Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P33681 (CD80_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 150. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
T-lymphocyte activation antigen CD80
Alternative name(s):
Activation B7-1 antigen
BB1
CTLA-4 counter-receptor B7.1
Short name=B7
CD_antigen=CD80
Gene names
Name:CD80
Synonyms:CD28LG, CD28LG1, LAB7
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length288 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Involved in the costimulatory signal essential for T-lymphocyte activation. T-cell proliferation and cytokine production is induced by the binding of CD28, binding to CTLA-4 has opposite effects and inhibits T-cell activation. Ref.8

Subunit structure

Homodimer; CD80 dimers on the antigen presenting cells (APCs) bridge CTLA4/CD152 dimers on T-cells in a periodic zipper-like arrangement. Interacts with adenovirus subgroup B fiber proteins and acts as a receptor for these viruses. Ref.8 Ref.9 Ref.11

Subcellular location

Membrane; Single-pass type I membrane protein.

Tissue specificity

Expressed on activated B-cells, macrophages and dendritic cells.

Sequence similarities

Contains 1 Ig-like C2-type (immunoglobulin-like) domain.

Contains 1 Ig-like V-type (immunoglobulin-like) domain.

Ontologies

Keywords
   Biological processHost-virus interaction
   Cellular componentMembrane
   Coding sequence diversityAlternative splicing
   DomainImmunoglobulin domain
Signal
Transmembrane
Transmembrane helix
   Molecular functionReceptor
   PTMDisulfide bond
Glycoprotein
   Technical term3D-structure
Complete proteome
Direct protein sequencing
Reference proteome
Gene Ontology (GO)
   Biological_processFc-epsilon receptor signaling pathway

Traceable author statement. Source: Reactome

T cell activation

Inferred by curator PubMed 9915850. Source: UniProtKB

T cell costimulation

Traceable author statement. Source: Reactome

cell-cell signaling

Inferred by curator PubMed 9915850. Source: UniProtKB

epidermal growth factor receptor signaling pathway

Traceable author statement. Source: Reactome

fibroblast growth factor receptor signaling pathway

Traceable author statement. Source: Reactome

innate immune response

Traceable author statement. Source: Reactome

intracellular signal transduction

Non-traceable author statement PubMed 9915850. Source: UniProtKB

neurotrophin TRK receptor signaling pathway

Traceable author statement. Source: Reactome

phosphatidylinositol-mediated signaling

Traceable author statement. Source: Reactome

positive regulation of T-helper 1 cell differentiation

Non-traceable author statement PubMed 9915850. Source: UniProtKB

positive regulation of alpha-beta T cell proliferation

Inferred from electronic annotation. Source: Ensembl

positive regulation of granulocyte macrophage colony-stimulating factor biosynthetic process

Non-traceable author statement PubMed 9915850. Source: UniProtKB

positive regulation of interleukin-2 biosynthetic process

Non-traceable author statement PubMed 9915850. Source: UniProtKB

positive regulation of peptidyl-tyrosine phosphorylation

Inferred from direct assay PubMed 9915850. Source: UniProtKB

positive regulation of signal transduction

Non-traceable author statement PubMed 9915850. Source: UniProtKB

positive regulation of transcription, DNA-templated

Non-traceable author statement PubMed 9915850. Source: UniProtKB

viral process

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentexternal side of plasma membrane

Inferred from electronic annotation. Source: Ensembl

integral component of membrane

Inferred by curator PubMed 9915850. Source: UniProtKB

plasma membrane

Traceable author statement. Source: Reactome

   Molecular_functioncoreceptor activity

Non-traceable author statement PubMed 9915850. Source: UniProtKB

protein binding

Inferred from physical interaction PubMed 9915850. Source: UniProtKB

Complete GO annotation...

Binary interactions

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: P33681-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: P33681-2)

Also known as: s1CD80;

The sequence of this isoform differs from the canonical sequence as follows:
     234-266: TKQEHFPDNLLPSWAITLISVNGIFVICCLTYC → S
Note: Soluble isoform. Expressed in unstimulated B-cells and monocytes, but not T-cells.
Isoform 3 (identifier: P33681-3)

Also known as: s2CD80;

The sequence of this isoform differs from the canonical sequence as follows:
     140-140: A → G
     141-266: Missing.
Note: Soluble isoform. Expressed in T-cells activated by ConA, non-activated monocytes and monocytes activated with IFN-c.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 3434 Ref.6
Chain35 – 288254T-lymphocyte activation antigen CD80
PRO_0000014547

Regions

Topological domain35 – 242208Extracellular Potential
Transmembrane243 – 26321Helical; Potential
Topological domain264 – 28825Cytoplasmic Potential
Domain35 – 135101Ig-like V-type
Domain145 – 23086Ig-like C2-type

Amino acid modifications

Glycosylation531N-linked (GlcNAc...) Ref.11
Glycosylation891N-linked (GlcNAc...) Ref.11
Glycosylation981N-linked (GlcNAc...) Potential
Glycosylation1861N-linked (GlcNAc...) Ref.11
Glycosylation2071N-linked (GlcNAc...) Ref.11
Glycosylation2111N-linked (GlcNAc...) Potential
Glycosylation2261N-linked (GlcNAc...) Ref.11
Glycosylation2321N-linked (GlcNAc...) Potential
Disulfide bond50 ↔ 116 Ref.11
Disulfide bond162 ↔ 216 Ref.11

Natural variations

Alternative sequence1401A → G in isoform 3.
VSP_047698
Alternative sequence141 – 266126Missing in isoform 3.
VSP_047699
Alternative sequence234 – 26633TKQEH…CLTYC → S in isoform 2.
VSP_047700

Secondary structure

......................................... 288
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified February 1, 1994. Version 1.
Checksum: BA453EE34528B1F4

FASTA28833,048
        10         20         30         40         50         60 
MGHTRRQGTS PSKCPYLNFF QLLVLAGLSH FCSGVIHVTK EVKEVATLSC GHNVSVEELA 

        70         80         90        100        110        120 
QTRIYWQKEK KMVLTMMSGD MNIWPEYKNR TIFDITNNLS IVILALRPSD EGTYECVVLK 

       130        140        150        160        170        180 
YEKDAFKREH LAEVTLSVKA DFPTPSISDF EIPTSNIRRI ICSTSGGFPE PHLSWLENGE 

       190        200        210        220        230        240 
ELNAINTTVS QDPETELYAV SSKLDFNMTT NHSFMCLIKY GHLRVNQTFN WNTTKQEHFP 

       250        260        270        280 
DNLLPSWAIT LISVNGIFVI CCLTYCFAPR CRERRRNERL RRESVRPV 

« Hide

Isoform 2 (s1CD80) [UniParc].

Checksum: DEB0A9FBA7B7D9A4
Show »

FASTA25629,413
Isoform 3 (s2CD80) [UniParc].

Checksum: 24DBC2D5BD70C4FA
Show »

FASTA16218,761

References

« Hide 'large scale' references
[1]"B7, a new member of the Ig superfamily with unique expression on activated and neoplastic B cells."
Freeman G.J., Freedman A.S., Segil J.M., Lee G., Whitman J.F., Nadler L.M.
J. Immunol. 143:2714-2722(1989) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Lymphoid tissue.
[2]"Genomic organization and chromosomal location of the human gene encoding the B-lymphocyte activation antigen B7."
Selvakumar A., Mohanraj B.K., Eddy R.L., Shows T.B., White P.C., Dupont B.
Immunogenetics 36:175-181(1992) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
[3]"Human Soluble CD80 is generated by alternative splicing, and recombinant soluble CD80 binds to CD28 and CD152 influencing T-cell activation."
Kakoulidou M., Giscombe R., Zhao X., Lefvert A.K., Wang X.
Scand. J. Immunol. 66:529-537(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), ALTERNATIVE SPLICING.
[4]"The DNA sequence, annotation and analysis of human chromosome 3."
Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J. expand/collapse author list , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain.
[6]"Structure, expression, and T cell costimulatory activity of the murine homologue of the human B lymphocyte activation antigen B7."
Freeman G.J., Gray G.S., Gimmi C.D., Lombard D.B., Zhou L.-J., White M., Fingeroth J.D., Gribben J.G., Nadler L.M.
J. Exp. Med. 174:625-631(1991) [PubMed] [Europe PMC] [Abstract]
Cited for: PROTEIN SEQUENCE OF 35-38.
[7]"CD80 (B7) and CD86 (B70) provide similar costimulatory signals for T cell proliferation, cytokine production, and generation of CTL."
Lanier L.L., O'Fallon S., Somoza C., Phillips J.H., Linsley P.S., Okumura K., Ito D., Azuma M.
J. Immunol. 154:97-105(1995) [PubMed] [Europe PMC] [Abstract]
Cited for: CHARACTERIZATION.
[8]"Interaction of CTLA-4 (CD152) with CD80 or CD86 inhibits human T-cell activation."
Vandenborre K., Van Gool S.W., Kasran A., Ceuppens J.L., Boogaerts M.A., Vandenberghe P.
Immunology 98:413-421(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, INTERACTION WITH CTLA4.
[9]"Members of adenovirus species B utilize CD80 and CD86 as cellular attachment receptors."
Short J.J., Vasu C., Holterman M.J., Curiel D.T., Pereboev A.
Virus Res. 122:144-153(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH ADENOVIRUS SUBGROUP B FIBER PROTEINS.
[10]"Structure and dimerization of a soluble form of B7-1."
Ikemizu S., Gilbert R.J., Fennelly J.A., Collins A.V., Harlos K., Jones E.Y., Stuart D.I., Davis S.J.
Immunity 12:51-60(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: X-RAY CRYSTALLOGRAPHY (3.0 ANGSTROMS) OF 35-234.
[11]"Crystal structure of the B7-1/CTLA-4 complex that inhibits human immune responses."
Stamper C.C., Zhang Y., Tobin J.F., Erbe D.V., Ikemizu S., Davis S.J., Stahl M.L., Seehra J., Somers W.S., Mosyak L.
Nature 410:608-611(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: X-RAY CRYSTALLOGRAPHY (3.0 ANGSTROMS) OF 35-242 IN COMPLEX WITH CTLA4, SUBUNIT, DISULFIDE BONDS, GLYCOSYLATION AT ASN-53; ASN-89; ASN-186; ASN-207 AND ASN-226.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
M27533 mRNA. Translation: AAA36045.1.
M83077 expand/collapse EMBL AC list , M83072, M83073, M83074 Genomic DNA. Translation: AAA58390.1.
AY197777 mRNA. Translation: AAO39208.1.
AY197778 mRNA. Translation: AAO39209.1.
AC073352 Genomic DNA. No translation available.
BC042665 mRNA. Translation: AAH42665.1.
CCDSCCDS2989.1. [P33681-1]
PIRA45803. I54495.
RefSeqNP_005182.1. NM_005191.3. [P33681-1]
UniGeneHs.838.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
1DR9X-ray3.00A35-233[»]
1I8LX-ray3.00A/B35-242[»]
ProteinModelPortalP33681.
SMRP33681. Positions 35-233.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid107379. 5 interactions.
DIPDIP-6044N.
IntActP33681. 4 interactions.
MINTMINT-6631578.
STRING9606.ENSP00000264246.

Chemistry

ChEMBLCHEMBL2364157.
DrugBankDB01281. Abatacept.
GuidetoPHARMACOLOGY2744.

PTM databases

PhosphoSiteP33681.

Polymorphism databases

DMDM461606.

Proteomic databases

PaxDbP33681.
PRIDEP33681.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000264246; ENSP00000264246; ENSG00000121594. [P33681-1]
ENST00000383668; ENSP00000373164; ENSG00000121594. [P33681-3]
ENST00000383669; ENSP00000373165; ENSG00000121594. [P33681-2]
ENST00000478182; ENSP00000418364; ENSG00000121594. [P33681-1]
GeneID941.
KEGGhsa:941.
UCSCuc003ecq.3. human. [P33681-1]

Organism-specific databases

CTD941.
GeneCardsGC03M119243.
HGNCHGNC:1700. CD80.
HPACAB025368.
MIM112203. gene.
neXtProtNX_P33681.
PharmGKBPA26239.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG42168.
HOGENOMHOG000036959.
HOVERGENHBG000261.
InParanoidP33681.
KOK05412.
OMAVRIYWQK.
OrthoDBEOG7VQJFD.
PhylomeDBP33681.
TreeFamTF351094.

Enzyme and pathway databases

ReactomeREACT_111102. Signal Transduction.
REACT_116125. Disease.
REACT_6900. Immune System.

Gene expression databases

ArrayExpressP33681.
BgeeP33681.
CleanExHS_CD80.
GenevestigatorP33681.

Family and domain databases

Gene3D2.60.40.10. 2 hits.
InterProIPR013162. CD80_C2-set.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
[Graphical view]
PfamPF08205. C2-set_2. 1 hit.
PF07686. V-set. 1 hit.
[Graphical view]
SMARTSM00409. IG. 1 hit.
[Graphical view]
PROSITEPS50835. IG_LIKE. 2 hits.
[Graphical view]
ProtoNetSearch...

Other

EvolutionaryTraceP33681.
GeneWikiCD80.
GenomeRNAi941.
NextBio3898.
PROP33681.
SOURCESearch...

Entry information

Entry nameCD80_HUMAN
AccessionPrimary (citable) accession number: P33681
Secondary accession number(s): Q5DTA9, Q5DTB0
Entry history
Integrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: February 1, 1994
Last modified: July 9, 2014
This is version 150 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 3

Human chromosome 3: entries, gene names and cross-references to MIM

Human cell differentiation molecules

CD nomenclature of surface proteins of human leucocytes and list of entries