P34308 (CAN_CAEEL) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 105.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Calpain clp-1 EC=3.4.22.- | ||||
| Gene names |
| ||||
| Organism | Caenorhabditis elegans [Reference proteome] | ||||
| Taxonomic identifier | 6239 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Ecdysozoa › Nematoda › Chromadorea › Rhabditida › Rhabditoidea › Rhabditidae › Peloderinae › Caenorhabditis![]() |
Protein attributes
| Sequence length | 780 AA. |
| Sequence status | Complete. |
| Protein existence | Inferred from homology |
General annotation (Comments)
| Function | Calcium-regulated protease involved in necrotic cell death. Ref.3 |
| Sequence similarities | Belongs to the peptidase C2 family. Contains 1 calpain catalytic domain. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Molecular function | Hydrolase Protease Thiol protease |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | positive regulation of necrotic cell death Inferred from genetic interaction PubMed 22157748. Source: WormBase proteolysisInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | M band Inferred from direct assay PubMed 22479198. Source: WormBase |
| Molecular_function | calcium-dependent cysteine-type endopeptidase activity Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] Note: Experimental confirmation may be lacking for some isoforms. | ||||||
| Isoform a (identifier: P34308-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform b (identifier: P34308-2) The sequence of this isoform differs from the canonical sequence as follows: 76-121: Missing. 708-708: D → DMNN | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform c (identifier: P34308-3) The sequence of this isoform differs from the canonical sequence as follows: 77-113: SNYDQGGNGNSGDQQKRKRDMAKDLIGGIFDNVVNRK → IFIFKIVRQKFPKNSSSFFCVRKHLDSLKTSPCGLDQ 114-780: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform d (identifier: P34308-4) The sequence of this isoform differs from the canonical sequence as follows: 77-100: SNYDQGGNGNSGDQQKRKRDMAKD → GGGSGGGGGGNNIGSLVGSLIGGG 101-121: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 780 | 780 | Calpain clp-1 | PRO_0000207734 | |||||
Regions | |||||||||
| Domain | 316 – 611 | 296 | Calpain catalytic | ||||||
| Compositional bias | 21 – 288 | 268 | Gly-rich | ||||||
Sites | |||||||||
| Active site | 371 | 1 | By similarity | ||||||
| Active site | 527 | 1 | By similarity | ||||||
| Active site | 551 | 1 | By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 76 – 121 | 46 | Missing in isoform b. | VSP_005247 | |||||
| Alternative sequence | 77 – 113 | 37 | SNYDQ…VVNRK → IFIFKIVRQKFPKNSSSFFC VRKHLDSLKTSPCGLDQ in isoform c. | VSP_005249 | |||||
| Alternative sequence | 77 – 100 | 24 | SNYDQ…DMAKD → GGGSGGGGGGNNIGSLVGSL IGGG in isoform d. | VSP_005248 | |||||
| Alternative sequence | 101 – 121 | 21 | Missing in isoform d. | VSP_005250 | |||||
| Alternative sequence | 114 – 780 | 667 | Missing in isoform c. | VSP_005251 | |||||
| Alternative sequence | 708 | 1 | D → DMNN in isoform b. | VSP_005252 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "2.2 Mb of contiguous nucleotide sequence from chromosome III of C. elegans." Wilson R., Ainscough R., Anderson K., Baynes C., Berks M., Bonfield J., Burton J., Connell M., Copsey T., Cooper J., Coulson A., Craxton M., Dear S., Du Z., Durbin R., Favello A., Fraser A., Fulton L. Wohldman P.Nature 368:32-38(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: Bristol N2. |
| [2] | "Genome sequence of the nematode C. elegans: a platform for investigating biology." The C. elegans sequencing consortium Science 282:2012-2018(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING. Strain: Bristol N2. |
| [3] | "Specific aspartyl and calpain proteases are required for neurodegeneration in C. elegans." Syntichaki P., Xu K., Driscoll M., Tavernarakis N. Nature 419:939-944(2002) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | FO080399 Genomic DNA. Translation: CCD63432.1. FO080399 Genomic DNA. Translation: CCD63433.1. FO080399 Genomic DNA. Translation: CCD63434.1. FO080399 Genomic DNA. Translation: CCD63435.1. |
| PIR | S44749. S44750. |
| RefSeq | NP_498740.2. NM_066339.5. NP_498741.3. NM_066340.4. NP_741237.1. NM_171886.4. NP_741238.1. NM_171201.1. |
| UniGene | Cel.17311. |
3D structure databases | |
| ProteinModelPortal | P34308. |
| SMR | P34308. Positions 181-259, 301-771. |
| ModBase | Search... |
Protein family/group databases | |
| MEROPS | C02.A03. |
Proteomic databases | |
| PaxDb | P34308. |
| PRIDE | P34308. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| EnsemblMetazoa | C06G4.2a.1; C06G4.2a.1; C06G4.2. C06G4.2a.2; C06G4.2a.2; C06G4.2. |
| GeneID | 176122. |
| KEGG | cel:CELE_C06G4.2. |
| UCSC | C06G4.2a.1. c. elegans. |
Organism-specific databases | |
| CTD | 176122. |
| WormBase | C06G4.2a; CE37743; WBGene00000542; clp-1. C06G4.2b; CE37744; WBGene00000542; clp-1. C06G4.2c; CE00517; WBGene00000542; clp-1. C06G4.2d; CE30486; WBGene00000542; clp-1. |
Phylogenomic databases | |
| eggNOG | NOG327523. |
| GeneTree | ENSGT00700000104110. |
| HOGENOM | HOG000020136. |
| InParanoid | P34308. |
| KO | K08585. |
| OMA | EGHSRFD. |
Family and domain databases | |
| InterPro | IPR022684. Calpain_cysteine_protease. IPR022682. Calpain_domain_III. IPR022683. Calpain_III. IPR000169. Pept_cys_AS. IPR001300. Peptidase_C2_calpain_cat. [Graphical view] |
| Pfam | PF01067. Calpain_III. 1 hit. PF00648. Peptidase_C2. 1 hit. [Graphical view] |
| PRINTS | PR00704. CALPAIN. |
| SMART | SM00720. calpain_III. 1 hit. SM00230. CysPc. 1 hit. [Graphical view] |
| SUPFAM | SSF49758. Peptidase_C2. 1 hit. |
| PROSITE | PS50203. CALPAIN_CAT. 1 hit. PS00640. THIOL_PROTEASE_ASN. False negative. PS00139. THIOL_PROTEASE_CYS. 1 hit. PS00639. THIOL_PROTEASE_HIS. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 891208. |
Entry information
| Entry name | CAN_CAEEL | ||||||||
| Accession | Primary (citable) accession number: P34308 Secondary accession number(s): P34309, Q5DX51, Q5DX52 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Caenorhabditis annotation project | ||||||||
Relevant documents
| Peptidase families Classification of peptidase families and list of entries |
| Caenorhabditis elegans Caenorhabditis elegans: entries, gene names and cross-references to WormBase |
| SIMILARITY comments Index of protein domains and families |

Clusters with
