Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P33681

- CD80_HUMAN

UniProt

P33681 - CD80_HUMAN

Protein

T-lymphocyte activation antigen CD80

Gene

CD80

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 152 (01 Oct 2014)
      Sequence version 1 (01 Feb 1994)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Involved in the costimulatory signal essential for T-lymphocyte activation. T-cell proliferation and cytokine production is induced by the binding of CD28, binding to CTLA-4 has opposite effects and inhibits T-cell activation.1 Publication

    GO - Molecular functioni

    1. coreceptor activity Source: UniProtKB
    2. protein binding Source: UniProtKB

    GO - Biological processi

    1. cell-cell signaling Source: UniProtKB
    2. epidermal growth factor receptor signaling pathway Source: Reactome
    3. Fc-epsilon receptor signaling pathway Source: Reactome
    4. fibroblast growth factor receptor signaling pathway Source: Reactome
    5. innate immune response Source: Reactome
    6. intracellular signal transduction Source: UniProtKB
    7. neurotrophin TRK receptor signaling pathway Source: Reactome
    8. phosphatidylinositol-mediated signaling Source: Reactome
    9. positive regulation of alpha-beta T cell proliferation Source: Ensembl
    10. positive regulation of granulocyte macrophage colony-stimulating factor biosynthetic process Source: UniProtKB
    11. positive regulation of interleukin-2 biosynthetic process Source: UniProtKB
    12. positive regulation of peptidyl-tyrosine phosphorylation Source: UniProtKB
    13. positive regulation of signal transduction Source: UniProtKB
    14. positive regulation of T-helper 1 cell differentiation Source: UniProtKB
    15. positive regulation of transcription, DNA-templated Source: UniProtKB
    16. T cell activation Source: UniProtKB
    17. T cell costimulation Source: Reactome
    18. viral process Source: UniProtKB-KW

    Keywords - Molecular functioni

    Receptor

    Keywords - Biological processi

    Host-virus interaction

    Enzyme and pathway databases

    ReactomeiREACT_147727. Constitutive PI3K/AKT Signaling in Cancer.
    REACT_19183. CD28 co-stimulation.
    REACT_19238. CD28 dependent Vav1 pathway.
    REACT_19358. CD28 dependent PI3K/Akt signaling.
    REACT_19405. CTLA4 inhibitory signaling.
    REACT_75829. PIP3 activates AKT signaling.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    T-lymphocyte activation antigen CD80
    Alternative name(s):
    Activation B7-1 antigen
    BB1
    CTLA-4 counter-receptor B7.1
    Short name:
    B7
    CD_antigen: CD80
    Gene namesi
    Name:CD80
    Synonyms:CD28LG, CD28LG1, LAB7
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 3

    Organism-specific databases

    HGNCiHGNC:1700. CD80.

    Subcellular locationi

    GO - Cellular componenti

    1. external side of plasma membrane Source: Ensembl
    2. integral component of membrane Source: UniProtKB
    3. plasma membrane Source: Reactome

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA26239.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 34341 PublicationAdd
    BLAST
    Chaini35 – 288254T-lymphocyte activation antigen CD80PRO_0000014547Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi50 ↔ 1161 PublicationPROSITE-ProRule annotation
    Glycosylationi53 – 531N-linked (GlcNAc...)1 Publication
    Glycosylationi89 – 891N-linked (GlcNAc...)1 Publication
    Glycosylationi98 – 981N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi162 ↔ 2161 PublicationPROSITE-ProRule annotation
    Glycosylationi186 – 1861N-linked (GlcNAc...)1 Publication
    Glycosylationi207 – 2071N-linked (GlcNAc...)1 Publication
    Glycosylationi211 – 2111N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi226 – 2261N-linked (GlcNAc...)1 Publication
    Glycosylationi232 – 2321N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiP33681.
    PRIDEiP33681.

    PTM databases

    PhosphoSiteiP33681.

    Expressioni

    Tissue specificityi

    Expressed on activated B-cells, macrophages and dendritic cells.

    Gene expression databases

    ArrayExpressiP33681.
    BgeeiP33681.
    CleanExiHS_CD80.
    GenevestigatoriP33681.

    Organism-specific databases

    HPAiCAB025368.

    Interactioni

    Subunit structurei

    Homodimer; CD80 dimers on the antigen presenting cells (APCs) bridge CTLA4/CD152 dimers on T-cells in a periodic zipper-like arrangement. Interacts with adenovirus subgroup B fiber proteins and acts as a receptor for these viruses.3 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    CD274Q9NZQ72EBI-1031024,EBI-4314282
    CTLA4P164103EBI-1031024,EBI-1030991
    NGFRP081383EBI-1031024,EBI-1387782

    Protein-protein interaction databases

    BioGridi107379. 5 interactions.
    DIPiDIP-6044N.
    IntActiP33681. 5 interactions.
    MINTiMINT-6631578.
    STRINGi9606.ENSP00000264246.

    Structurei

    Secondary structure

    1
    288
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi37 – 415
    Beta strandi46 – 483
    Helixi58 – 614
    Beta strandi63 – 686
    Beta strandi71 – 777
    Beta strandi80 – 834
    Helixi85 – 884
    Beta strandi91 – 955
    Turni96 – 994
    Beta strandi100 – 1034
    Helixi108 – 1103
    Beta strandi112 – 1209
    Beta strandi127 – 13913
    Beta strandi146 – 1516
    Beta strandi157 – 16913
    Beta strandi171 – 1799
    Beta strandi185 – 1917
    Turni193 – 1953
    Beta strandi198 – 20710
    Beta strandi212 – 2209
    Beta strandi225 – 2317

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1DR9X-ray3.00A35-233[»]
    1I8LX-ray3.00A/B35-242[»]
    ProteinModelPortaliP33681.
    SMRiP33681. Positions 35-233.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiP33681.

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini35 – 242208ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini264 – 28825CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei243 – 26321HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini35 – 135101Ig-like V-typeAdd
    BLAST
    Domaini145 – 23086Ig-like C2-typeAdd
    BLAST

    Sequence similaritiesi

    Keywords - Domaini

    Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG42168.
    HOGENOMiHOG000036959.
    HOVERGENiHBG000261.
    InParanoidiP33681.
    KOiK05412.
    OMAiVRIYWQK.
    OrthoDBiEOG7VQJFD.
    PhylomeDBiP33681.
    TreeFamiTF351094.

    Family and domain databases

    Gene3Di2.60.40.10. 2 hits.
    InterProiIPR013162. CD80_C2-set.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR003599. Ig_sub.
    IPR013106. Ig_V-set.
    [Graphical view]
    PfamiPF08205. C2-set_2. 1 hit.
    PF07686. V-set. 1 hit.
    [Graphical view]
    SMARTiSM00409. IG. 1 hit.
    [Graphical view]
    PROSITEiPS50835. IG_LIKE. 2 hits.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P33681-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGHTRRQGTS PSKCPYLNFF QLLVLAGLSH FCSGVIHVTK EVKEVATLSC    50
    GHNVSVEELA QTRIYWQKEK KMVLTMMSGD MNIWPEYKNR TIFDITNNLS 100
    IVILALRPSD EGTYECVVLK YEKDAFKREH LAEVTLSVKA DFPTPSISDF 150
    EIPTSNIRRI ICSTSGGFPE PHLSWLENGE ELNAINTTVS QDPETELYAV 200
    SSKLDFNMTT NHSFMCLIKY GHLRVNQTFN WNTTKQEHFP DNLLPSWAIT 250
    LISVNGIFVI CCLTYCFAPR CRERRRNERL RRESVRPV 288
    Length:288
    Mass (Da):33,048
    Last modified:February 1, 1994 - v1
    Checksum:iBA453EE34528B1F4
    GO
    Isoform 2 (identifier: P33681-2) [UniParc]FASTAAdd to Basket

    Also known as: s1CD80

    The sequence of this isoform differs from the canonical sequence as follows:
         234-266: TKQEHFPDNLLPSWAITLISVNGIFVICCLTYC → S

    Note: Soluble isoform. Expressed in unstimulated B-cells and monocytes, but not T-cells.

    Show »
    Length:256
    Mass (Da):29,413
    Checksum:iDEB0A9FBA7B7D9A4
    GO
    Isoform 3 (identifier: P33681-3) [UniParc]FASTAAdd to Basket

    Also known as: s2CD80

    The sequence of this isoform differs from the canonical sequence as follows:
         140-140: A → G
         141-266: Missing.

    Note: Soluble isoform. Expressed in T-cells activated by ConA, non-activated monocytes and monocytes activated with IFN-c.

    Show »
    Length:162
    Mass (Da):18,761
    Checksum:i24DBC2D5BD70C4FA
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei140 – 1401A → G in isoform 3. 1 PublicationVSP_047698
    Alternative sequencei141 – 266126Missing in isoform 3. 1 PublicationVSP_047699Add
    BLAST
    Alternative sequencei234 – 26633TKQEH…CLTYC → S in isoform 2. 1 PublicationVSP_047700Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M27533 mRNA. Translation: AAA36045.1.
    M83077
    , M83072, M83073, M83074 Genomic DNA. Translation: AAA58390.1.
    AY197777 mRNA. Translation: AAO39208.1.
    AY197778 mRNA. Translation: AAO39209.1.
    AC073352 Genomic DNA. No translation available.
    BC042665 mRNA. Translation: AAH42665.1.
    CCDSiCCDS2989.1. [P33681-1]
    PIRiI54495. A45803.
    RefSeqiNP_005182.1. NM_005191.3. [P33681-1]
    UniGeneiHs.838.

    Genome annotation databases

    EnsembliENST00000264246; ENSP00000264246; ENSG00000121594. [P33681-1]
    ENST00000383669; ENSP00000373165; ENSG00000121594. [P33681-2]
    ENST00000478182; ENSP00000418364; ENSG00000121594. [P33681-1]
    GeneIDi941.
    KEGGihsa:941.
    UCSCiuc003ecq.3. human. [P33681-1]

    Polymorphism databases

    DMDMi461606.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M27533 mRNA. Translation: AAA36045.1 .
    M83077
    , M83072 , M83073 , M83074 Genomic DNA. Translation: AAA58390.1 .
    AY197777 mRNA. Translation: AAO39208.1 .
    AY197778 mRNA. Translation: AAO39209.1 .
    AC073352 Genomic DNA. No translation available.
    BC042665 mRNA. Translation: AAH42665.1 .
    CCDSi CCDS2989.1. [P33681-1 ]
    PIRi I54495. A45803.
    RefSeqi NP_005182.1. NM_005191.3. [P33681-1 ]
    UniGenei Hs.838.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1DR9 X-ray 3.00 A 35-233 [» ]
    1I8L X-ray 3.00 A/B 35-242 [» ]
    ProteinModelPortali P33681.
    SMRi P33681. Positions 35-233.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 107379. 5 interactions.
    DIPi DIP-6044N.
    IntActi P33681. 5 interactions.
    MINTi MINT-6631578.
    STRINGi 9606.ENSP00000264246.

    Chemistry

    ChEMBLi CHEMBL2364157.
    DrugBanki DB01281. Abatacept.
    GuidetoPHARMACOLOGYi 2744.

    PTM databases

    PhosphoSitei P33681.

    Polymorphism databases

    DMDMi 461606.

    Proteomic databases

    PaxDbi P33681.
    PRIDEi P33681.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000264246 ; ENSP00000264246 ; ENSG00000121594 . [P33681-1 ]
    ENST00000383669 ; ENSP00000373165 ; ENSG00000121594 . [P33681-2 ]
    ENST00000478182 ; ENSP00000418364 ; ENSG00000121594 . [P33681-1 ]
    GeneIDi 941.
    KEGGi hsa:941.
    UCSCi uc003ecq.3. human. [P33681-1 ]

    Organism-specific databases

    CTDi 941.
    GeneCardsi GC03M119243.
    HGNCi HGNC:1700. CD80.
    HPAi CAB025368.
    MIMi 112203. gene.
    neXtProti NX_P33681.
    PharmGKBi PA26239.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG42168.
    HOGENOMi HOG000036959.
    HOVERGENi HBG000261.
    InParanoidi P33681.
    KOi K05412.
    OMAi VRIYWQK.
    OrthoDBi EOG7VQJFD.
    PhylomeDBi P33681.
    TreeFami TF351094.

    Enzyme and pathway databases

    Reactomei REACT_147727. Constitutive PI3K/AKT Signaling in Cancer.
    REACT_19183. CD28 co-stimulation.
    REACT_19238. CD28 dependent Vav1 pathway.
    REACT_19358. CD28 dependent PI3K/Akt signaling.
    REACT_19405. CTLA4 inhibitory signaling.
    REACT_75829. PIP3 activates AKT signaling.

    Miscellaneous databases

    EvolutionaryTracei P33681.
    GeneWikii CD80.
    GenomeRNAii 941.
    NextBioi 3898.
    PROi P33681.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P33681.
    Bgeei P33681.
    CleanExi HS_CD80.
    Genevestigatori P33681.

    Family and domain databases

    Gene3Di 2.60.40.10. 2 hits.
    InterProi IPR013162. CD80_C2-set.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR003599. Ig_sub.
    IPR013106. Ig_V-set.
    [Graphical view ]
    Pfami PF08205. C2-set_2. 1 hit.
    PF07686. V-set. 1 hit.
    [Graphical view ]
    SMARTi SM00409. IG. 1 hit.
    [Graphical view ]
    PROSITEi PS50835. IG_LIKE. 2 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "B7, a new member of the Ig superfamily with unique expression on activated and neoplastic B cells."
      Freeman G.J., Freedman A.S., Segil J.M., Lee G., Whitman J.F., Nadler L.M.
      J. Immunol. 143:2714-2722(1989) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Lymphoid tissue.
    2. "Genomic organization and chromosomal location of the human gene encoding the B-lymphocyte activation antigen B7."
      Selvakumar A., Mohanraj B.K., Eddy R.L., Shows T.B., White P.C., Dupont B.
      Immunogenetics 36:175-181(1992) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    3. "Human Soluble CD80 is generated by alternative splicing, and recombinant soluble CD80 binds to CD28 and CD152 influencing T-cell activation."
      Kakoulidou M., Giscombe R., Zhao X., Lefvert A.K., Wang X.
      Scand. J. Immunol. 66:529-537(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), ALTERNATIVE SPLICING.
    4. "The DNA sequence, annotation and analysis of human chromosome 3."
      Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
      , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
      Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    6. "Structure, expression, and T cell costimulatory activity of the murine homologue of the human B lymphocyte activation antigen B7."
      Freeman G.J., Gray G.S., Gimmi C.D., Lombard D.B., Zhou L.-J., White M., Fingeroth J.D., Gribben J.G., Nadler L.M.
      J. Exp. Med. 174:625-631(1991) [PubMed] [Europe PMC] [Abstract]
      Cited for: PROTEIN SEQUENCE OF 35-38.
    7. "CD80 (B7) and CD86 (B70) provide similar costimulatory signals for T cell proliferation, cytokine production, and generation of CTL."
      Lanier L.L., O'Fallon S., Somoza C., Phillips J.H., Linsley P.S., Okumura K., Ito D., Azuma M.
      J. Immunol. 154:97-105(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: CHARACTERIZATION.
    8. "Interaction of CTLA-4 (CD152) with CD80 or CD86 inhibits human T-cell activation."
      Vandenborre K., Van Gool S.W., Kasran A., Ceuppens J.L., Boogaerts M.A., Vandenberghe P.
      Immunology 98:413-421(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH CTLA4.
    9. "Members of adenovirus species B utilize CD80 and CD86 as cellular attachment receptors."
      Short J.J., Vasu C., Holterman M.J., Curiel D.T., Pereboev A.
      Virus Res. 122:144-153(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH ADENOVIRUS SUBGROUP B FIBER PROTEINS.
    10. Cited for: X-RAY CRYSTALLOGRAPHY (3.0 ANGSTROMS) OF 35-234.
    11. "Crystal structure of the B7-1/CTLA-4 complex that inhibits human immune responses."
      Stamper C.C., Zhang Y., Tobin J.F., Erbe D.V., Ikemizu S., Davis S.J., Stahl M.L., Seehra J., Somers W.S., Mosyak L.
      Nature 410:608-611(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (3.0 ANGSTROMS) OF 35-242 IN COMPLEX WITH CTLA4, SUBUNIT, DISULFIDE BONDS, GLYCOSYLATION AT ASN-53; ASN-89; ASN-186; ASN-207 AND ASN-226.

    Entry informationi

    Entry nameiCD80_HUMAN
    AccessioniPrimary (citable) accession number: P33681
    Secondary accession number(s): Q5DTA9, Q5DTB0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 1, 1994
    Last sequence update: February 1, 1994
    Last modified: October 1, 2014
    This is version 152 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human cell differentiation molecules
      CD nomenclature of surface proteins of human leucocytes and list of entries
    2. Human chromosome 3
      Human chromosome 3: entries, gene names and cross-references to MIM
    3. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    4. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3