P33402 (GCYA2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 123.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Guanylate cyclase soluble subunit alpha-2 Short name=GCS-alpha-2 EC=4.6.1.2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 732 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Has guanylyl cyclase on binding to the beta-1 subunit. Isoform 2 acts as a negative regulator of guanylyl cyclase activity as it forms non-functional heterodimers with the beta subunits. |
| Catalytic activity | GTP = 3',5'-cyclic GMP + diphosphate. |
| Enzyme regulation | Activated by nitric oxide in the presence of magnesium or manganese ions. |
| Subunit structure | Heterodimer of an alpha and a beta chain. |
| Subcellular location | |
| Tissue specificity | Isoform 1 is expressed in fetal brain, liver, colon, endothelium and testis. Isoform 2 is expressed only in liver, colon and endothelium. |
| Miscellaneous | There are two types of guanylate cyclases: soluble forms and membrane-associated receptor forms. |
| Sequence similarities | Belongs to the adenylyl cyclase class-4/guanylyl cyclase family. Contains 1 guanylate cyclase domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | cGMP biosynthesis |
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | GTP-binding Nucleotide-binding |
| Molecular function | Lyase |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | blood coagulation Traceable author statement. Source: Reactome intracellular signal transductionInferred from electronic annotation. Source: InterPro positive regulation of cGMP biosynthetic processInferred from electronic annotation. Source: Compara signal transductionTraceable author statement Ref.1. Source: ProtInc |
| Cellular_component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | GTP binding Inferred from electronic annotation. Source: UniProtKB-KW guanylate cyclase activityTraceable author statement Ref.1. Source: ProtInc heme bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P33402-1) Also known as: Alpha-2; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P33402-2) Also known as: Alpha-2-I; The sequence of this isoform differs from the canonical sequence as follows: 612-612: Q → QPQRSELLFSFPVSIQLVPDQHQSETDLGTEK |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 732 | 732 | Guanylate cyclase soluble subunit alpha-2 | PRO_0000074113 | |||||
Regions | |||||||||
| Domain | 521 – 648 | 128 | Guanylate cyclase | ||||||
| Compositional bias | 51 – 76 | 26 | Ala-rich | ||||||
| Compositional bias | 51 – 58 | 8 | Poly-Ala | ||||||
Natural variations | |||||||||
| Alternative sequence | 612 | 1 | Q → QPQRSELLFSFPVSIQLVPD QHQSETDLGTEK in isoform 2. | VSP_001814 | |||||
| Natural variant | 681 | 1 | E → V in a colorectal cancer sample; somatic mutation. Ref.5 | VAR_036420 | |||||
| Natural variant | 685 | 1 | N → T in a colorectal cancer sample; somatic mutation. Ref.5 | VAR_036421 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning and expression of a new alpha-subunit of soluble guanylyl cyclase. Interchangeability of the alpha-subunits of the enzyme." Harteneck C., Wedel B., Koesling D., Malkewitz J., Boehme E., Schultz G. FEBS Lett. 292:217-222(1991) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. |
| [2] | "A variant of the alpha 2 subunit of soluble guanylyl cyclase contains an insert homologous to a region within adenylyl cyclases and functions as a dominant negative protein." Behrends S., Harteneck C., Schultz G., Koesling D. J. Biol. Chem. 270:21109-21113(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [3] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [5] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] VAL-681 AND THR-685. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X63282 mRNA. Translation: CAA44921.1. Z50053 mRNA. Translation: CAA90393.1. CH471065 Genomic DNA. Translation: EAW67081.1. BC130484 mRNA. Translation: AAI30485.1. BC130488 mRNA. Translation: AAI30489.1. |
| IPI | IPI00217233. IPI00981500. |
| PIR | S18325. |
| RefSeq | NP_000846.1. NM_000855.2. NP_001243353.1. NM_001256424.1. |
| UniGene | Hs.24321. |
3D structure databases | |
| ProteinModelPortal | P33402. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000344874. |
PTM databases | |
| PhosphoSite | P33402. |
Polymorphism databases | |
| DMDM | 461897. |
Proteomic databases | |
| PaxDb | P33402. |
| PRIDE | P33402. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000282249; ENSP00000282249; ENSG00000152402. ENST00000526355; ENSP00000431245; ENSG00000152402. |
| GeneID | 2977. |
| KEGG | hsa:2977. |
| UCSC | uc001pjg.1. human. uc009yxn.1. human. |
Organism-specific databases | |
| CTD | 2977. |
| GeneCards | GC11M106591. |
| HGNC | HGNC:4684. GUCY1A2. |
| HPA | CAB009534. |
| MIM | 601244. gene. |
| neXtProt | NX_P33402. |
| PharmGKB | PA186. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG2114. |
| HOVERGEN | HBG106603. |
| KO | K12318. |
| OMA | ECENTNI. |
Enzyme and pathway databases | |
| Reactome | REACT_604. Hemostasis. |
Gene expression databases | |
| ArrayExpress | P33402. |
| Bgee | P33402. |
| CleanEx | HS_GUCY1A2. |
| Genevestigator | P33402. |
| GermOnline | ENSG00000152402. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.30.70.1230. 1 hit. |
| InterPro | IPR001054. A/G_cyclase. IPR018297. A/G_cyclase_CS. IPR011645. Haem_no_assoc-bd. IPR011644. Heme_NO-bd. IPR024096. NO_sig/Golgi_transp_ligand-bd. [Graphical view] |
| Pfam | PF00211. Guanylate_cyc. 1 hit. PF07700. HNOB. 1 hit. PF07701. HNOBA. 1 hit. [Graphical view] |
| SMART | SM00044. CYCc. 1 hit. [Graphical view] |
| SUPFAM | SSF55073. A/G_cyclase. 1 hit. SSF111126. Haem_NO-bd. 1 hit. |
| PROSITE | PS00452. GUANYLATE_CYCLASE_1. 1 hit. PS50125. GUANYLATE_CYCLASE_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | P33402. |
| ChEMBL | CHEMBL3303. |
| GenomeRNAi | 2977. |
| NextBio | 11808. |
| SOURCE | Search... |
Entry information
| Entry name | GCYA2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P33402 Secondary accession number(s): A1L4C4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
