Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Fasciclin-2

Gene

Fas2

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Neuronal recognition molecule for the MP1 axon pathway, pathway recognition for axons during the development of nerve fascicles.1 Publication

GO - Biological processi

  • axonal fasciculation Source: FlyBase
  • behavioral response to ethanol Source: FlyBase
  • Bolwig's organ morphogenesis Source: FlyBase
  • cell morphogenesis involved in neuron differentiation Source: FlyBase
  • homophilic cell adhesion via plasma membrane adhesion molecules Source: FlyBase
  • imaginal disc-derived male genitalia morphogenesis Source: FlyBase
  • learning Source: FlyBase
  • learning or memory Source: FlyBase
  • motor neuron axon guidance Source: FlyBase
  • mushroom body development Source: FlyBase
  • negative regulation of epidermal growth factor receptor signaling pathway Source: FlyBase
  • negative regulation of neuron remodeling Source: FlyBase
  • neuromuscular junction development Source: FlyBase
  • neuron recognition Source: FlyBase
  • olfactory learning Source: FlyBase
  • photoreceptor cell axon guidance Source: FlyBase
  • regulation of cell shape Source: FlyBase
  • regulation of synapse structure or activity Source: FlyBase
  • regulation of synaptic growth at neuromuscular junction Source: FlyBase
  • regulation of synaptic plasticity Source: FlyBase
  • regulation of tube architecture, open tracheal system Source: FlyBase
  • regulation of tube diameter, open tracheal system Source: FlyBase
  • regulation of tube length, open tracheal system Source: FlyBase
  • short-term memory Source: FlyBase
  • synapse organization Source: FlyBase
  • terminal button organization Source: FlyBase
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Cell adhesion, Differentiation, Neurogenesis

Enzyme and pathway databases

ReactomeiR-DME-375165. NCAM signaling for neurite out-growth.
R-DME-419037. NCAM1 interactions.
R-DME-445144. Signal transduction by L1.
R-DME-5673001. RAF/MAP kinase cascade.

Names & Taxonomyi

Protein namesi
Recommended name:
Fasciclin-2
Alternative name(s):
Fasciclin II
Short name:
FAS II
Gene namesi
Name:Fas2
ORF Names:CG3665
OrganismiDrosophila melanogaster (Fruit fly)
Taxonomic identifieri7227 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
Proteomesi
  • UP000000803 Componenti: Chromosome X

Organism-specific databases

FlyBaseiFBgn0000635. Fas2.

Subcellular locationi

Isoform 1 :
  • Cell membrane 1 Publication; Single-pass type I membrane protein Sequence analysis
Isoform 2 :
  • Cell membrane 1 Publication; Lipid-anchorGPI-anchor 1 Publication

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini29 – 751ExtracellularSequence analysisAdd BLAST723
Transmembranei752 – 769HelicalSequence analysisAdd BLAST18
Topological domaini770 – 873CytoplasmicSequence analysisAdd BLAST104

GO - Cellular componenti

  • anchored component of membrane Source: UniProtKB-KW
  • axon Source: FlyBase
  • cell projection Source: FlyBase
  • cytoplasm Source: FlyBase
  • cytosol Source: FlyBase
  • integral component of membrane Source: FlyBase
  • muscle cell postsynaptic density Source: FlyBase
  • neuromuscular junction Source: BHF-UCL
  • neuron projection Source: FlyBase
  • plasma membrane Source: UniProtKB
  • postsynaptic membrane Source: FlyBase
  • presynaptic active zone Source: FlyBase
  • presynaptic membrane Source: FlyBase
  • presynaptic periactive zone Source: FlyBase
  • type I terminal bouton Source: BHF-UCL
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 28Sequence analysisAdd BLAST28
ChainiPRO_000001475829 – 873Fasciclin-2Add BLAST845

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi54 ↔ 116PROSITE-ProRule annotation
Glycosylationi74N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi159 ↔ 207PROSITE-ProRule annotation
Glycosylationi250N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi251 ↔ 302PROSITE-ProRule annotation
Glycosylationi330N-linked (GlcNAc...)1 Publication1
Disulfide bondi343 ↔ 407PROSITE-ProRule annotation
Glycosylationi448N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi451 ↔ 504PROSITE-ProRule annotation
Glycosylationi458N-linked (GlcNAc...)Sequence analysis1
Glycosylationi576N-linked (GlcNAc...)1 Publication1
Modified residuei827Phosphoserine1 Publication1
Modified residuei841Phosphothreonine1 Publication1
Modified residuei845Phosphoserine1 Publication1

Keywords - PTMi

Disulfide bond, Glycoprotein, GPI-anchor, Lipoprotein, Phosphoprotein

Proteomic databases

PaxDbiP34082.
PRIDEiP34082.

PTM databases

iPTMnetiP34082.

Expressioni

Tissue specificityi

In embryos, both isoforms are initially expressed on the surface of the axons in the MP1 pathway and later on several other longitudinal axon fascicles.1 Publication

Gene expression databases

BgeeiFBgn0000635.
ExpressionAtlasiP34082. baseline.
GenevisibleiP34082. DM.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
ApplP145993EBI-868243,EBI-74135
Dmel_CG15630Q9VR252EBI-868243,EBI-6897191
Dmel_CG33543Q59E142EBI-868243,EBI-6897236
X11LQ9GQQ62EBI-868243,EBI-2027617

Protein-protein interaction databases

BioGridi57881. 267 interactors.
IntActiP34082. 669 interactors.
STRINGi7227.FBpp0070633.

Structurei

3D structure databases

ProteinModelPortaliP34082.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini31 – 131Ig-like C2-type 1Add BLAST101
Domaini138 – 223Ig-like C2-type 2Add BLAST86
Domaini230 – 318Ig-like C2-type 3Add BLAST89
Domaini323 – 423Ig-like C2-type 4Add BLAST101
Domaini428 – 520Ig-like C2-type 5Add BLAST93
Domaini524 – 622Fibronectin type-III 1PROSITE-ProRule annotationAdd BLAST99
Domaini638 – 738Fibronectin type-III 2PROSITE-ProRule annotationAdd BLAST101

Sequence similaritiesi

Contains 2 fibronectin type-III domains.PROSITE-ProRule annotation

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IQJI. Eukaryota.
ENOG410XTGB. LUCA.
GeneTreeiENSGT00860000133697.
InParanoidiP34082.
KOiK06491.
OrthoDBiEOG091G02K3.
PhylomeDBiP34082.

Family and domain databases

CDDicd00063. FN3. 2 hits.
Gene3Di2.60.40.10. 7 hits.
InterProiIPR003961. FN3_dom.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR009138. Neural_cell_adh.
[Graphical view]
PfamiPF00041. fn3. 2 hits.
PF07679. I-set. 3 hits.
[Graphical view]
PRINTSiPR01838. NCAMFAMILY.
SMARTiSM00060. FN3. 2 hits.
SM00409. IG. 5 hits.
SM00408. IGc2. 5 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 5 hits.
SSF49265. SSF49265. 1 hit.
PROSITEiPS50853. FN3. 2 hits.
PS50835. IG_LIKE. 5 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Experimental confirmation may be lacking for some isoforms.
Isoform 1 (identifier: P34082-1) [UniParc]FASTAAdd to basket
Also known as: A, Membrane-linked

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGELPPNSVG VFLALLLCSC SLIELTRAQS PILEIYPKQE VQRKPVGKPL
60 70 80 90 100
ILTCRPTVPE PSLVADLQWK DNRNNTILPK PNGRNQPPMY TETLPGESLA
110 120 130 140 150
LMITSLSVEM GGKYYCTASY ANTEILEKGV TIKTYVAITW TNAPENQYPT
160 170 180 190 200
LGQDYVVMCE VKADPNPTID WLRNGDPIRT TNDKYVVQTN GLLIRNVQES
210 220 230 240 250
DEGIYTCRAA VIETGELLER TIRVEVFIQP EIISLPTNLE AVEGKPFAAN
260 270 280 290 300
CTARGKPVPE ISWIRDATQL NVATADRFQV NPQTGLVTIS SVSQDDYGTY
310 320 330 340 350
TCLAKNRAGV VDQKTKLNVL VRPQIYELYN VTGARTKEIA ITCRAKGRPA
360 370 380 390 400
PAITFRRWGT QEEYTNGQQD DDPRIILEPN FDEERGESTG TLRISNAERS
410 420 430 440 450
DDGLYQCIAR NKGADAYKTG HITVEFAPDF SHMKELPPVF SWEQRKANLS
460 470 480 490 500
CLAMGIPNAT IEWHWNGRKI KDLYDTNLKI VGTGPRSDLI VHPVTRQYYS
510 520 530 540 550
GYKCIATNIH GTAEHDMQLK EARVPDFVSE AKPSQLTATT MTFDIRGPST
560 570 580 590 600
ELGLPILAYS VQYKEALNPD WSTAYNRSWS PDSPYIVEGL RPQTEYSFRF
610 620 630 640 650
AARNQVGLGN WGVNQQQSTP RRSAPEEPKP LHNPVQHDKE EPVVVSPYSD
660 670 680 690 700
HFELRWGVPA DNGEPIDRYQ IKYCPGVKIS GTWTELENSC NTVEVMETTS
710 720 730 740 750
FEMTQLVGNT YYRIELKAHN AIGYSSPASI IMKTTRGIDV IQVAERQVFS
760 770 780 790 800
SAAIVGIAIG GVLLLLFVVD LLCCITVHMG VMATMCRKAK RSPSEIDDEA
810 820 830 840 850
KLGSGQLVKE PPPSPLPLPP PVKLGGSPMS TPLDEKEPLR TPTGSIKQNS
860 870
TIEFDGRFVH SRSGEIIGKN SAV
Length:873
Mass (Da):96,926
Last modified:February 1, 1994 - v1
Checksum:iE48F0484CCE62AC9
GO
Isoform 2 (identifier: P34082-2) [UniParc]FASTAAdd to basket
Also known as: C, Phosphatidylinositol-linked

The sequence of this isoform differs from the canonical sequence as follows:
     738-811: IDVIQVAERQ...LGSGQLVKEP → ESDSANNNLG...LLSVLASMLA
     812-873: Missing.

Note: GPI-anchored form.
Show »
Length:811
Mass (Da):90,068
Checksum:iFAB06B4D2ECC57B9
GO
Isoform 3 (identifier: P34082-3) [UniParc]FASTAAdd to basket
Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     737-773: GIDVIQVAERQVFSSAAIVGIAIGGVLLLLFVVDLLC → DNPHPSTSGAAPLAQLLVIFTALPTMLLILPPTTHTA
     774-873: Missing.

Show »
Length:773
Mass (Da):86,290
Checksum:iB43E6CCC8E3D7D46
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti804S → R in CAA21826 (PubMed:10731137).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_002506737 – 773GIDVI…VDLLC → DNPHPSTSGAAPLAQLLVIF TALPTMLLILPPTTHTA in isoform 3. CuratedAdd BLAST37
Alternative sequenceiVSP_002508738 – 811IDVIQ…LVKEP → ESDSANNNLGTLLYSAGFNS GVGALHKRLFTTTTTTTATS TTTITSITTATTTIITLATT ISITLLSVLASMLA in isoform 2. 1 PublicationAdd BLAST74
Alternative sequenceiVSP_002507774 – 873Missing in isoform 3. CuratedAdd BLAST100
Alternative sequenceiVSP_002509812 – 873Missing in isoform 2. 1 PublicationAdd BLAST62

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M77165 mRNA. Translation: AAA28527.1.
M77166 mRNA. Translation: AAA28528.1.
AL033125 Genomic DNA. Translation: CAA21825.1.
AE014298 Genomic DNA. Translation: AAF45925.2.
AE014298 Genomic DNA. Translation: AAN09118.1.
AE014298 Genomic DNA. Translation: AAN09119.1.
BT014661 mRNA. Translation: AAT27285.1.
AL033125 Genomic DNA. Translation: CAA21826.1.
PIRiA41054.
B41054.
RefSeqiNP_525066.1. NM_080327.3. [P34082-1]
NP_726911.1. NM_167004.2. [P34082-3]
NP_726912.1. NM_167005.2. [P34082-2]
UniGeneiDm.1687.

Genome annotation databases

EnsemblMetazoaiFBtr0070665; FBpp0070633; FBgn0000635. [P34082-1]
GeneIDi31364.
KEGGidme:Dmel_CG3665.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M77165 mRNA. Translation: AAA28527.1.
M77166 mRNA. Translation: AAA28528.1.
AL033125 Genomic DNA. Translation: CAA21825.1.
AE014298 Genomic DNA. Translation: AAF45925.2.
AE014298 Genomic DNA. Translation: AAN09118.1.
AE014298 Genomic DNA. Translation: AAN09119.1.
BT014661 mRNA. Translation: AAT27285.1.
AL033125 Genomic DNA. Translation: CAA21826.1.
PIRiA41054.
B41054.
RefSeqiNP_525066.1. NM_080327.3. [P34082-1]
NP_726911.1. NM_167004.2. [P34082-3]
NP_726912.1. NM_167005.2. [P34082-2]
UniGeneiDm.1687.

3D structure databases

ProteinModelPortaliP34082.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi57881. 267 interactors.
IntActiP34082. 669 interactors.
STRINGi7227.FBpp0070633.

PTM databases

iPTMnetiP34082.

Proteomic databases

PaxDbiP34082.
PRIDEiP34082.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiFBtr0070665; FBpp0070633; FBgn0000635. [P34082-1]
GeneIDi31364.
KEGGidme:Dmel_CG3665.

Organism-specific databases

CTDi31364.
FlyBaseiFBgn0000635. Fas2.

Phylogenomic databases

eggNOGiENOG410IQJI. Eukaryota.
ENOG410XTGB. LUCA.
GeneTreeiENSGT00860000133697.
InParanoidiP34082.
KOiK06491.
OrthoDBiEOG091G02K3.
PhylomeDBiP34082.

Enzyme and pathway databases

ReactomeiR-DME-375165. NCAM signaling for neurite out-growth.
R-DME-419037. NCAM1 interactions.
R-DME-445144. Signal transduction by L1.
R-DME-5673001. RAF/MAP kinase cascade.

Miscellaneous databases

ChiTaRSiFas2. fly.
GenomeRNAii31364.
PROiP34082.

Gene expression databases

BgeeiFBgn0000635.
ExpressionAtlasiP34082. baseline.
GenevisibleiP34082. DM.

Family and domain databases

CDDicd00063. FN3. 2 hits.
Gene3Di2.60.40.10. 7 hits.
InterProiIPR003961. FN3_dom.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR009138. Neural_cell_adh.
[Graphical view]
PfamiPF00041. fn3. 2 hits.
PF07679. I-set. 3 hits.
[Graphical view]
PRINTSiPR01838. NCAMFAMILY.
SMARTiSM00060. FN3. 2 hits.
SM00409. IG. 5 hits.
SM00408. IGc2. 5 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 5 hits.
SSF49265. SSF49265. 1 hit.
PROSITEiPS50853. FN3. 2 hits.
PS50835. IG_LIKE. 5 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiFAS2_DROME
AccessioniPrimary (citable) accession number: P34082
Secondary accession number(s): P34083
, Q6IDE4, Q8IRS5, Q9W4M6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: February 1, 1994
Last modified: November 30, 2016
This is version 170 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.