Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Calpain clp-1

Gene

clp-1

Organism
Caenorhabditis elegans
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Protein inferred from homologyi

Functioni

Calcium-regulated protease involved in necrotic cell death.1 Publication

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei371 – 3711By similarity
Active sitei527 – 5271By similarity
Active sitei551 – 5511By similarity

GO - Molecular functioni

  1. calcium-dependent cysteine-type endopeptidase activity Source: GO_Central

GO - Biological processi

  1. positive regulation of necrotic cell death Source: WormBase
  2. proteolysis Source: GO_Central
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protease, Thiol protease

Protein family/group databases

MEROPSiC02.A03.

Names & Taxonomyi

Protein namesi
Recommended name:
Calpain clp-1 (EC:3.4.22.-)
Gene namesi
Name:clp-1
ORF Names:C06G4.2/C06G4.3
OrganismiCaenorhabditis elegans
Taxonomic identifieri6239 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
ProteomesiUP000001940: Chromosome III

Organism-specific databases

WormBaseiC06G4.2a; CE37743; WBGene00000542; clp-1.
C06G4.2b; CE37744; WBGene00000542; clp-1.
C06G4.2c; CE00517; WBGene00000542; clp-1.
C06G4.2d; CE30486; WBGene00000542; clp-1.

Subcellular locationi

GO - Cellular componenti

  1. M band Source: WormBase
  2. sarcomere Source: WormBase
Complete GO annotation...

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 780780Calpain clp-1PRO_0000207734Add
BLAST

Proteomic databases

PaxDbiP34308.
PRIDEiP34308.

Structurei

3D structure databases

ProteinModelPortaliP34308.
SMRiP34308. Positions 301-771.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini316 – 611296Calpain catalyticPROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi21 – 288268Gly-richAdd
BLAST

Sequence similaritiesi

Belongs to the peptidase C2 family.Curated
Contains 1 calpain catalytic domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiNOG327523.
GeneTreeiENSGT00760000118971.
HOGENOMiHOG000020136.
InParanoidiP34308.
KOiK08585.
OMAiRFDVIQG.
OrthoDBiEOG7RV9FM.
PhylomeDBiP34308.

Family and domain databases

InterProiIPR022684. Calpain_cysteine_protease.
IPR022682. Calpain_domain_III.
IPR022683. Calpain_III.
IPR000169. Pept_cys_AS.
IPR001300. Peptidase_C2_calpain_cat.
[Graphical view]
PfamiPF01067. Calpain_III. 1 hit.
PF00648. Peptidase_C2. 1 hit.
[Graphical view]
PRINTSiPR00704. CALPAIN.
SMARTiSM00720. calpain_III. 1 hit.
SM00230. CysPc. 1 hit.
[Graphical view]
SUPFAMiSSF49758. SSF49758. 1 hit.
PROSITEiPS50203. CALPAIN_CAT. 1 hit.
PS00139. THIOL_PROTEASE_CYS. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Note: Experimental confirmation may be lacking for some isoforms.

Isoform a (identifier: P34308-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MADDEEEIIQ KVEVKPDEFN GLIGSIAGNL IRDKVGGAGG DILGGLASNF
60 70 80 90 100
FGGGGGGGGG GGGGGFGGGN GGFGGGSNYD QGGNGNSGDQ QKRKRDMAKD
110 120 130 140 150
LIGGIFDNVV NRKGKKEQDN YGGGGNYGGG GGNQGGGGGG GFNFNDIGGL
160 170 180 190 200
INSMGGGGGG GQRQGGGGGG FGDILGGIGS LIGGGGGGQY NGGGGNVNPN
210 220 230 240 250
NLNGGMVNVI GNLIGEAAHR FLGVDPGTGR IIGAVAGNVI MGLGGKDNSL
260 270 280 290 300
GNIGKVILDN IISGKFRRDV DPFVRPGPDP DRGGGGSGPS PISPRPTTEP
310 320 330 340 350
QDFYELRDQC LESKRLFEDP QFLANDSSLF FSKRPPKRVE WLRPGEITRE
360 370 380 390 400
PQLITEGHSR FDVIQGELGD CWLLAAAANL TLKDELFYRV VPPDQSFTEN
410 420 430 440 450
YAGIFHFQFW QYGKWVDVVI DDRLPTSNGE LLYMHSASNN EFWSALLEKA
460 470 480 490 500
YAKLFGSYEA LKGGTTSEAL EDMTGGLTEF IDLKNPPRNL MQMMMRGFEM
510 520 530 540 550
GSLFGCSIEA DPNVWEAKMS NGLVKGHAYS ITGCRIVDGP NGQTCILRIR
560 570 580 590 600
NPWGNEQEWN GPWSDNSREW RSVPDSVKQD MGLKFDHDGE FWMSFDDFMR
610 620 630 640 650
NFEKMEICNL GPDVMDEVYQ MTGVKAAGMV WAANTHDGAW VRNQTAGGCR
660 670 680 690 700
NYINTFANNP QFRVQLTDSD PDDDDELCTV IFAVLQKYRR NLKQDGLDNV
710 720 730 740 750
PIGFAVYDAG NNRGRLSKQF FAANKSAMRS AAFINLREMT GRFRVPPGNY
760 770 780
VVVPSTFEPN EEAEFMLRVY TNGFIESEEL

Note: No experimental confirmation available.

Length:780
Mass (Da):83,643
Last modified:July 5, 2005 - v4
Checksum:iC1DFA4E5671F7835
GO
Isoform b (identifier: P34308-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     76-121: Missing.
     708-708: D → DMNN

Note: No experimental confirmation available.

Show »
Length:737
Mass (Da):78,904
Checksum:i0B91CF87AD6FA281
GO
Isoform c (identifier: P34308-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     77-113: SNYDQGGNGNSGDQQKRKRDMAKDLIGGIFDNVVNRK → IFIFKIVRQKFPKNSSSFFCVRKHLDSLKTSPCGLDQ
     114-780: Missing.

Note: No experimental confirmation available.

Show »
Length:113
Mass (Da):11,283
Checksum:i2DDF5D0C0A40C297
GO
Isoform d (identifier: P34308-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     77-100: SNYDQGGNGNSGDQQKRKRDMAKD → GGGSGGGGGGNNIGSLVGSLIGGG
     101-121: Missing.

Note: No experimental confirmation available.

Show »
Length:759
Mass (Da):80,442
Checksum:i5CC728E8C5372689
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei76 – 12146Missing in isoform b. CuratedVSP_005247Add
BLAST
Alternative sequencei77 – 11337SNYDQ…VVNRK → IFIFKIVRQKFPKNSSSFFC VRKHLDSLKTSPCGLDQ in isoform c. CuratedVSP_005249Add
BLAST
Alternative sequencei77 – 10024SNYDQ…DMAKD → GGGSGGGGGGNNIGSLVGSL IGGG in isoform d. CuratedVSP_005248Add
BLAST
Alternative sequencei101 – 12121Missing in isoform d. CuratedVSP_005250Add
BLAST
Alternative sequencei114 – 780667Missing in isoform c. CuratedVSP_005251Add
BLAST
Alternative sequencei708 – 7081D → DMNN in isoform b. CuratedVSP_005252

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
FO080399 Genomic DNA. Translation: CCD63432.1.
FO080399 Genomic DNA. Translation: CCD63433.1.
FO080399 Genomic DNA. Translation: CCD63434.1.
FO080399 Genomic DNA. Translation: CCD63435.1.
PIRiS44749.
S44750.
RefSeqiNP_498740.2. NM_066339.5. [P34308-2]
NP_498741.3. NM_066340.4. [P34308-1]
NP_741237.1. NM_171886.4. [P34308-4]
NP_741238.1. NM_171201.1. [P34308-3]
UniGeneiCel.17311.

Genome annotation databases

EnsemblMetazoaiC06G4.2a; C06G4.2a; WBGene00000542. [P34308-1]
GeneIDi176122.
KEGGicel:CELE_C06G4.2.
UCSCiC06G4.2a.1. c. elegans. [P34308-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
FO080399 Genomic DNA. Translation: CCD63432.1.
FO080399 Genomic DNA. Translation: CCD63433.1.
FO080399 Genomic DNA. Translation: CCD63434.1.
FO080399 Genomic DNA. Translation: CCD63435.1.
PIRiS44749.
S44750.
RefSeqiNP_498740.2. NM_066339.5. [P34308-2]
NP_498741.3. NM_066340.4. [P34308-1]
NP_741237.1. NM_171886.4. [P34308-4]
NP_741238.1. NM_171201.1. [P34308-3]
UniGeneiCel.17311.

3D structure databases

ProteinModelPortaliP34308.
SMRiP34308. Positions 301-771.
ModBaseiSearch...
MobiDBiSearch...

Protein family/group databases

MEROPSiC02.A03.

Proteomic databases

PaxDbiP34308.
PRIDEiP34308.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiC06G4.2a; C06G4.2a; WBGene00000542. [P34308-1]
GeneIDi176122.
KEGGicel:CELE_C06G4.2.
UCSCiC06G4.2a.1. c. elegans. [P34308-1]

Organism-specific databases

CTDi176122.
WormBaseiC06G4.2a; CE37743; WBGene00000542; clp-1.
C06G4.2b; CE37744; WBGene00000542; clp-1.
C06G4.2c; CE00517; WBGene00000542; clp-1.
C06G4.2d; CE30486; WBGene00000542; clp-1.

Phylogenomic databases

eggNOGiNOG327523.
GeneTreeiENSGT00760000118971.
HOGENOMiHOG000020136.
InParanoidiP34308.
KOiK08585.
OMAiRFDVIQG.
OrthoDBiEOG7RV9FM.
PhylomeDBiP34308.

Miscellaneous databases

NextBioi891208.

Family and domain databases

InterProiIPR022684. Calpain_cysteine_protease.
IPR022682. Calpain_domain_III.
IPR022683. Calpain_III.
IPR000169. Pept_cys_AS.
IPR001300. Peptidase_C2_calpain_cat.
[Graphical view]
PfamiPF01067. Calpain_III. 1 hit.
PF00648. Peptidase_C2. 1 hit.
[Graphical view]
PRINTSiPR00704. CALPAIN.
SMARTiSM00720. calpain_III. 1 hit.
SM00230. CysPc. 1 hit.
[Graphical view]
SUPFAMiSSF49758. SSF49758. 1 hit.
PROSITEiPS50203. CALPAIN_CAT. 1 hit.
PS00139. THIOL_PROTEASE_CYS. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: Bristol N2.
  2. "Genome sequence of the nematode C. elegans: a platform for investigating biology."
    The C. elegans sequencing consortium
    Science 282:2012-2018(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING.
    Strain: Bristol N2.
  3. "Specific aspartyl and calpain proteases are required for neurodegeneration in C. elegans."
    Syntichaki P., Xu K., Driscoll M., Tavernarakis N.
    Nature 419:939-944(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.

Entry informationi

Entry nameiCAN_CAEEL
AccessioniPrimary (citable) accession number: P34308
Secondary accession number(s): P34309, Q5DX51, Q5DX52
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: July 5, 2005
Last modified: February 4, 2015
This is version 118 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
  2. Peptidase families
    Classification of peptidase families and list of entries
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.