SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P33681

- CD80_HUMAN

UniProt

P33681 - CD80_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
T-lymphocyte activation antigen CD80
Gene
CD80, CD28LG, CD28LG1, LAB7
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Involved in the costimulatory signal essential for T-lymphocyte activation. T-cell proliferation and cytokine production is induced by the binding of CD28, binding to CTLA-4 has opposite effects and inhibits T-cell activation.1 Publication

GO - Molecular functioni

  1. coreceptor activity Source: UniProtKB
  2. protein binding Source: UniProtKB
Complete GO annotation...

GO - Biological processi

  1. Fc-epsilon receptor signaling pathway Source: Reactome
  2. T cell activation Source: UniProtKB
  3. T cell costimulation Source: Reactome
  4. cell-cell signaling Source: UniProtKB
  5. epidermal growth factor receptor signaling pathway Source: Reactome
  6. fibroblast growth factor receptor signaling pathway Source: Reactome
  7. innate immune response Source: Reactome
  8. intracellular signal transduction Source: UniProtKB
  9. neurotrophin TRK receptor signaling pathway Source: Reactome
  10. phosphatidylinositol-mediated signaling Source: Reactome
  11. positive regulation of T-helper 1 cell differentiation Source: UniProtKB
  12. positive regulation of alpha-beta T cell proliferation Source: Ensembl
  13. positive regulation of granulocyte macrophage colony-stimulating factor biosynthetic process Source: UniProtKB
  14. positive regulation of interleukin-2 biosynthetic process Source: UniProtKB
  15. positive regulation of peptidyl-tyrosine phosphorylation Source: UniProtKB
  16. positive regulation of signal transduction Source: UniProtKB
  17. positive regulation of transcription, DNA-templated Source: UniProtKB
  18. viral process Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Biological processi

Host-virus interaction

Enzyme and pathway databases

ReactomeiREACT_147727. Constitutive PI3K/AKT Signaling in Cancer.
REACT_19183. CD28 co-stimulation.
REACT_19238. CD28 dependent Vav1 pathway.
REACT_19358. CD28 dependent PI3K/Akt signaling.
REACT_19405. CTLA4 inhibitory signaling.
REACT_75829. PIP3 activates AKT signaling.

Names & Taxonomyi

Protein namesi
Recommended name:
T-lymphocyte activation antigen CD80
Alternative name(s):
Activation B7-1 antigen
BB1
CTLA-4 counter-receptor B7.1
Short name:
B7
CD_antigen: CD80
Gene namesi
Name:CD80
Synonyms:CD28LG, CD28LG1, LAB7
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 3

Organism-specific databases

HGNCiHGNC:1700. CD80.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini35 – 242208Extracellular Reviewed prediction
Add
BLAST
Transmembranei243 – 26321Helical; Reviewed prediction
Add
BLAST
Topological domaini264 – 28825Cytoplasmic Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. external side of plasma membrane Source: Ensembl
  2. integral component of membrane Source: UniProtKB
  3. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA26239.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 34341 Publication
Add
BLAST
Chaini35 – 288254T-lymphocyte activation antigen CD80
PRO_0000014547Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi50 ↔ 1161 Publication
Glycosylationi53 – 531N-linked (GlcNAc...)1 Publication
Glycosylationi89 – 891N-linked (GlcNAc...)1 Publication
Glycosylationi98 – 981N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi162 ↔ 2161 Publication
Glycosylationi186 – 1861N-linked (GlcNAc...)1 Publication
Glycosylationi207 – 2071N-linked (GlcNAc...)1 Publication
Glycosylationi211 – 2111N-linked (GlcNAc...) Reviewed prediction
Glycosylationi226 – 2261N-linked (GlcNAc...)1 Publication
Glycosylationi232 – 2321N-linked (GlcNAc...) Reviewed prediction

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiP33681.
PRIDEiP33681.

PTM databases

PhosphoSiteiP33681.

Expressioni

Tissue specificityi

Expressed on activated B-cells, macrophages and dendritic cells.

Gene expression databases

ArrayExpressiP33681.
BgeeiP33681.
CleanExiHS_CD80.
GenevestigatoriP33681.

Organism-specific databases

HPAiCAB025368.

Interactioni

Subunit structurei

Homodimer; CD80 dimers on the antigen presenting cells (APCs) bridge CTLA4/CD152 dimers on T-cells in a periodic zipper-like arrangement. Interacts with adenovirus subgroup B fiber proteins and acts as a receptor for these viruses.3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
CD274Q9NZQ72EBI-1031024,EBI-4314282
CTLA4P164103EBI-1031024,EBI-1030991
NGFRP081383EBI-1031024,EBI-1387782

Protein-protein interaction databases

BioGridi107379. 5 interactions.
DIPiDIP-6044N.
IntActiP33681. 4 interactions.
MINTiMINT-6631578.
STRINGi9606.ENSP00000264246.

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi37 – 415
Beta strandi46 – 483
Helixi58 – 614
Beta strandi63 – 686
Beta strandi71 – 777
Beta strandi80 – 834
Helixi85 – 884
Beta strandi91 – 955
Turni96 – 994
Beta strandi100 – 1034
Helixi108 – 1103
Beta strandi112 – 1209
Beta strandi127 – 13913
Beta strandi146 – 1516
Beta strandi157 – 16913
Beta strandi171 – 1799
Beta strandi185 – 1917
Turni193 – 1953
Beta strandi198 – 20710
Beta strandi212 – 2209
Beta strandi225 – 2317

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1DR9X-ray3.00A35-233[»]
1I8LX-ray3.00A/B35-242[»]
ProteinModelPortaliP33681.
SMRiP33681. Positions 35-233.

Miscellaneous databases

EvolutionaryTraceiP33681.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini35 – 135101Ig-like V-type
Add
BLAST
Domaini145 – 23086Ig-like C2-type
Add
BLAST

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG42168.
HOGENOMiHOG000036959.
HOVERGENiHBG000261.
InParanoidiP33681.
KOiK05412.
OMAiVRIYWQK.
OrthoDBiEOG7VQJFD.
PhylomeDBiP33681.
TreeFamiTF351094.

Family and domain databases

Gene3Di2.60.40.10. 2 hits.
InterProiIPR013162. CD80_C2-set.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
[Graphical view]
PfamiPF08205. C2-set_2. 1 hit.
PF07686. V-set. 1 hit.
[Graphical view]
SMARTiSM00409. IG. 1 hit.
[Graphical view]
PROSITEiPS50835. IG_LIKE. 2 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P33681-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MGHTRRQGTS PSKCPYLNFF QLLVLAGLSH FCSGVIHVTK EVKEVATLSC    50
GHNVSVEELA QTRIYWQKEK KMVLTMMSGD MNIWPEYKNR TIFDITNNLS 100
IVILALRPSD EGTYECVVLK YEKDAFKREH LAEVTLSVKA DFPTPSISDF 150
EIPTSNIRRI ICSTSGGFPE PHLSWLENGE ELNAINTTVS QDPETELYAV 200
SSKLDFNMTT NHSFMCLIKY GHLRVNQTFN WNTTKQEHFP DNLLPSWAIT 250
LISVNGIFVI CCLTYCFAPR CRERRRNERL RRESVRPV 288
Length:288
Mass (Da):33,048
Last modified:February 1, 1994 - v1
Checksum:iBA453EE34528B1F4
GO
Isoform 2 (identifier: P33681-2) [UniParc]FASTAAdd to Basket

Also known as: s1CD80

The sequence of this isoform differs from the canonical sequence as follows:
     234-266: TKQEHFPDNLLPSWAITLISVNGIFVICCLTYC → S

Note: Soluble isoform. Expressed in unstimulated B-cells and monocytes, but not T-cells.

Show »
Length:256
Mass (Da):29,413
Checksum:iDEB0A9FBA7B7D9A4
GO
Isoform 3 (identifier: P33681-3) [UniParc]FASTAAdd to Basket

Also known as: s2CD80

The sequence of this isoform differs from the canonical sequence as follows:
     140-140: A → G
     141-266: Missing.

Note: Soluble isoform. Expressed in T-cells activated by ConA, non-activated monocytes and monocytes activated with IFN-c.

Show »
Length:162
Mass (Da):18,761
Checksum:i24DBC2D5BD70C4FA
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei140 – 1401A → G in isoform 3.
VSP_047698
Alternative sequencei141 – 266126Missing in isoform 3.
VSP_047699Add
BLAST
Alternative sequencei234 – 26633TKQEH…CLTYC → S in isoform 2.
VSP_047700Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
M27533 mRNA. Translation: AAA36045.1.
M83077
, M83072, M83073, M83074 Genomic DNA. Translation: AAA58390.1.
AY197777 mRNA. Translation: AAO39208.1.
AY197778 mRNA. Translation: AAO39209.1.
AC073352 Genomic DNA. No translation available.
BC042665 mRNA. Translation: AAH42665.1.
CCDSiCCDS2989.1. [P33681-1]
PIRiI54495. A45803.
RefSeqiNP_005182.1. NM_005191.3. [P33681-1]
UniGeneiHs.838.

Genome annotation databases

EnsembliENST00000264246; ENSP00000264246; ENSG00000121594. [P33681-1]
ENST00000383668; ENSP00000373164; ENSG00000121594. [P33681-3]
ENST00000383669; ENSP00000373165; ENSG00000121594. [P33681-2]
ENST00000478182; ENSP00000418364; ENSG00000121594. [P33681-1]
GeneIDi941.
KEGGihsa:941.
UCSCiuc003ecq.3. human. [P33681-1]

Polymorphism databases

DMDMi461606.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
M27533 mRNA. Translation: AAA36045.1 .
M83077
, M83072 , M83073 , M83074 Genomic DNA. Translation: AAA58390.1 .
AY197777 mRNA. Translation: AAO39208.1 .
AY197778 mRNA. Translation: AAO39209.1 .
AC073352 Genomic DNA. No translation available.
BC042665 mRNA. Translation: AAH42665.1 .
CCDSi CCDS2989.1. [P33681-1 ]
PIRi I54495. A45803.
RefSeqi NP_005182.1. NM_005191.3. [P33681-1 ]
UniGenei Hs.838.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1DR9 X-ray 3.00 A 35-233 [» ]
1I8L X-ray 3.00 A/B 35-242 [» ]
ProteinModelPortali P33681.
SMRi P33681. Positions 35-233.
ModBasei Search...

Protein-protein interaction databases

BioGridi 107379. 5 interactions.
DIPi DIP-6044N.
IntActi P33681. 4 interactions.
MINTi MINT-6631578.
STRINGi 9606.ENSP00000264246.

Chemistry

ChEMBLi CHEMBL2364157.
DrugBanki DB01281. Abatacept.
GuidetoPHARMACOLOGYi 2744.

PTM databases

PhosphoSitei P33681.

Polymorphism databases

DMDMi 461606.

Proteomic databases

PaxDbi P33681.
PRIDEi P33681.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000264246 ; ENSP00000264246 ; ENSG00000121594 . [P33681-1 ]
ENST00000383668 ; ENSP00000373164 ; ENSG00000121594 . [P33681-3 ]
ENST00000383669 ; ENSP00000373165 ; ENSG00000121594 . [P33681-2 ]
ENST00000478182 ; ENSP00000418364 ; ENSG00000121594 . [P33681-1 ]
GeneIDi 941.
KEGGi hsa:941.
UCSCi uc003ecq.3. human. [P33681-1 ]

Organism-specific databases

CTDi 941.
GeneCardsi GC03M119243.
HGNCi HGNC:1700. CD80.
HPAi CAB025368.
MIMi 112203. gene.
neXtProti NX_P33681.
PharmGKBi PA26239.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG42168.
HOGENOMi HOG000036959.
HOVERGENi HBG000261.
InParanoidi P33681.
KOi K05412.
OMAi VRIYWQK.
OrthoDBi EOG7VQJFD.
PhylomeDBi P33681.
TreeFami TF351094.

Enzyme and pathway databases

Reactomei REACT_147727. Constitutive PI3K/AKT Signaling in Cancer.
REACT_19183. CD28 co-stimulation.
REACT_19238. CD28 dependent Vav1 pathway.
REACT_19358. CD28 dependent PI3K/Akt signaling.
REACT_19405. CTLA4 inhibitory signaling.
REACT_75829. PIP3 activates AKT signaling.

Miscellaneous databases

EvolutionaryTracei P33681.
GeneWikii CD80.
GenomeRNAii 941.
NextBioi 3898.
PROi P33681.
SOURCEi Search...

Gene expression databases

ArrayExpressi P33681.
Bgeei P33681.
CleanExi HS_CD80.
Genevestigatori P33681.

Family and domain databases

Gene3Di 2.60.40.10. 2 hits.
InterProi IPR013162. CD80_C2-set.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
[Graphical view ]
Pfami PF08205. C2-set_2. 1 hit.
PF07686. V-set. 1 hit.
[Graphical view ]
SMARTi SM00409. IG. 1 hit.
[Graphical view ]
PROSITEi PS50835. IG_LIKE. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "B7, a new member of the Ig superfamily with unique expression on activated and neoplastic B cells."
    Freeman G.J., Freedman A.S., Segil J.M., Lee G., Whitman J.F., Nadler L.M.
    J. Immunol. 143:2714-2722(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Lymphoid tissue.
  2. "Genomic organization and chromosomal location of the human gene encoding the B-lymphocyte activation antigen B7."
    Selvakumar A., Mohanraj B.K., Eddy R.L., Shows T.B., White P.C., Dupont B.
    Immunogenetics 36:175-181(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  3. "Human Soluble CD80 is generated by alternative splicing, and recombinant soluble CD80 binds to CD28 and CD152 influencing T-cell activation."
    Kakoulidou M., Giscombe R., Zhao X., Lefvert A.K., Wang X.
    Scand. J. Immunol. 66:529-537(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), ALTERNATIVE SPLICING.
  4. "The DNA sequence, annotation and analysis of human chromosome 3."
    Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
    , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
    Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  6. "Structure, expression, and T cell costimulatory activity of the murine homologue of the human B lymphocyte activation antigen B7."
    Freeman G.J., Gray G.S., Gimmi C.D., Lombard D.B., Zhou L.-J., White M., Fingeroth J.D., Gribben J.G., Nadler L.M.
    J. Exp. Med. 174:625-631(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 35-38.
  7. "CD80 (B7) and CD86 (B70) provide similar costimulatory signals for T cell proliferation, cytokine production, and generation of CTL."
    Lanier L.L., O'Fallon S., Somoza C., Phillips J.H., Linsley P.S., Okumura K., Ito D., Azuma M.
    J. Immunol. 154:97-105(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: CHARACTERIZATION.
  8. "Interaction of CTLA-4 (CD152) with CD80 or CD86 inhibits human T-cell activation."
    Vandenborre K., Van Gool S.W., Kasran A., Ceuppens J.L., Boogaerts M.A., Vandenberghe P.
    Immunology 98:413-421(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH CTLA4.
  9. "Members of adenovirus species B utilize CD80 and CD86 as cellular attachment receptors."
    Short J.J., Vasu C., Holterman M.J., Curiel D.T., Pereboev A.
    Virus Res. 122:144-153(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH ADENOVIRUS SUBGROUP B FIBER PROTEINS.
  10. Cited for: X-RAY CRYSTALLOGRAPHY (3.0 ANGSTROMS) OF 35-234.
  11. "Crystal structure of the B7-1/CTLA-4 complex that inhibits human immune responses."
    Stamper C.C., Zhang Y., Tobin J.F., Erbe D.V., Ikemizu S., Davis S.J., Stahl M.L., Seehra J., Somers W.S., Mosyak L.
    Nature 410:608-611(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (3.0 ANGSTROMS) OF 35-242 IN COMPLEX WITH CTLA4, SUBUNIT, DISULFIDE BONDS, GLYCOSYLATION AT ASN-53; ASN-89; ASN-186; ASN-207 AND ASN-226.

Entry informationi

Entry nameiCD80_HUMAN
AccessioniPrimary (citable) accession number: P33681
Secondary accession number(s): Q5DTA9, Q5DTB0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: February 1, 1994
Last modified: September 3, 2014
This is version 151 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi