Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P34056

- AP2A_MOUSE

UniProt

P34056 - AP2A_MOUSE

Protein

Transcription factor AP-2-alpha

Gene

Tfap2a

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 134 (01 Oct 2014)
      Sequence version 2 (01 Nov 1995)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Sequence-specific DNA-binding protein that interacts with inducible viral and cellular enhancer elements to regulate transcription of selected genes. AP-2 factors bind to the consensus sequence 5'-GCCNNNGGC-3' and activate genes involved in a large spectrum of important biological functions including proper eye, face, body wall, limb and neural tube development. They also suppress a number of genes including MCAM/MUC18, C/EBP alpha and MYC. AP-2-alpha is the only AP-2 protein required for early morphogenesis of the lens vesicle. Together with the CITED2 coactivator, stimulates the PITX2 P1 promoter transcription activation. Associates with chromatin to the PITX2 P1 promoter region.1 Publication

    GO - Molecular functioni

    1. chromatin binding Source: UniProtKB
    2. core promoter proximal region sequence-specific DNA binding Source: MGI
    3. protein binding Source: MGI
    4. RNA polymerase II core promoter proximal region sequence-specific DNA binding Source: UniProtKB
    5. RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity Source: UniProtKB
    6. RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription Source: UniProtKB
    7. RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription Source: UniProtKB
    8. RNA polymerase II core promoter sequence-specific DNA binding Source: MGI
    9. RNA polymerase II distal enhancer sequence-specific DNA binding Source: MGI
    10. RNA polymerase II regulatory region sequence-specific DNA binding Source: NTNU_SB
    11. RNA polymerase II transcription coactivator activity Source: UniProtKB
    12. RNA polymerase II transcription corepressor activity Source: UniProtKB
    13. RNA polymerase II transcription regulatory region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription Source: NTNU_SB
    14. sequence-specific DNA binding transcription factor activity Source: MGI
    15. transcription coactivator activity Source: UniProtKB
    16. transcription regulatory region DNA binding Source: UniProtKB

    GO - Biological processi

    1. anterior neuropore closure Source: MGI
    2. basement membrane organization Source: MGI
    3. bone morphogenesis Source: UniProtKB
    4. cellular response to iron ion Source: UniProtKB
    5. cornea development in camera-type eye Source: MGI
    6. embryonic body morphogenesis Source: MGI
    7. embryonic camera-type eye morphogenesis Source: MGI
    8. embryonic cranial skeleton morphogenesis Source: UniProtKB
    9. embryonic forelimb morphogenesis Source: UniProtKB
    10. embryonic pattern specification Source: MGI
    11. epidermis morphogenesis Source: MGI
    12. eyelid development in camera-type eye Source: UniProtKB
    13. face morphogenesis Source: MGI
    14. forebrain neuron development Source: MGI
    15. forelimb morphogenesis Source: MGI
    16. inner ear morphogenesis Source: UniProtKB
    17. keratinocyte development Source: MGI
    18. kidney development Source: UniProtKB
    19. lens induction in camera-type eye Source: MGI
    20. lens morphogenesis in camera-type eye Source: MGI
    21. metanephric nephron development Source: UniProtKB
    22. negative regulation of apoptotic process Source: UniProtKB
    23. negative regulation of cell proliferation Source: MGI
    24. negative regulation of epidermal growth factor receptor signaling pathway Source: MGI
    25. negative regulation of neuron apoptotic process Source: MGI
    26. negative regulation of reactive oxygen species metabolic process Source: UniProtKB
    27. negative regulation of transcription by competitive promoter binding Source: UniProtKB
    28. negative regulation of transcription from RNA polymerase II promoter Source: UniProtKB
    29. nervous system development Source: UniProtKB
    30. neural crest cell development Source: MGI
    31. neural tube closure Source: MGI
    32. oculomotor nerve formation Source: UniProtKB
    33. optic cup structural organization Source: UniProtKB
    34. optic vesicle morphogenesis Source: UniProtKB
    35. outflow tract morphogenesis Source: MGI
    36. palate development Source: UniProtKB
    37. positive regulation of bone mineralization Source: UniProtKB
    38. positive regulation of cell migration Source: MGI
    39. positive regulation of gene expression Source: UniProtKB
    40. positive regulation of neuron apoptotic process Source: Ensembl
    41. positive regulation of tooth mineralization Source: UniProtKB
    42. positive regulation of transcription, DNA-templated Source: UniProtKB
    43. positive regulation of transcription from RNA polymerase II promoter Source: UniProtKB
    44. regulation of neuron differentiation Source: MGI
    45. regulation of transcription, DNA-templated Source: MGI
    46. regulation of transcription from RNA polymerase II promoter Source: MGI
    47. retina layer formation Source: Ensembl
    48. sensory organ development Source: UniProtKB
    49. sensory perception of sound Source: UniProtKB
    50. skeletal system morphogenesis Source: MGI
    51. skin development Source: UniProtKB
    52. sympathetic nervous system development Source: MGI
    53. trigeminal nerve development Source: UniProtKB

    Keywords - Molecular functioni

    Activator

    Keywords - Biological processi

    Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Transcription factor AP-2-alpha
    Short name:
    AP2-alpha
    Alternative name(s):
    AP-2 transcription factor
    Activating enhancer-binding protein 2-alpha
    Activator protein 2
    Short name:
    AP-2
    Gene namesi
    Name:Tfap2a
    Synonyms:Ap2tf, Tcfap2a
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 13

    Organism-specific databases

    MGIiMGI:104671. Tfap2a.

    Subcellular locationi

    GO - Cellular componenti

    1. centrosome Source: Ensembl
    2. Golgi apparatus Source: Ensembl
    3. nucleus Source: MGI
    4. transcription factor complex Source: MGI

    Keywords - Cellular componenti

    Nucleus

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 437437Transcription factor AP-2-alphaPRO_0000184797Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Cross-linki10 – 10Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)By similarity
    Modified residuei239 – 2391Phosphoserine; by PKABy similarity

    Post-translational modificationi

    Sumoylated on Lys-10; which inhibits transcriptional activity.By similarity

    Keywords - PTMi

    Isopeptide bond, Phosphoprotein, Ubl conjugation

    Proteomic databases

    MaxQBiP34056.
    PRIDEiP34056.

    PTM databases

    PhosphoSiteiP34056.

    Expressioni

    Developmental stagei

    Expressed in the embryonic heart. Expressed from embryo day 9.5 to birth. At day 12.5, expressed in the midbrain, hindbrain, spinal cord, sensory ganglia, epidermis, nephric system and limbs. At mid-embryogenesis, isoform 3 is the most abundant form in the nervous system and total embryo, but the least abundant form in the epidermis. In adults, AP-2A is expressed in the eye, skin, kidney, prostate, thymus, skeletal muscle and very weakly, in the brain. Highest expression found in skin and eye.1 Publication

    Inductioni

    All isoforms are induced during retinoic acid-mediated differentiation and by cAMP stimulation of primary astrocytes. Isoform 3 is most strongly induced in the former case, isoform 1 in the latter case.

    Gene expression databases

    BgeeiP34056.
    CleanExiMM_TCFAP2A.
    GenevestigatoriP34056.

    Interactioni

    Subunit structurei

    Binds DNA as a dimer. Can form homodimers or heterodimers with other AP-2 family members. Interacts with WWOX. Interacts with UBE2I. Interacts with RALBP1 in a complex also containing EPN1 and NUMB during interphase and mitosis By similarity. Interacts with CITED4. Interacts with KCTD1; this interaction represses transcription activation. Interacts (via C-terminus) with CITED2 (via C-terminus); the interaction stimulates TFAP2A-transcriptional activation. Interacts (via N-terminus) with EP300 (via N-terminus); the interaction requires CITED2 By similarity. Interacts with KCTD15; this interaction inhibits TFAP2A transcriptional activation By similarity.By similarity

    Protein-protein interaction databases

    BioGridi204011. 7 interactions.

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni280 – 410131H-S-H (helix-span-helix), dimerizationAdd
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi57 – 626WW-binding

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi29 – 11789Gln/Pro-rich (transactivation domain)Add
    BLAST

    Domaini

    The WW-binding motif mediates interaction with WWOX.By similarity

    Sequence similaritiesi

    Belongs to the AP-2 family.Curated

    Phylogenomic databases

    eggNOGiNOG300693.
    GeneTreeiENSGT00550000074577.
    HOVERGENiHBG002455.
    InParanoidiP34056.
    KOiK09176.
    OrthoDBiEOG7HHWS1.
    PhylomeDBiP34056.
    TreeFamiTF313718.

    Family and domain databases

    InterProiIPR004979. TF_AP2.
    IPR008121. TF_AP2_alpha_N.
    IPR013854. TF_AP2_C.
    [Graphical view]
    PANTHERiPTHR10812. PTHR10812. 1 hit.
    PfamiPF03299. TF_AP-2. 1 hit.
    [Graphical view]
    PRINTSiPR01749. AP2ATNSCPFCT.
    PR01748. AP2TNSCPFCT.

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P34056-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MLWKLTDNIK YEDCEDRHDG TSNGTARLPQ LGTVGQSPYT SAPPLSHTPN    50
    ADFQPPYFPP PYQPIYPQSQ DPYSHVNDPY SLNPLHAQPQ PQHPGWPGQR 100
    QSQESGLLHT HRGLPHQLSG LDPRRDYRRH EDLLHGPHAL GSGLGDLPIH 150
    SLPHAIEDVP HVEDPGINIP DQTVIKKGPV SLSKSNSNAV SAIPINKDNL 200
    FGGVVNPNEV FCSVPGRLSL LSSTSKYKVT VAEVQRRLSP PECLNASLLG 250
    GVLRRAKSKN GGRSLREKLD KIGLNLPAGR RKAANVTLLT SLVEGEAVHL 300
    ARDFGYVCET EFPAKAVAEF LNRQHSDPNE QVARKNMLLA TKQICKEFTD 350
    LLAQDRSPLG NSRPNPILEP GIQSCLTHFN LISHGFGSPA VCAAVTALQN 400
    YLTEALKAMD KMYLSNNPNS HTDNSAKSSD KEEKHRK 437
    Length:437
    Mass (Da):47,971
    Last modified:November 1, 1995 - v2
    Checksum:i901F456EE07AE69C
    GO
    Isoform 2 (identifier: P34056-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         16-160: Missing.

    Show »
    Length:292
    Mass (Da):31,960
    Checksum:i6E9B01E97186E4E1
    GO
    Isoform 3 (identifier: P34056-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-15: MLWKLTDNIKYEDCE → MLVHSFSAM

    Show »
    Length:431
    Mass (Da):47,092
    Checksum:i7CA39A800983538C
    GO
    Isoform 4 (identifier: P34056-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-15: MLWKLTDNIKYEDCE → MNSVVVDTPYFGGLPTLGLWNGFSRVVEALRLISSSPSRLAFFQ

    Show »
    Length:466
    Mass (Da):50,900
    Checksum:i49A69CBE5826B8BB
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti38 – 381P → S in AAH07471. (PubMed:15489334)Curated
    Sequence conflicti139 – 1391A → G(PubMed:15489334)Curated
    Sequence conflicti139 – 1391A → G(PubMed:7750631)Curated
    Sequence conflicti158 – 1592DV → RL(PubMed:16141072)Curated
    Sequence conflicti390 – 3901Missing(PubMed:1989904)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 1515MLWKL…YEDCE → MLVHSFSAM in isoform 3. CuratedVSP_006402Add
    BLAST
    Alternative sequencei1 – 1515MLWKL…YEDCE → MNSVVVDTPYFGGLPTLGLW NGFSRVVEALRLISSSPSRL AFFQ in isoform 4. CuratedVSP_006403Add
    BLAST
    Alternative sequencei16 – 160145Missing in isoform 2. CuratedVSP_006404Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X74216 mRNA. Translation: CAA52292.1.
    BC018226 mRNA. Translation: AAH18226.1.
    BC007471 mRNA. Translation: AAH07471.1.
    U17285 mRNA. Translation: AAA85681.1.
    U17291, U17289 Genomic DNA. Translation: AAA85678.1.
    U17286 mRNA. Translation: AAA85682.1.
    U17287 mRNA. Translation: AAA85683.1.
    U17291, U17290 Genomic DNA. Translation: AAA85679.1.
    U17288 mRNA. Translation: AAA85684.1.
    U17291 Genomic DNA. Translation: AAA85680.1.
    AK013900 mRNA. Translation: BAB29047.1.
    X57012 mRNA. Translation: CAA40331.1.
    CCDSiCCDS26467.1. [P34056-1]
    CCDS49243.1. [P34056-3]
    PIRiS42111.
    RefSeqiNP_035677.2. NM_011547.3.
    UniGeneiMm.85544.

    Genome annotation databases

    EnsembliENSMUST00000110193; ENSMUSP00000105822; ENSMUSG00000021359.
    GeneIDi21418.
    KEGGimmu:21418.
    UCSCiuc007qei.1. mouse. [P34056-4]
    uc011yyq.1. mouse. [P34056-2]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X74216 mRNA. Translation: CAA52292.1 .
    BC018226 mRNA. Translation: AAH18226.1 .
    BC007471 mRNA. Translation: AAH07471.1 .
    U17285 mRNA. Translation: AAA85681.1 .
    U17291 , U17289 Genomic DNA. Translation: AAA85678.1 .
    U17286 mRNA. Translation: AAA85682.1 .
    U17287 mRNA. Translation: AAA85683.1 .
    U17291 , U17290 Genomic DNA. Translation: AAA85679.1 .
    U17288 mRNA. Translation: AAA85684.1 .
    U17291 Genomic DNA. Translation: AAA85680.1 .
    AK013900 mRNA. Translation: BAB29047.1 .
    X57012 mRNA. Translation: CAA40331.1 .
    CCDSi CCDS26467.1. [P34056-1 ]
    CCDS49243.1. [P34056-3 ]
    PIRi S42111.
    RefSeqi NP_035677.2. NM_011547.3.
    UniGenei Mm.85544.

    3D structure databases

    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 204011. 7 interactions.

    PTM databases

    PhosphoSitei P34056.

    Proteomic databases

    MaxQBi P34056.
    PRIDEi P34056.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000110193 ; ENSMUSP00000105822 ; ENSMUSG00000021359 .
    GeneIDi 21418.
    KEGGi mmu:21418.
    UCSCi uc007qei.1. mouse. [P34056-4 ]
    uc011yyq.1. mouse. [P34056-2 ]

    Organism-specific databases

    CTDi 7020.
    MGIi MGI:104671. Tfap2a.

    Phylogenomic databases

    eggNOGi NOG300693.
    GeneTreei ENSGT00550000074577.
    HOVERGENi HBG002455.
    InParanoidi P34056.
    KOi K09176.
    OrthoDBi EOG7HHWS1.
    PhylomeDBi P34056.
    TreeFami TF313718.

    Miscellaneous databases

    NextBioi 300724.
    PROi P34056.
    SOURCEi Search...

    Gene expression databases

    Bgeei P34056.
    CleanExi MM_TCFAP2A.
    Genevestigatori P34056.

    Family and domain databases

    InterProi IPR004979. TF_AP2.
    IPR008121. TF_AP2_alpha_N.
    IPR013854. TF_AP2_C.
    [Graphical view ]
    PANTHERi PTHR10812. PTHR10812. 1 hit.
    Pfami PF03299. TF_AP-2. 1 hit.
    [Graphical view ]
    PRINTSi PR01749. AP2ATNSCPFCT.
    PR01748. AP2TNSCPFCT.
    ProtoNeti Search...

    Publicationsi

    1. "The complete murine cDNA sequence of the transcription factor AP-2."
      Moser M., Pscherer A., Bauer R., Imhof A., Seegers S., Kerscher M., Buettner R.
      Nucleic Acids Res. 21:4844-4844(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA].
      Strain: NIH Swiss.
    2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
    3. "Alternative mRNAs encode multiple isoforms of transcription factor AP-2 during murine embryogenesis."
      Meier P., Koedood M., Philipp J., Fontana A., Mitchell P.J.
      Dev. Biol. 169:1-14(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] OF 1-279, ALTERNATIVE SPLICING.
      Strain: 129/4 and ICR.
      Tissue: Embryo.
    4. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 158-437.
      Strain: C57BL/6J.
      Tissue: Embryonic head.
    5. "Transcription factor AP-2 is expressed in neural crest cell lineages during mouse embryogenesis."
      Mitchell P.J., Timmons P.M., Hebert J.M., Rigby P.W.J., Tjian R.
      Genes Dev. 5:105-119(1991) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 259-437.
    6. "Cloning of mouse Cited4, a member of the CITED family p300/CBP-binding transcriptional coactivators: induced expression in mammary epithelial cells."
      Yahata T., Takedatsu H., Dunwoodie S.L., Braganca J., Swingler T., Withington S.L., Hur J., Coser K.R., Isselbacher K.J., Bhattacharya S., Shioda T.
      Genomics 80:601-613(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH CITED4.
    7. Cited for: FUNCTION, ASSOCIATION WITH CHROMATIN, DEVELOPMENTAL STAGE.

    Entry informationi

    Entry nameiAP2A_MOUSE
    AccessioniPrimary (citable) accession number: P34056
    Secondary accession number(s): Q60740
    , Q60741, Q60742, Q60743, Q62067, Q62068, Q62069, Q91VX0, Q9CRY4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 1, 1994
    Last sequence update: November 1, 1995
    Last modified: October 1, 2014
    This is version 134 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3