Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Calpain clp-1

Gene

clp-1

Organism
Caenorhabditis elegans
Status
Reviewed-Annotation score: -Protein inferred from homologyi

Functioni

Calcium-regulated protease involved in necrotic cell death.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei371By similarity1
Active sitei527By similarity1
Active sitei551By similarity1

GO - Molecular functioni

GO - Biological processi

  • positive regulation of necrotic cell death Source: WormBase

Keywordsi

Molecular functionHydrolase, Protease, Thiol protease

Enzyme and pathway databases

ReactomeiR-CEL-6798695 Neutrophil degranulation

Protein family/group databases

MEROPSiC02.A03

Names & Taxonomyi

Protein namesi
Recommended name:
Calpain clp-1 (EC:3.4.22.-)
Gene namesi
Name:clp-1
ORF Names:C06G4.2/C06G4.3
OrganismiCaenorhabditis elegans
Taxonomic identifieri6239 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
Proteomesi
  • UP000001940 Componenti: Chromosome III

Organism-specific databases

WormBaseiC06G4.2a ; CE37743 ; WBGene00000542 ; clp-1
C06G4.2b ; CE37744 ; WBGene00000542 ; clp-1
C06G4.2c ; CE00517 ; WBGene00000542 ; clp-1
C06G4.2d ; CE30486 ; WBGene00000542 ; clp-1

Subcellular locationi

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002077341 – 780Calpain clp-1Add BLAST780

Proteomic databases

EPDiP34308
PaxDbiP34308
PeptideAtlasiP34308
PRIDEiP34308

Expressioni

Gene expression databases

BgeeiWBGene00000542

Interactioni

Protein-protein interaction databases

STRINGi6239.C06G4.2a.2

Structurei

3D structure databases

ProteinModelPortaliP34308
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini316 – 611Calpain catalyticPROSITE-ProRule annotationAdd BLAST296

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi21 – 288Gly-richAdd BLAST268

Sequence similaritiesi

Belongs to the peptidase C2 family.Curated

Phylogenomic databases

eggNOGiKOG0045 Eukaryota
ENOG410XP0B LUCA
GeneTreeiENSGT00760000118971
HOGENOMiHOG000020136
InParanoidiP34308
KOiK08585
OMAiDEVYQMT
OrthoDBiEOG091G049E
PhylomeDBiP34308

Family and domain databases

CDDicd00214 Calpain_III, 1 hit
cd00044 CysPc, 1 hit
InterProiView protein in InterPro
IPR033883 C2_III
IPR022684 Calpain_cysteine_protease
IPR022682 Calpain_domain_III
IPR022683 Calpain_III
IPR036213 Calpain_III_sf
IPR000169 Pept_cys_AS
IPR001300 Peptidase_C2_calpain_cat
PfamiView protein in Pfam
PF01067 Calpain_III, 1 hit
PF00648 Peptidase_C2, 1 hit
PRINTSiPR00704 CALPAIN
SMARTiView protein in SMART
SM00720 calpain_III, 1 hit
SM00230 CysPc, 1 hit
SUPFAMiSSF49758 SSF49758, 1 hit
PROSITEiView protein in PROSITE
PS50203 CALPAIN_CAT, 1 hit
PS00139 THIOL_PROTEASE_CYS, 1 hit

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Experimental confirmation may be lacking for some isoforms.
Isoform a (identifier: P34308-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MADDEEEIIQ KVEVKPDEFN GLIGSIAGNL IRDKVGGAGG DILGGLASNF
60 70 80 90 100
FGGGGGGGGG GGGGGFGGGN GGFGGGSNYD QGGNGNSGDQ QKRKRDMAKD
110 120 130 140 150
LIGGIFDNVV NRKGKKEQDN YGGGGNYGGG GGNQGGGGGG GFNFNDIGGL
160 170 180 190 200
INSMGGGGGG GQRQGGGGGG FGDILGGIGS LIGGGGGGQY NGGGGNVNPN
210 220 230 240 250
NLNGGMVNVI GNLIGEAAHR FLGVDPGTGR IIGAVAGNVI MGLGGKDNSL
260 270 280 290 300
GNIGKVILDN IISGKFRRDV DPFVRPGPDP DRGGGGSGPS PISPRPTTEP
310 320 330 340 350
QDFYELRDQC LESKRLFEDP QFLANDSSLF FSKRPPKRVE WLRPGEITRE
360 370 380 390 400
PQLITEGHSR FDVIQGELGD CWLLAAAANL TLKDELFYRV VPPDQSFTEN
410 420 430 440 450
YAGIFHFQFW QYGKWVDVVI DDRLPTSNGE LLYMHSASNN EFWSALLEKA
460 470 480 490 500
YAKLFGSYEA LKGGTTSEAL EDMTGGLTEF IDLKNPPRNL MQMMMRGFEM
510 520 530 540 550
GSLFGCSIEA DPNVWEAKMS NGLVKGHAYS ITGCRIVDGP NGQTCILRIR
560 570 580 590 600
NPWGNEQEWN GPWSDNSREW RSVPDSVKQD MGLKFDHDGE FWMSFDDFMR
610 620 630 640 650
NFEKMEICNL GPDVMDEVYQ MTGVKAAGMV WAANTHDGAW VRNQTAGGCR
660 670 680 690 700
NYINTFANNP QFRVQLTDSD PDDDDELCTV IFAVLQKYRR NLKQDGLDNV
710 720 730 740 750
PIGFAVYDAG NNRGRLSKQF FAANKSAMRS AAFINLREMT GRFRVPPGNY
760 770 780
VVVPSTFEPN EEAEFMLRVY TNGFIESEEL
Note: No experimental confirmation available.
Length:780
Mass (Da):83,643
Last modified:July 5, 2005 - v4
Checksum:iC1DFA4E5671F7835
GO
Isoform b (identifier: P34308-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     76-121: Missing.
     708-708: D → DMNN

Note: No experimental confirmation available.
Show »
Length:737
Mass (Da):78,904
Checksum:i0B91CF87AD6FA281
GO
Isoform c (identifier: P34308-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     77-113: SNYDQGGNGNSGDQQKRKRDMAKDLIGGIFDNVVNRK → IFIFKIVRQKFPKNSSSFFCVRKHLDSLKTSPCGLDQ
     114-780: Missing.

Note: No experimental confirmation available.
Show »
Length:113
Mass (Da):11,283
Checksum:i2DDF5D0C0A40C297
GO
Isoform d (identifier: P34308-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     77-100: SNYDQGGNGNSGDQQKRKRDMAKD → GGGSGGGGGGNNIGSLVGSLIGGG
     101-121: Missing.

Note: No experimental confirmation available.
Show »
Length:759
Mass (Da):80,442
Checksum:i5CC728E8C5372689
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_00524776 – 121Missing in isoform b. CuratedAdd BLAST46
Alternative sequenceiVSP_00524977 – 113SNYDQ…VVNRK → IFIFKIVRQKFPKNSSSFFC VRKHLDSLKTSPCGLDQ in isoform c. CuratedAdd BLAST37
Alternative sequenceiVSP_00524877 – 100SNYDQ…DMAKD → GGGSGGGGGGNNIGSLVGSL IGGG in isoform d. CuratedAdd BLAST24
Alternative sequenceiVSP_005250101 – 121Missing in isoform d. CuratedAdd BLAST21
Alternative sequenceiVSP_005251114 – 780Missing in isoform c. CuratedAdd BLAST667
Alternative sequenceiVSP_005252708D → DMNN in isoform b. Curated1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
FO080399 Genomic DNA Translation: CCD63432.1
FO080399 Genomic DNA Translation: CCD63433.1
FO080399 Genomic DNA Translation: CCD63434.1
FO080399 Genomic DNA Translation: CCD63435.1
PIRiS44749
S44750
RefSeqiNP_498740.2, NM_066339.5 [P34308-2]
NP_498741.3, NM_066340.4 [P34308-1]
NP_741237.1, NM_171886.4 [P34308-4]
NP_741238.1, NM_171201.1 [P34308-3]
UniGeneiCel.17311

Genome annotation databases

EnsemblMetazoaiC06G4.2a.1; C06G4.2a.1; WBGene00000542 [P34308-1]
C06G4.2a.2; C06G4.2a.2; WBGene00000542 [P34308-1]
GeneIDi176122
KEGGicel:CELE_C06G4.2
UCSCiC06G4.2a.1 c. elegans [P34308-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiCAN_CAEEL
AccessioniPrimary (citable) accession number: P34308
Secondary accession number(s): P34309, Q5DX51, Q5DX52
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: July 5, 2005
Last modified: April 25, 2018
This is version 140 of the entry and version 4 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health