    UCSCi C06G4.2a.1. c. elegans. [P34308-1 ]

    Organism-specific databases

    CTDi 176122.
    WormBasei C06G4.2a ; CE37743 ; WBGene00000542 ; clp-1.
    C06G4.2b ; CE37744 ; WBGene00000542 ; clp-1.
    C06G4.2c ; CE00517 ; WBGene00000542 ; clp-1.
    C06G4.2d ; CE30486 ; WBGene00000542 ; clp-1.

    Phylogenomic databases

    eggNOGi NOG327523.
    GeneTreei ENSGT00750000117383.
    HOGENOMi HOG000020136.
    InParanoidi P34308.
    KOi K08585.
    OMAi HSRFDVI.
    OrthoDBi EOG7RV9FM.
    PhylomeDBi P34308.

    Miscellaneous databases

    NextBioi 891208.

    Family and domain databases

    InterProi IPR022684. Calpain_cysteine_protease.
    IPR022682. Calpain_domain_III.
    IPR022683. Calpain_III.
    IPR000169. Pept_cys_AS.
    IPR001300. Peptidase_C2_calpain_cat.
    [Graphical view ]
    Pfami PF01067. Calpain_III. 1 hit.
    PF00648. Peptidase_C2. 1 hit.
    [Graphical view ]
    PRINTSi PR00704. CALPAIN.
    SMARTi SM00720. calpain_III. 1 hit.
    SM00230. CysPc. 1 hit.
    [Graphical view ]
    SUPFAMi SSF49758. SSF49758. 1 hit.
    PROSITEi PS50203. CALPAIN_CAT. 1 hit.
    PS00139. THIOL_PROTEASE_CYS. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: Bristol N2.
    2. "Genome sequence of the nematode C. elegans: a platform for investigating biology."
      The C. elegans sequencing consortium
      Science 282:2012-2018(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING.
      Strain: Bristol N2.
    3. "Specific aspartyl and calpain proteases are required for neurodegeneration in C. elegans."
      Syntichaki P., Xu K., Driscoll M., Tavernarakis N.
      Nature 419:939-944(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.

    Entry informationi

    Entry nameiCAN_CAEEL
    AccessioniPrimary (citable) accession number: P34308
    Secondary accession number(s): P34309, Q5DX51, Q5DX52
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 1, 1994
    Last sequence update: July 5, 2005
    Last modified: October 1, 2014
    This is version 115 of the entry and version 4 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programCaenorhabditis annotation project

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Caenorhabditis elegans
      Caenorhabditis elegans: entries, gene names and cross-references to WormBase
    2. Peptidase families
      Classification of peptidase families and list of entries
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3