Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P34056

- AP2A_MOUSE

UniProt

P34056 - AP2A_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Transcription factor AP-2-alpha

Gene

Tfap2a

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Sequence-specific DNA-binding protein that interacts with inducible viral and cellular enhancer elements to regulate transcription of selected genes. AP-2 factors bind to the consensus sequence 5'-GCCNNNGGC-3' and activate genes involved in a large spectrum of important biological functions including proper eye, face, body wall, limb and neural tube development. They also suppress a number of genes including MCAM/MUC18, C/EBP alpha and MYC. AP-2-alpha is the only AP-2 protein required for early morphogenesis of the lens vesicle. Together with the CITED2 coactivator, stimulates the PITX2 P1 promoter transcription activation. Associates with chromatin to the PITX2 P1 promoter region.1 Publication

GO - Molecular functioni

  1. chromatin binding Source: UniProtKB
  2. core promoter proximal region sequence-specific DNA binding Source: MGI
  3. RNA polymerase II core promoter proximal region sequence-specific DNA binding Source: UniProtKB
  4. RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity Source: UniProtKB
  5. RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription Source: UniProtKB
  6. RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription Source: UniProtKB
  7. RNA polymerase II core promoter sequence-specific DNA binding Source: MGI
  8. RNA polymerase II distal enhancer sequence-specific DNA binding Source: MGI
  9. RNA polymerase II regulatory region sequence-specific DNA binding Source: NTNU_SB
  10. RNA polymerase II transcription coactivator activity Source: UniProtKB
  11. RNA polymerase II transcription corepressor activity Source: UniProtKB
  12. RNA polymerase II transcription regulatory region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription Source: NTNU_SB
  13. sequence-specific DNA binding transcription factor activity Source: MGI
  14. transcription coactivator activity Source: UniProtKB
  15. transcription regulatory region DNA binding Source: UniProtKB

GO - Biological processi

  1. anterior neuropore closure Source: MGI
  2. basement membrane organization Source: MGI
  3. bone morphogenesis Source: UniProtKB
  4. cellular response to iron ion Source: UniProtKB
  5. cornea development in camera-type eye Source: MGI
  6. embryonic body morphogenesis Source: MGI
  7. embryonic camera-type eye morphogenesis Source: MGI
  8. embryonic cranial skeleton morphogenesis Source: UniProtKB
  9. embryonic forelimb morphogenesis Source: UniProtKB
  10. embryonic pattern specification Source: MGI
  11. epidermis morphogenesis Source: MGI
  12. eyelid development in camera-type eye Source: UniProtKB
  13. face morphogenesis Source: MGI
  14. forebrain neuron development Source: MGI
  15. forelimb morphogenesis Source: MGI
  16. inner ear morphogenesis Source: UniProtKB
  17. keratinocyte development Source: MGI
  18. kidney development Source: UniProtKB
  19. lens induction in camera-type eye Source: MGI
  20. lens morphogenesis in camera-type eye Source: MGI
  21. metanephric nephron development Source: UniProtKB
  22. negative regulation of apoptotic process Source: UniProtKB
  23. negative regulation of cell proliferation Source: MGI
  24. negative regulation of epidermal growth factor receptor signaling pathway Source: MGI
  25. negative regulation of neuron apoptotic process Source: MGI
  26. negative regulation of reactive oxygen species metabolic process Source: UniProtKB
  27. negative regulation of transcription by competitive promoter binding Source: UniProtKB
  28. negative regulation of transcription from RNA polymerase II promoter Source: UniProtKB
  29. nervous system development Source: UniProtKB
  30. neural crest cell development Source: MGI
  31. neural tube closure Source: MGI
  32. oculomotor nerve formation Source: UniProtKB
  33. optic cup structural organization Source: UniProtKB
  34. optic vesicle morphogenesis Source: UniProtKB
  35. outflow tract morphogenesis Source: MGI
  36. palate development Source: UniProtKB
  37. positive regulation of bone mineralization Source: UniProtKB
  38. positive regulation of cell migration Source: MGI
  39. positive regulation of gene expression Source: UniProtKB
  40. positive regulation of neuron apoptotic process Source: Ensembl
  41. positive regulation of tooth mineralization Source: UniProtKB
  42. positive regulation of transcription, DNA-templated Source: UniProtKB
  43. positive regulation of transcription from RNA polymerase II promoter Source: UniProtKB
  44. regulation of neuron differentiation Source: MGI
  45. regulation of transcription, DNA-templated Source: MGI
  46. regulation of transcription from RNA polymerase II promoter Source: MGI
  47. retina layer formation Source: Ensembl
  48. sensory organ development Source: UniProtKB
  49. sensory perception of sound Source: UniProtKB
  50. skeletal system morphogenesis Source: MGI
  51. skin development Source: UniProtKB
  52. sympathetic nervous system development Source: MGI
  53. trigeminal nerve development Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Activator

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Transcription factor AP-2-alpha
Short name:
AP2-alpha
Alternative name(s):
AP-2 transcription factor
Activating enhancer-binding protein 2-alpha
Activator protein 2
Short name:
AP-2
Gene namesi
Name:Tfap2a
Synonyms:Ap2tf, Tcfap2a
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 13

Organism-specific databases

MGIiMGI:104671. Tfap2a.

Subcellular locationi

GO - Cellular componenti

  1. centrosome Source: Ensembl
  2. Golgi apparatus Source: Ensembl
  3. nucleus Source: MGI
  4. transcription factor complex Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 437437Transcription factor AP-2-alphaPRO_0000184797Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Cross-linki10 – 10Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)By similarity
Modified residuei239 – 2391Phosphoserine; by PKABy similarity

Post-translational modificationi

Sumoylated on Lys-10; which inhibits transcriptional activity.By similarity

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQBiP34056.
PRIDEiP34056.

PTM databases

PhosphoSiteiP34056.

Expressioni

Developmental stagei

Expressed in the embryonic heart. Expressed from embryo day 9.5 to birth. At day 12.5, expressed in the midbrain, hindbrain, spinal cord, sensory ganglia, epidermis, nephric system and limbs. At mid-embryogenesis, isoform 3 is the most abundant form in the nervous system and total embryo, but the least abundant form in the epidermis. In adults, AP-2A is expressed in the eye, skin, kidney, prostate, thymus, skeletal muscle and very weakly, in the brain. Highest expression found in skin and eye.1 Publication

Inductioni

All isoforms are induced during retinoic acid-mediated differentiation and by cAMP stimulation of primary astrocytes. Isoform 3 is most strongly induced in the former case, isoform 1 in the latter case.

Gene expression databases

BgeeiP34056.
CleanExiMM_TCFAP2A.
ExpressionAtlasiP34056. baseline and differential.
GenevestigatoriP34056.

Interactioni

Subunit structurei

Binds DNA as a dimer. Can form homodimers or heterodimers with other AP-2 family members. Interacts with WWOX. Interacts with UBE2I. Interacts with RALBP1 in a complex also containing EPN1 and NUMB during interphase and mitosis (By similarity). Interacts with CITED4. Interacts with KCTD1; this interaction represses transcription activation. Interacts (via C-terminus) with CITED2 (via C-terminus); the interaction stimulates TFAP2A-transcriptional activation. Interacts (via N-terminus) with EP300 (via N-terminus); the interaction requires CITED2 (By similarity). Interacts with KCTD15; this interaction inhibits TFAP2A transcriptional activation (By similarity).By similarity

Protein-protein interaction databases

BioGridi204011. 7 interactions.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni280 – 410131H-S-H (helix-span-helix), dimerizationAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi57 – 626WW-binding

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi29 – 11789Gln/Pro-rich (transactivation domain)Add
BLAST

Domaini

The WW-binding motif mediates interaction with WWOX.By similarity

Sequence similaritiesi

Belongs to the AP-2 family.Curated

Phylogenomic databases

eggNOGiNOG300693.
GeneTreeiENSGT00550000074577.
HOVERGENiHBG002455.
InParanoidiP34056.
KOiK09176.
OrthoDBiEOG7HHWS1.
PhylomeDBiP34056.
TreeFamiTF313718.

Family and domain databases

InterProiIPR004979. TF_AP2.
IPR008121. TF_AP2_alpha_N.
IPR013854. TF_AP2_C.
[Graphical view]
PANTHERiPTHR10812. PTHR10812. 1 hit.
PfamiPF03299. TF_AP-2. 1 hit.
[Graphical view]
PRINTSiPR01749. AP2ATNSCPFCT.
PR01748. AP2TNSCPFCT.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P34056-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLWKLTDNIK YEDCEDRHDG TSNGTARLPQ LGTVGQSPYT SAPPLSHTPN
60 70 80 90 100
ADFQPPYFPP PYQPIYPQSQ DPYSHVNDPY SLNPLHAQPQ PQHPGWPGQR
110 120 130 140 150
QSQESGLLHT HRGLPHQLSG LDPRRDYRRH EDLLHGPHAL GSGLGDLPIH
160 170 180 190 200
SLPHAIEDVP HVEDPGINIP DQTVIKKGPV SLSKSNSNAV SAIPINKDNL
210 220 230 240 250
FGGVVNPNEV FCSVPGRLSL LSSTSKYKVT VAEVQRRLSP PECLNASLLG
260 270 280 290 300
GVLRRAKSKN GGRSLREKLD KIGLNLPAGR RKAANVTLLT SLVEGEAVHL
310 320 330 340 350
ARDFGYVCET EFPAKAVAEF LNRQHSDPNE QVARKNMLLA TKQICKEFTD
360 370 380 390 400
LLAQDRSPLG NSRPNPILEP GIQSCLTHFN LISHGFGSPA VCAAVTALQN
410 420 430
YLTEALKAMD KMYLSNNPNS HTDNSAKSSD KEEKHRK
Length:437
Mass (Da):47,971
Last modified:November 1, 1995 - v2
Checksum:i901F456EE07AE69C
GO
Isoform 2 (identifier: P34056-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     16-160: Missing.

Show »
Length:292
Mass (Da):31,960
Checksum:i6E9B01E97186E4E1
GO
Isoform 3 (identifier: P34056-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-15: MLWKLTDNIKYEDCE → MLVHSFSAM

Show »
Length:431
Mass (Da):47,092
Checksum:i7CA39A800983538C
GO
Isoform 4 (identifier: P34056-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-15: MLWKLTDNIKYEDCE → MNSVVVDTPYFGGLPTLGLWNGFSRVVEALRLISSSPSRLAFFQ

Show »
Length:466
Mass (Da):50,900
Checksum:i49A69CBE5826B8BB
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti38 – 381P → S in AAH07471. (PubMed:15489334)Curated
Sequence conflicti139 – 1391A → G(PubMed:15489334)Curated
Sequence conflicti139 – 1391A → G(PubMed:7750631)Curated
Sequence conflicti158 – 1592DV → RL(PubMed:16141072)Curated
Sequence conflicti390 – 3901Missing(PubMed:1989904)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 1515MLWKL…YEDCE → MLVHSFSAM in isoform 3. CuratedVSP_006402Add
BLAST
Alternative sequencei1 – 1515MLWKL…YEDCE → MNSVVVDTPYFGGLPTLGLW NGFSRVVEALRLISSSPSRL AFFQ in isoform 4. CuratedVSP_006403Add
BLAST
Alternative sequencei16 – 160145Missing in isoform 2. CuratedVSP_006404Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X74216 mRNA. Translation: CAA52292.1.
BC018226 mRNA. Translation: AAH18226.1.
BC007471 mRNA. Translation: AAH07471.1.
U17285 mRNA. Translation: AAA85681.1.
U17291, U17289 Genomic DNA. Translation: AAA85678.1.
U17286 mRNA. Translation: AAA85682.1.
U17287 mRNA. Translation: AAA85683.1.
U17291, U17290 Genomic DNA. Translation: AAA85679.1.
U17288 mRNA. Translation: AAA85684.1.
U17291 Genomic DNA. Translation: AAA85680.1.
AK013900 mRNA. Translation: BAB29047.1.
X57012 mRNA. Translation: CAA40331.1.
CCDSiCCDS26467.1. [P34056-1]
CCDS49243.1. [P34056-3]
PIRiS42111.
RefSeqiNP_001288603.1. NM_001301674.1.
NP_035677.2. NM_011547.4.
UniGeneiMm.85544.

Genome annotation databases

EnsembliENSMUST00000110193; ENSMUSP00000105822; ENSMUSG00000021359.
GeneIDi21418.
KEGGimmu:21418.
UCSCiuc007qei.1. mouse. [P34056-4]
uc011yyq.1. mouse. [P34056-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X74216 mRNA. Translation: CAA52292.1 .
BC018226 mRNA. Translation: AAH18226.1 .
BC007471 mRNA. Translation: AAH07471.1 .
U17285 mRNA. Translation: AAA85681.1 .
U17291 , U17289 Genomic DNA. Translation: AAA85678.1 .
U17286 mRNA. Translation: AAA85682.1 .
U17287 mRNA. Translation: AAA85683.1 .
U17291 , U17290 Genomic DNA. Translation: AAA85679.1 .
U17288 mRNA. Translation: AAA85684.1 .
U17291 Genomic DNA. Translation: AAA85680.1 .
AK013900 mRNA. Translation: BAB29047.1 .
X57012 mRNA. Translation: CAA40331.1 .
CCDSi CCDS26467.1. [P34056-1 ]
CCDS49243.1. [P34056-3 ]
PIRi S42111.
RefSeqi NP_001288603.1. NM_001301674.1.
NP_035677.2. NM_011547.4.
UniGenei Mm.85544.

3D structure databases

ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 204011. 7 interactions.

PTM databases

PhosphoSitei P34056.

Proteomic databases

MaxQBi P34056.
PRIDEi P34056.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000110193 ; ENSMUSP00000105822 ; ENSMUSG00000021359 .
GeneIDi 21418.
KEGGi mmu:21418.
UCSCi uc007qei.1. mouse. [P34056-4 ]
uc011yyq.1. mouse. [P34056-2 ]

Organism-specific databases

CTDi 7020.
MGIi MGI:104671. Tfap2a.

Phylogenomic databases

eggNOGi NOG300693.
GeneTreei ENSGT00550000074577.
HOVERGENi HBG002455.
InParanoidi P34056.
KOi K09176.
OrthoDBi EOG7HHWS1.
PhylomeDBi P34056.
TreeFami TF313718.

Miscellaneous databases

NextBioi 300724.
PROi P34056.
SOURCEi Search...

Gene expression databases

Bgeei P34056.
CleanExi MM_TCFAP2A.
ExpressionAtlasi P34056. baseline and differential.
Genevestigatori P34056.

Family and domain databases

InterProi IPR004979. TF_AP2.
IPR008121. TF_AP2_alpha_N.
IPR013854. TF_AP2_C.
[Graphical view ]
PANTHERi PTHR10812. PTHR10812. 1 hit.
Pfami PF03299. TF_AP-2. 1 hit.
[Graphical view ]
PRINTSi PR01749. AP2ATNSCPFCT.
PR01748. AP2TNSCPFCT.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The complete murine cDNA sequence of the transcription factor AP-2."
    Moser M., Pscherer A., Bauer R., Imhof A., Seegers S., Kerscher M., Buettner R.
    Nucleic Acids Res. 21:4844-4844(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA].
    Strain: NIH Swiss.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
  3. "Alternative mRNAs encode multiple isoforms of transcription factor AP-2 during murine embryogenesis."
    Meier P., Koedood M., Philipp J., Fontana A., Mitchell P.J.
    Dev. Biol. 169:1-14(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] OF 1-279, ALTERNATIVE SPLICING.
    Strain: 129/4 and ICR.
    Tissue: Embryo.
  4. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 158-437.
    Strain: C57BL/6J.
    Tissue: Embryonic head.
  5. "Transcription factor AP-2 is expressed in neural crest cell lineages during mouse embryogenesis."
    Mitchell P.J., Timmons P.M., Hebert J.M., Rigby P.W.J., Tjian R.
    Genes Dev. 5:105-119(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 259-437.
  6. "Cloning of mouse Cited4, a member of the CITED family p300/CBP-binding transcriptional coactivators: induced expression in mammary epithelial cells."
    Yahata T., Takedatsu H., Dunwoodie S.L., Braganca J., Swingler T., Withington S.L., Hur J., Coser K.R., Isselbacher K.J., Bhattacharya S., Shioda T.
    Genomics 80:601-613(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH CITED4.
  7. Cited for: FUNCTION, ASSOCIATION WITH CHROMATIN, DEVELOPMENTAL STAGE.

Entry informationi

Entry nameiAP2A_MOUSE
AccessioniPrimary (citable) accession number: P34056
Secondary accession number(s): Q60740
, Q60741, Q60742, Q60743, Q62067, Q62068, Q62069, Q91VX0, Q9CRY4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: November 1, 1995
Last modified: November 26, 2014
This is version 136 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3