Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

T-lymphocyte activation antigen CD80

Gene

CD80

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Involved in the costimulatory signal essential for T-lymphocyte activation. T-cell proliferation and cytokine production is induced by the binding of CD28, binding to CTLA-4 has opposite effects and inhibits T-cell activation.1 Publication
(Microbial infection) Acts as a receptor for adenovirus subgroup B.1 Publication

GO - Molecular functioni

GO - Biological processi

  • cell-cell signaling Source: UniProtKB
  • cellular response to lipopolysaccharide Source: Ensembl
  • intracellular signal transduction Source: UniProtKB
  • phosphatidylinositol-mediated signaling Source: Reactome
  • positive regulation of alpha-beta T cell proliferation Source: Ensembl
  • positive regulation of granulocyte macrophage colony-stimulating factor biosynthetic process Source: UniProtKB
  • positive regulation of interleukin-2 biosynthetic process Source: UniProtKB
  • positive regulation of peptidyl-tyrosine phosphorylation Source: UniProtKB
  • positive regulation of signal transduction Source: UniProtKB
  • positive regulation of T-helper 1 cell differentiation Source: UniProtKB
  • positive regulation of transcription, DNA-templated Source: UniProtKB
  • regulation of phosphatidylinositol 3-kinase signaling Source: Reactome
  • T cell activation Source: UniProtKB
  • T cell costimulation Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Host cell receptor for virus entry, Receptor

Keywords - Biological processi

Host-virus interaction

Enzyme and pathway databases

BioCyciZFISH:ENSG00000121594-MONOMER.
ReactomeiR-HSA-1257604. PIP3 activates AKT signaling.
R-HSA-2219530. Constitutive Signaling by Aberrant PI3K in Cancer.
R-HSA-389356. CD28 co-stimulation.
R-HSA-389357. CD28 dependent PI3K/Akt signaling.
R-HSA-389359. CD28 dependent Vav1 pathway.
R-HSA-389513. CTLA4 inhibitory signaling.
R-HSA-6811558. PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling.

Names & Taxonomyi

Protein namesi
Recommended name:
T-lymphocyte activation antigen CD80
Alternative name(s):
Activation B7-1 antigen
BB1
CTLA-4 counter-receptor B7.1
Short name:
B7
CD_antigen: CD80
Gene namesi
Name:CD80
Synonyms:CD28LG, CD28LG1, LAB7
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:1700. CD80.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini35 – 242ExtracellularSequence analysisAdd BLAST208
Transmembranei243 – 263HelicalSequence analysisAdd BLAST21
Topological domaini264 – 288CytoplasmicSequence analysisAdd BLAST25

GO - Cellular componenti

  • cell surface Source: UniProtKB
  • external side of plasma membrane Source: Ensembl
  • integral component of membrane Source: UniProtKB
  • intracellular Source: GOC
  • plasma membrane Source: Reactome
  • protein complex involved in cell adhesion Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi941.
OpenTargetsiENSG00000121594.
PharmGKBiPA26239.

Chemistry databases

ChEMBLiCHEMBL2364157.
DrugBankiDB01281. Abatacept.
DB06681. Belatacept.
GuidetoPHARMACOLOGYi2744.

Polymorphism and mutation databases

BioMutaiCD80.
DMDMi461606.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 341 PublicationAdd BLAST34
ChainiPRO_000001454735 – 288T-lymphocyte activation antigen CD80Add BLAST254

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi50 ↔ 116PROSITE-ProRule annotation1 Publication
Glycosylationi53N-linked (GlcNAc...)1 Publication1
Glycosylationi89N-linked (GlcNAc...)1 Publication1
Glycosylationi98N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi162 ↔ 216PROSITE-ProRule annotation1 Publication
Glycosylationi186N-linked (GlcNAc...)1 Publication1
Glycosylationi207N-linked (GlcNAc...)1 Publication1
Glycosylationi211N-linked (GlcNAc...)Sequence analysis1
Glycosylationi226N-linked (GlcNAc...)1 Publication1
Glycosylationi232N-linked (GlcNAc...)Sequence analysis1
Modified residuei284PhosphoserineCombined sources1

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiP33681.
PeptideAtlasiP33681.
PRIDEiP33681.

PTM databases

iPTMnetiP33681.
PhosphoSitePlusiP33681.

Expressioni

Tissue specificityi

Expressed on activated B-cells, macrophages and dendritic cells.

Gene expression databases

BgeeiENSG00000121594.
CleanExiHS_CD80.
ExpressionAtlasiP33681. baseline and differential.
GenevisibleiP33681. HS.

Organism-specific databases

HPAiCAB025368.
HPA050092.

Interactioni

Subunit structurei

Homodimer; CD80 dimers on the antigen presenting cells (APCs) bridge CTLA4/CD152 dimers on T-cells in a periodic zipper-like arrangement.2 Publications
(Microbial infection) Interacts with adenovirus subgroup B fiber proteins.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
CD274Q9NZQ72EBI-1031024,EBI-4314282
CTLA4P164103EBI-1031024,EBI-1030991
NGFRP081383EBI-1031024,EBI-1387782

Protein-protein interaction databases

BioGridi107379. 6 interactors.
DIPiDIP-6044N.
IntActiP33681. 5 interactors.
MINTiMINT-6631578.
STRINGi9606.ENSP00000264246.

Structurei

Secondary structure

1288
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi37 – 41Combined sources5
Beta strandi46 – 48Combined sources3
Helixi58 – 61Combined sources4
Beta strandi63 – 68Combined sources6
Beta strandi71 – 77Combined sources7
Beta strandi80 – 83Combined sources4
Helixi85 – 88Combined sources4
Beta strandi91 – 95Combined sources5
Turni96 – 99Combined sources4
Beta strandi100 – 103Combined sources4
Helixi108 – 110Combined sources3
Beta strandi112 – 120Combined sources9
Beta strandi127 – 139Combined sources13
Beta strandi146 – 151Combined sources6
Beta strandi157 – 169Combined sources13
Beta strandi171 – 179Combined sources9
Beta strandi185 – 191Combined sources7
Turni193 – 195Combined sources3
Beta strandi198 – 207Combined sources10
Beta strandi212 – 220Combined sources9
Beta strandi225 – 231Combined sources7

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1DR9X-ray3.00A35-233[»]
1I8LX-ray3.00A/B35-242[»]
ProteinModelPortaliP33681.
SMRiP33681.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP33681.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini35 – 135Ig-like V-typeAdd BLAST101
Domaini145 – 230Ig-like C2-typeAdd BLAST86

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410J3XE. Eukaryota.
ENOG411154Z. LUCA.
GeneTreeiENSGT00720000108819.
HOGENOMiHOG000036959.
HOVERGENiHBG000261.
InParanoidiP33681.
KOiK05412.
OMAiVRIYWQK.
OrthoDBiEOG091G0QRI.
PhylomeDBiP33681.
TreeFamiTF351094.

Family and domain databases

Gene3Di2.60.40.10. 2 hits.
InterProiIPR013162. CD80_C2-set.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
[Graphical view]
PfamiPF08205. C2-set_2. 1 hit.
PF07686. V-set. 1 hit.
[Graphical view]
SMARTiSM00409. IG. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 2 hits.
PROSITEiPS50835. IG_LIKE. 2 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P33681-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGHTRRQGTS PSKCPYLNFF QLLVLAGLSH FCSGVIHVTK EVKEVATLSC
60 70 80 90 100
GHNVSVEELA QTRIYWQKEK KMVLTMMSGD MNIWPEYKNR TIFDITNNLS
110 120 130 140 150
IVILALRPSD EGTYECVVLK YEKDAFKREH LAEVTLSVKA DFPTPSISDF
160 170 180 190 200
EIPTSNIRRI ICSTSGGFPE PHLSWLENGE ELNAINTTVS QDPETELYAV
210 220 230 240 250
SSKLDFNMTT NHSFMCLIKY GHLRVNQTFN WNTTKQEHFP DNLLPSWAIT
260 270 280
LISVNGIFVI CCLTYCFAPR CRERRRNERL RRESVRPV
Length:288
Mass (Da):33,048
Last modified:February 1, 1994 - v1
Checksum:iBA453EE34528B1F4
GO
Isoform 2 (identifier: P33681-2) [UniParc]FASTAAdd to basket
Also known as: s1CD80

The sequence of this isoform differs from the canonical sequence as follows:
     234-266: TKQEHFPDNLLPSWAITLISVNGIFVICCLTYC → S

Note: Soluble isoform. Expressed in unstimulated B-cells and monocytes, but not T-cells.
Show »
Length:256
Mass (Da):29,413
Checksum:iDEB0A9FBA7B7D9A4
GO
Isoform 3 (identifier: P33681-3) [UniParc]FASTAAdd to basket
Also known as: s2CD80

The sequence of this isoform differs from the canonical sequence as follows:
     140-140: A → G
     141-266: Missing.

Note: Soluble isoform. Expressed in T-cells activated by ConA, non-activated monocytes and monocytes activated with IFN-c.
Show »
Length:162
Mass (Da):18,761
Checksum:i24DBC2D5BD70C4FA
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_047698140A → G in isoform 3. 1 Publication1
Alternative sequenceiVSP_047699141 – 266Missing in isoform 3. 1 PublicationAdd BLAST126
Alternative sequenceiVSP_047700234 – 266TKQEH…CLTYC → S in isoform 2. 1 PublicationAdd BLAST33

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M27533 mRNA. Translation: AAA36045.1.
M83077
, M83072, M83073, M83074 Genomic DNA. Translation: AAA58390.1.
AY197777 mRNA. Translation: AAO39208.1.
AY197778 mRNA. Translation: AAO39209.1.
AC073352 Genomic DNA. No translation available.
BC042665 mRNA. Translation: AAH42665.1.
CCDSiCCDS2989.1. [P33681-1]
PIRiI54495. A45803.
RefSeqiNP_005182.1. NM_005191.3. [P33681-1]
UniGeneiHs.838.

Genome annotation databases

EnsembliENST00000264246; ENSP00000264246; ENSG00000121594. [P33681-1]
ENST00000383669; ENSP00000373165; ENSG00000121594. [P33681-2]
ENST00000478182; ENSP00000418364; ENSG00000121594. [P33681-1]
GeneIDi941.
KEGGihsa:941.
UCSCiuc003ecq.4. human. [P33681-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M27533 mRNA. Translation: AAA36045.1.
M83077
, M83072, M83073, M83074 Genomic DNA. Translation: AAA58390.1.
AY197777 mRNA. Translation: AAO39208.1.
AY197778 mRNA. Translation: AAO39209.1.
AC073352 Genomic DNA. No translation available.
BC042665 mRNA. Translation: AAH42665.1.
CCDSiCCDS2989.1. [P33681-1]
PIRiI54495. A45803.
RefSeqiNP_005182.1. NM_005191.3. [P33681-1]
UniGeneiHs.838.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1DR9X-ray3.00A35-233[»]
1I8LX-ray3.00A/B35-242[»]
ProteinModelPortaliP33681.
SMRiP33681.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107379. 6 interactors.
DIPiDIP-6044N.
IntActiP33681. 5 interactors.
MINTiMINT-6631578.
STRINGi9606.ENSP00000264246.

Chemistry databases

ChEMBLiCHEMBL2364157.
DrugBankiDB01281. Abatacept.
DB06681. Belatacept.
GuidetoPHARMACOLOGYi2744.

PTM databases

iPTMnetiP33681.
PhosphoSitePlusiP33681.

Polymorphism and mutation databases

BioMutaiCD80.
DMDMi461606.

Proteomic databases

PaxDbiP33681.
PeptideAtlasiP33681.
PRIDEiP33681.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000264246; ENSP00000264246; ENSG00000121594. [P33681-1]
ENST00000383669; ENSP00000373165; ENSG00000121594. [P33681-2]
ENST00000478182; ENSP00000418364; ENSG00000121594. [P33681-1]
GeneIDi941.
KEGGihsa:941.
UCSCiuc003ecq.4. human. [P33681-1]

Organism-specific databases

CTDi941.
DisGeNETi941.
GeneCardsiCD80.
HGNCiHGNC:1700. CD80.
HPAiCAB025368.
HPA050092.
MIMi112203. gene.
neXtProtiNX_P33681.
OpenTargetsiENSG00000121594.
PharmGKBiPA26239.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410J3XE. Eukaryota.
ENOG411154Z. LUCA.
GeneTreeiENSGT00720000108819.
HOGENOMiHOG000036959.
HOVERGENiHBG000261.
InParanoidiP33681.
KOiK05412.
OMAiVRIYWQK.
OrthoDBiEOG091G0QRI.
PhylomeDBiP33681.
TreeFamiTF351094.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000121594-MONOMER.
ReactomeiR-HSA-1257604. PIP3 activates AKT signaling.
R-HSA-2219530. Constitutive Signaling by Aberrant PI3K in Cancer.
R-HSA-389356. CD28 co-stimulation.
R-HSA-389357. CD28 dependent PI3K/Akt signaling.
R-HSA-389359. CD28 dependent Vav1 pathway.
R-HSA-389513. CTLA4 inhibitory signaling.
R-HSA-6811558. PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling.

Miscellaneous databases

EvolutionaryTraceiP33681.
GeneWikiiCD80.
GenomeRNAii941.
PROiP33681.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000121594.
CleanExiHS_CD80.
ExpressionAtlasiP33681. baseline and differential.
GenevisibleiP33681. HS.

Family and domain databases

Gene3Di2.60.40.10. 2 hits.
InterProiIPR013162. CD80_C2-set.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
[Graphical view]
PfamiPF08205. C2-set_2. 1 hit.
PF07686. V-set. 1 hit.
[Graphical view]
SMARTiSM00409. IG. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 2 hits.
PROSITEiPS50835. IG_LIKE. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCD80_HUMAN
AccessioniPrimary (citable) accession number: P33681
Secondary accession number(s): Q5DTA9, Q5DTB0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: February 1, 1994
Last modified: November 2, 2016
This is version 172 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.