P34056 (AP2A_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 122.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Transcription factor AP-2-alpha Short name=AP2-alpha Alternative name(s): AP-2 transcription factor Activating enhancer-binding protein 2-alpha Activator protein 2 Short name=AP-2 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 437 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Sequence-specific DNA-binding protein that interacts with inducible viral and cellular enhancer elements to regulate transcription of selected genes. AP-2 factors bind to the consensus sequence 5'-GCCNNNGGC-3' and activate genes involved in a large spectrum of important biological functions including proper eye, face, body wall, limb and neural tube development. They also suppress a number of genes including MCAM/MUC18, C/EBP alpha and MYC. AP-2-alpha is the only AP-2 protein required for early morphogenesis of the lens vesicle. Together with the CITED2 coactivator, stimulates the PITX2 P1 promoter transcription activation. Associates with chromatin to the PITX2 P1 promoter region. Ref.7 |
| Subunit structure | Binds DNA as a dimer. Can form homodimers or heterodimers with other AP-2 family members. Interacts with WWOX. Interacts with UBE2I. Interacts with RALBP1 in a complex also containing EPN1 and NUMB during interphase and mitosis By similarity. Interacts with CITED4. Interacts with KCTD1; this interaction represses transcription activation. Interacts (via C-terminus) with CITED2 (via C-terminus); the interaction stimulates TFAP2A-transcriptional activation. Interacts (via N-terminus) with EP300 (via N-terminus); the interaction requires CITED2 By similarity. Ref.6 |
| Subcellular location | |
| Developmental stage | Expressed in the embryonic heart. Expressed from embryo day 9.5 to birth. At day 12.5, expressed in the midbrain, hindbrain, spinal cord, sensory ganglia, epidermis, nephric system and limbs. At mid-embryogenesis, isoform 3 is the most abundant form in the nervous system and total embryo, but the least abundant form in the epidermis. In adults, AP-2A is expressed in the eye, skin, kidney, prostate, thymus, skeletal muscle and very weakly, in the brain. Highest expression found in skin and eye. Ref.7 |
| Induction | All isoforms are induced during retinoic acid-mediated differentiation and by cAMP stimulation of primary astrocytes. Isoform 3 is most strongly induced in the former case, isoform 1 in the latter case. |
| Domain | The WW-binding motif mediates interaction with WWOX By similarity. |
| Post-translational modification | Sumoylated on Lys-10; which inhibits transcriptional activity By similarity. |
| Sequence similarities | Belongs to the AP-2 family. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P34056-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P34056-2) The sequence of this isoform differs from the canonical sequence as follows: 16-160: Missing. | ||||||
| Isoform 3 (identifier: P34056-3) The sequence of this isoform differs from the canonical sequence as follows: 1-15: MLWKLTDNIKYEDCE → MLVHSFSAM | ||||||
| Isoform 4 (identifier: P34056-4) The sequence of this isoform differs from the canonical sequence as follows: 1-15: MLWKLTDNIKYEDCE → MNSVVVDTPYFGGLPTLGLWNGFSRVVEALRLISSSPSRLAFFQ |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 437 | 437 | Transcription factor AP-2-alpha | PRO_0000184797 | |||||
Regions | |||||||||
| Region | 280 – 410 | 131 | H-S-H (helix-span-helix), dimerization | ||||||
| Motif | 57 – 62 | 6 | WW-binding | ||||||
| Compositional bias | 29 – 117 | 89 | Gln/Pro-rich (transactivation domain) | ||||||
Amino acid modifications | |||||||||
| Modified residue | 239 | 1 | Phosphoserine; by PKA By similarity | ||||||
| Cross-link | 10 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) By similarity | |||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 15 | 15 | MLWKL…YEDCE → MLVHSFSAM in isoform 3. | VSP_006402 | |||||
| Alternative sequence | 1 – 15 | 15 | MLWKL…YEDCE → MNSVVVDTPYFGGLPTLGLW NGFSRVVEALRLISSSPSRL AFFQ in isoform 4. | VSP_006403 | |||||
| Alternative sequence | 16 – 160 | 145 | Missing in isoform 2. | VSP_006404 | |||||
Experimental info | |||||||||
| Sequence conflict | 38 | 1 | P → S in AAH07471. Ref.2 | ||||||
| Sequence conflict | 139 | 1 | A → G Ref.2 | ||||||
| Sequence conflict | 139 | 1 | A → G Ref.3 | ||||||
| Sequence conflict | 158 – 159 | 2 | DV → RL Ref.4 | ||||||
| Sequence conflict | 390 | 1 | Missing Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The complete murine cDNA sequence of the transcription factor AP-2." Moser M., Pscherer A., Bauer R., Imhof A., Seegers S., Kerscher M., Buettner R. Nucleic Acids Res. 21:4844-4844(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Strain: NIH Swiss. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. |
| [3] | "Alternative mRNAs encode multiple isoforms of transcription factor AP-2 during murine embryogenesis." Meier P., Koedood M., Philipp J., Fontana A., Mitchell P.J. Dev. Biol. 169:1-14(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] OF 1-279, ALTERNATIVE SPLICING. Strain: 129/4 and ICR. Tissue: Embryo. |
| [4] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 158-437. Strain: C57BL/6J. Tissue: Embryonic head. |
| [5] | "Transcription factor AP-2 is expressed in neural crest cell lineages during mouse embryogenesis." Mitchell P.J., Timmons P.M., Hebert J.M., Rigby P.W.J., Tjian R. Genes Dev. 5:105-119(1991) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 259-437. |
| [6] | "Cloning of mouse Cited4, a member of the CITED family p300/CBP-binding transcriptional coactivators: induced expression in mammary epithelial cells." Yahata T., Takedatsu H., Dunwoodie S.L., Braganca J., Swingler T., Withington S.L., Hur J., Coser K.R., Isselbacher K.J., Bhattacharya S., Shioda T. Genomics 80:601-613(2002) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CITED4. |
| [7] | "Cited2 controls left-right patterning and heart development through a Nodal-Pitx2c pathway." Bamforth S.D., Braganca J., Farthing C.R., Schneider J.E., Broadbent C., Michell A.C., Clarke K., Neubauer S., Norris D., Brown N.A., Anderson R.H., Bhattacharya S. Nat. Genet. 36:1189-1196(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, ASSOCIATION WITH CHROMATIN, DEVELOPMENTAL STAGE. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X74216 mRNA. Translation: CAA52292.1. BC018226 mRNA. Translation: AAH18226.1. BC007471 mRNA. Translation: AAH07471.1. U17285 mRNA. Translation: AAA85681.1. U17291, U17289 Genomic DNA. Translation: AAA85678.1. U17286 mRNA. Translation: AAA85682.1. U17287 mRNA. Translation: AAA85683.1. U17291, U17290 Genomic DNA. Translation: AAA85679.1. U17288 mRNA. Translation: AAA85684.1. U17291 Genomic DNA. Translation: AAA85680.1. AK013900 mRNA. Translation: BAB29047.1. X57012 mRNA. Translation: CAA40331.1. |
| IPI | IPI00112753. IPI00226893. IPI00226894. IPI00226897. |
| PIR | S42111. |
| RefSeq | NP_035677.2. NM_011547.3. |
| UniGene | Mm.85544. |
3D structure databases | |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | P34056. |
Proteomic databases | |
| PRIDE | P34056. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000110193; ENSMUSP00000105822; ENSMUSG00000021359. |
| GeneID | 21418. |
| KEGG | mmu:21418. |
| UCSC | uc007qei.1. mouse. uc011yyq.1. mouse. |
Organism-specific databases | |
| CTD | 7020. |
| MGI | MGI:104671. Tfap2a. |
Phylogenomic databases | |
| eggNOG | NOG300693. |
| GeneTree | ENSGT00550000074577. |
| HOVERGEN | HBG002455. |
| InParanoid | P34056. |
| KO | K09176. |
| OrthoDB | EOG4NP73N. |
Gene expression databases | |
| ArrayExpress | P34056. |
| Bgee | P34056. |
| CleanEx | MM_TCFAP2A. |
| Genevestigator | P34056. |
| GermOnline | ENSMUSG00000021359. Mus musculus. |
Family and domain databases | |
| InterPro | IPR004979. TF_AP2. IPR008121. TF_AP2_alpha_N. IPR013854. TF_AP2_C. [Graphical view] |
| PANTHER | PTHR10812. PTHR10812. 1 hit. |
| Pfam | PF03299. TF_AP-2. 1 hit. [Graphical view] |
| PRINTS | PR01749. AP2ATNSCPFCT. PR01748. AP2TNSCPFCT. |
| ProtoNet | Search... |
Other | |
| NextBio | 300724. |
| SOURCE | Search... |
Entry information
| Entry name | AP2A_MOUSE | ||||||||
| Accession | Primary (citable) accession number: P34056 Secondary accession number(s): Q60740 Q9CRY4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
