Reviewed,
UniProtKB/Swiss-Prot P34056 (AP2A_MOUSE)
Last modified
June 16, 2009.
Version 89.
History...
Clusters with 100%,
90%,
50% identity |
Documents (2) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Transcription factor AP-2 alpha Short name=AP2-alpha Alternative name(s): Activating enhancer-binding protein 2 alpha AP-2 transcription factor Activator protein 2 Short name=AP-2 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributes
| Sequence length | 437 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Sequence-specific DNA-binding protein that interacts with inducible viral and cellular enhancer elements to regulate transcription of selected genes. AP-2 factors bind to the consensus sequence 5'-GCCNNNGGC-3' and activate genes involved in a large spectrum of important biological functions including proper eye, face, body wall, limb and neural tube development. They also suppress a number of genes including MCAM/MUC18, C/EBP alpha and MYC. AP-2 alpha is the only AP-2 protein required for early morphogenesis of the lens vesicle. |
| Subunit structure | Binds DNA as a dimer. Can form homodimers or heterodimers with other AP-2 family members. Interacts with WWOX. Interacts with UBE2I. Interacts with RALBP1 in a complex also containing EPN1 and NUMB during interphase and mitosis By similarity. Interacts with CITED4. |
| Subcellular location | |
| Developmental stage | Expressed from embryo day 9.5 to birth. At day 12.5, expressed in the midbrain, hindbrain, spinal cord, sensory ganglia, epidermis, nephric system and limbs. At mid-embryogenesis, isoform 3 is the most abundant form in the nervous system and total embryo, but the least abundant form in the epidermis. In adults, AP-2A is expressed in the eye, skin, kidney, prostate, thymus, skeletal muscle and very weakly, in the brain. Highest expression found in skin and eye. |
| Induction | All isoforms are induced during retinoic acid-mediated differentiation and by cAMP stimulation of primary astrocytes. Isoform 3 is most strongly induced in the former case, isoform 1 in the latter case. |
| Domain | The WW-binding motif mediates interaction with WWOX By similarity. |
| Post-translational modification | Sumoylated on Lys-10; which inhibits transcriptional activity By similarity. |
| Sequence similarities | Belongs to the AP-2 family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transcription Transcription regulation |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing |
| Ligand | DNA-binding |
| Molecular function | Activator |
| PTM | Isopeptide bond Phosphoprotein Ubl conjugation |
| Gene Ontology (GO) | |
| Biological process | anterior neuropore closure Inferred from mutant phenotype. Source: MGI embryonic cranial skeleton morphogenesisInferred from mutant phenotype. Source: MGI regulation of transcription from RNA polymerase II promoterInferred from direct assay. Source: MGI transcriptionInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | transcription factor complex Traceable author statement. Source: MGI |
| Molecular function | protein binding Inferred from physical interaction. Source: MGI transcription factor activityInferred from direct assay. Source: MGI |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P34056-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P34056-2) The sequence of this isoform differs from the canonical sequence as follows: 16-160: Missing. | ||||||
| Isoform 3 (identifier: P34056-3) The sequence of this isoform differs from the canonical sequence as follows: 1-15: MLWKLTDNIKYEDCE → MLVHSFSAM | ||||||
| Isoform 4 (identifier: P34056-4) The sequence of this isoform differs from the canonical sequence as follows: 1-15: MLWKLTDNIKYEDCE → MNSVVVDTPYFGGLPTLGLWNGFSRVVEALRLISSSPSRLAFFQ |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 437 | 437 | Transcription factor AP-2 alpha | PRO_0000184797 | |||||
Regions | |||||||||
| Region | 280 – 410 | 131 | H-S-H (helix-span-helix), dimerization | ||||||
| Motif | 57 – 62 | 6 | WW-binding | ||||||
| Compositional bias | 29 – 117 | 89 | Gln/Pro-rich (transactivation domain) | ||||||
Amino acid modifications | |||||||||
| Modified residue | 225 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 239 | 1 | Phosphoserine; by PKA By similarity | ||||||
| Cross-link | 10 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) By similarity | |||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 15 | 15 | MLWKL…YEDCE → MLVHSFSAM in isoform 3. | VSP_006402 | |||||
| Alternative sequence | 1 – 15 | 15 | MLWKL…YEDCE → MNSVVVDTPYFGGLPTLGLW NGFSRVVEALRLISSSPSRL AFFQ in isoform 4. | VSP_006403 | |||||
| Alternative sequence | 16 – 160 | 145 | Missing in isoform 2. | VSP_006404 | |||||
Experimental info | |||||||||
| Sequence conflict | 38 | 1 | P → S in AAH07471. Ref.2 | ||||||
| Sequence conflict | 139 | 1 | A → G Ref.2 | ||||||
| Sequence conflict | 139 | 1 | A → G Ref.3 | ||||||
| Sequence conflict | 158 – 159 | 2 | DV → RL Ref.4 | ||||||
| Sequence conflict | 390 | 1 | Missing Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The complete murine cDNA sequence of the transcription factor AP-2." Moser M., Pscherer A., Bauer R., Imhof A., Seegers S., Kerscher M., Buettner R. Nucleic Acids Res. 21:4844-4844(1993) [PubMed: 8233835] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Strain: NIH Swiss. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. |
| [3] | "Alternative mRNAs encode multiple isoforms of transcription factor AP-2 during murine embryogenesis." Meier P., Koedood M., Philipp J., Fontana A., Mitchell P.J. Dev. Biol. 169:1-14(1995) [PubMed: 7750631] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] OF 1-279, ALTERNATIVE SPLICING. Strain: 129/4 and ICR. Tissue: Embryo. |
| [4] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 158-437. Strain: C57BL/6J. Tissue: Embryonic head. |
| [5] | "Transcription factor AP-2 is expressed in neural crest cell lineages during mouse embryogenesis." Mitchell P.J., Timmons P.M., Hebert J.M., Rigby P.W.J., Tjian R. Genes Dev. 5:105-119(1991) [PubMed: 1989904] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 259-437. |
| [6] | "Cloning of mouse Cited4, a member of the CITED family p300/CBP-binding transcriptional coactivators: induced expression in mammary epithelial cells." Yahata T., Takedatsu H., Dunwoodie S.L., Braganca J., Swingler T., Withington S.L., Hur J., Coser K.R., Isselbacher K.J., Bhattacharya S., Shioda T. Genomics 80:601-613(2002) [PubMed: 12504852] [Abstract] Cited for: INTERACTION WITH CITED4. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| X74216 mRNA. Translation: CAA52292.1. BC018226 mRNA. Translation: AAH18226.1. BC007471 mRNA. Translation: AAH07471.1. U17285 mRNA. Translation: AAA85681.1. U17291, U17289 Genomic DNA. Translation: AAA85678.1. U17286 mRNA. Translation: AAA85682.1. U17287 mRNA. Translation: AAA85683.1. U17291, U17290 Genomic DNA. Translation: AAA85679.1. U17288 mRNA. Translation: AAA85684.1. U17291 Genomic DNA. Translation: AAA85680.1. AK013900 mRNA. Translation: BAB29047.1. X57012 mRNA. Translation: CAA40331.1. | |
| IPI | IPI00112753. IPI00226893. IPI00226894. IPI00226897. |
| PIR | S42111. |
| UniGene | Mm.85544 |
3D structure databases | |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | P34056. |
Genome annotation databases | |
| Ensembl | ENSMUSG00000021359. Mus musculus. [Contig view] |
Organism-specific databases | |
| MGI | MGI:104671. Tcfap2a. |
Phylogenomic databases | |
| HOVERGEN | P34056. |
Gene expression databases | |
| ArrayExpress | P34056. |
| Bgee | P34056. |
| CleanEx | MM_TCFAP2A. |
| GermOnline | ENSMUSG00000021359. Mus musculus. |
Family and domain databases | |
| InterPro | IPR004979. TF_AP2. IPR008121. TF_AP2_alpha_N. IPR013854. TF_AP2_C. [Graphical view] |
| PANTHER | PTHR10812. TF_AP2. 1 hit. PTHR10812:SF8. TF_AP2_alpha_N. 1 hit. |
| Pfam | PF03299. TF_AP-2. 1 hit. [Graphical view] |
| PRINTS | PR01749. AP2ATNSCPFCT. PR01748. AP2TNSCPFCT. |
| ProtoNet | Search... |
Other Resources | |
| SOURCE | Search... |
Entry information
| Entry name | AP2A_MOUSE | ||||||||
| Accession | Primary (citable) accession number: P34056 Secondary accession number(s): Q60740 Q9CRY4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


