P33085 (SHAKB_DROME) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 109.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Innexin shaking-B Alternative name(s): Protein passover | ||||||
| Gene names |
| ||||||
| Organism | Drosophila melanogaster (Fruit fly) [Reference proteome] | ||||||
| Taxonomic identifier | 7227 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Ecdysozoa › Arthropoda › Hexapoda › Insecta › Pterygota › Neoptera › Endopterygota › Diptera › Brachycera › Muscomorpha › Ephydroidea › Drosophilidae › Drosophila › Sophophora › ![]() |
Protein attributes
| Sequence length | 372 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Structural component of the gap junctions at electrical synapses in distal and mid-depth levels in the lamina. Isoform Lethal forms voltage sensitive intercellular channels through homotypic interactions. Ref.8 Ref.9 |
| Subunit structure | |
| Subcellular location | Cell membrane; Multi-pass membrane protein Potential. Cell junction › gap junction. |
| Tissue specificity | Isoform Neural is expressed in synapses of giant fibers (GF), in a large thoracic cell in location of postsynaptic target and optic lobe lamina and medulla. Isoform Lethal is expressed in embryonic mesodermal derivatives. During metamorphosis, both isoforms are dynamically expressed in pupal nervous system. |
| Disruption phenotype | Flies fail to jump in response to a light-off stimulus. Neural-specific mutants exhibit modified giant fiber system and gustatory response. Ref.2 |
| Sequence similarities | Belongs to the pannexin family. |
Ontologies
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform Lethal (identifier: P33085-1) Also known as: A; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Neural (identifier: P33085-2) Also known as: C; The sequence of this isoform differs from the canonical sequence as follows: 2-58: LDIFRGLKNL...GNPIDCVHTK → VSHVKIDSPV...GNPIDCVHTR 72-116: QSTYTLKSLF...YKYYQWVCFC → HSTYTVVDAF...TKYYQWVAFT | ||||||
| Isoform B (identifier: P33085-3) The sequence of this isoform differs from the canonical sequence as follows: 121-121: A → P 123-372: Missing. | ||||||
| Isoform D (identifier: P33085-4) The sequence of this isoform differs from the canonical sequence as follows: 2-116: LDIFRGLKNL...YKYYQWVCFC → YKPDTLTRRG...TKYYQWVAFT | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform E (identifier: P33085-6) The sequence of this isoform differs from the canonical sequence as follows: 2-119: LDIFRGLKNL...YQWVCFCLFF → MGRHCHVPKQ...QKKIPTTYNE | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform F (identifier: P33085-5) The sequence of this isoform differs from the canonical sequence as follows: 2-36: LDIFRGLKNLVKVSHVKTDSIVFRLHYSITVMILM → KKQGSEVPFPGVHNSQGRGPLTIKHTKYYQWVAFT 37-116: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 372 | 372 | Innexin shaking-B | PRO_0000208500 | |||||
Regions | |||||||||
| Topological domain | 1 – 21 | 21 | Cytoplasmic Potential | ||||||
| Transmembrane | 22 – 42 | 21 | Helical; Potential | ||||||
| Topological domain | 43 – 110 | 68 | Extracellular Potential | ||||||
| Transmembrane | 111 – 131 | 21 | Helical; Potential | ||||||
| Topological domain | 132 – 182 | 51 | Cytoplasmic Potential | ||||||
| Transmembrane | 183 – 203 | 21 | Helical; Potential | ||||||
| Topological domain | 204 – 267 | 64 | Extracellular Potential | ||||||
| Transmembrane | 268 – 288 | 21 | Helical; Potential | ||||||
| Topological domain | 289 – 372 | 84 | Cytoplasmic Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 2 – 119 | 118 | LDIFR…FCLFF → MGRHCHVPKQTHHIQFAQLA QSPAVCGLSESAANLRYKLL LICHRVGIKIPRQKKIPTTY NE in isoform E. | VSP_037474 | |||||
| Alternative sequence | 2 – 116 | 115 | LDIFR…WVCFC → YKPDTLTRRGSLRSLRSAPL LSTVLESTLSLTRIHPIASL ELPGLDYAVHSQSAFGAYGL AHPRDLATCTSLRSGLAAIT AASASAAGGVSQSQSALLGR YGPNASIRHGERKIVQPKRV LSRKLKPHLVADTVKQYISR AQRTTKKGSQEQQNMEFLRG VYAFMQVSRSSVSHVKIDSP VFRLHTNATVILLITFSIAV TTRQYVGNPIDCVHTRDIPE DVLNTYCWIHSTYTVVDAFM KKQGSEVPFPGVHNSQGRGP LTIKHTKYYQWVAFT in isoform D. | VSP_036913 | |||||
| Alternative sequence | 2 – 58 | 57 | LDIFR…CVHTK → VSHVKIDSPVFRLHTNATVI LLITFSIAVTTRQYVGNPID CVHTR in isoform Neural. | VSP_002678 | |||||
| Alternative sequence | 2 – 36 | 35 | LDIFR…VMILM → KKQGSEVPFPGVHNSQGRGP LTIKHTKYYQWVAFT in isoform F. | VSP_036914 | |||||
| Alternative sequence | 37 – 116 | 80 | Missing in isoform F. | VSP_036915 | |||||
| Alternative sequence | 72 – 116 | 45 | QSTYT…WVCFC → HSTYTVVDAFMKKQGSEVPF PGVHNSQGRGPLTIKHTKYY QWVAFT in isoform Neural. | VSP_002679 | |||||
| Alternative sequence | 121 | 1 | A → P in isoform B. | VSP_012897 | |||||
| Alternative sequence | 123 – 372 | 250 | Missing in isoform B. | VSP_012898 | |||||
Experimental info | |||||||||
| Sequence conflict | 232 | 1 | I → M in AAA28745. Ref.2 | ||||||
| Sequence conflict | 232 | 1 | I → M in ABE73233. Ref.7 | ||||||
| Sequence conflict | 247 – 249 | 3 | SGE → GEV in AAC46584. Ref.4 | ||||||
| Isoform D: | |||||||||
| Sequence conflict | 3 | 1 | K → E in ABE73233. Ref.7 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Analysis of a cDNA from the neurologically active locus shaking-B (Passover) of Drosophila melanogaster." Crompton D.E., Griffin A., Davies J.A., Miklos G.L.G. Gene 122:385-386(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM B). Strain: Oregon-R. Tissue: Embryo. |
| [2] | "Passover: a gene required for synaptic connectivity in the giant fiber system of Drosophila." Krishnan S.N., Frei E., Swain G.P., Wyman R.J. Cell 73:967-977(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM NEURAL), DISRUPTION PHENOTYPE. Strain: Oregon-R. Tissue: Pupae. |
| [3] | "Essential and neural transcripts from the Drosophila shaking-B locus are differentially expressed in the embryonic mesoderm and pupal nervous system." Crompton D., Todman M., Wilkin M., Ji S., Davies J. Dev. Biol. 170:142-158(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM LETHAL). Tissue: Embryo. |
| [4] | "Molecular basis of intracistronic complementation in the Passover locus of Drosophila." Krishnan S.N., Frei E., Schalet A.P., Wyman R.J. Proc. Natl. Acad. Sci. U.S.A. 92:2021-2025(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM LETHAL). |
| [5] | "The genome sequence of Drosophila melanogaster." Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D. Venter J.C.Science 287:2185-2195(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: Berkeley. |
| [6] | "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review." Misra S., Crosby M.A., Mungall C.J., Matthews B.B., Campbell K.S., Hradecky P., Huang Y., Kaminker J.S., Millburn G.H., Prochnik S.E., Smith C.D., Tupy J.L., Whitfield E.J., Bayraktaroglu L., Berman B.P., Bettencourt B.R., Celniker S.E., de Grey A.D.N.J. Lewis S.E.Genome Biol. 3:RESEARCH0083.1-RESEARCH0083.22(2002) [PubMed] [Europe PMC] [Abstract] Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING. Strain: Berkeley. |
| [7] | Stapleton M., Carlson J.W., Chavez C., Frise E., George R.A., Pacleb J.M., Park S., Wan K.H., Yu C., Celniker S.E. Submitted (APR-2006) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM D). Strain: Berkeley. |
| [8] | "The shaking B gene in Drosophila regulates the number of gap junctions between photoreceptor terminals in the lamina." Shimohigashi M., Meinertzhagen I.A. J. Neurobiol. 35:105-117(1998) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [9] | "Drosophila Shaking-B protein forms gap junctions in paired Xenopus oocytes." Phelan P., Stebbings L.A., Baines R.A., Bacon J.P., Davies J.A., Ford C. Nature 391:181-184(1998) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBUNIT. |
| [10] | "Nested transcripts of gap junction gene have distinct expression patterns." Zhang Z., Curtin K.D., Sun Y.A., Wyman R.J. J. Neurobiol. 40:288-301(1999) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | M98872 mRNA. Translation: AAA89079.1. X65103 mRNA. Translation: CAA46228.1. L13306 mRNA. Translation: AAA28745.1. S78495 mRNA. Translation: AAB34769.1. U17330 mRNA. Translation: AAC46584.1. AE014298 Genomic DNA. Translation: AAF50880.2. AE014298 Genomic DNA. Translation: AAF50882.2. AE014298 Genomic DNA. Translation: AAF50883.1. AE014298 Genomic DNA. Translation: ABW09456.2. AE014298 Genomic DNA. Translation: ACL82952.1. BT025062 mRNA. Translation: ABE73233.1. |
| PIR | A40734. JN0441. |
| RefSeq | NP_001097038.2. NM_001103568.2. NP_001138222.1. NM_001144750.1. NP_523425.2. NM_078701.3. NP_608410.2. NM_134566.2. NP_728361.1. NM_170660.1. |
| UniGene | Dm.2607. |
3D structure databases | |
| ModBase | Search... |
Protein family/group databases | |
| TCDB | 1.A.25.1.4. gap junction-forming innexin family. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| EnsemblMetazoa | FBtr0112571; FBpp0111483; FBgn0085387. |
| GeneID | 33062. |
| KEGG | dme:Dmel_CG34358. |
Organism-specific databases | |
| CTD | 33062. |
| FlyBase | FBgn0085387. shakB. |
Phylogenomic databases | |
| eggNOG | NOG74896. |
| GeneTree | ENSGT00530000064205. |
| InParanoid | Q9VRC2. |
| OMA | CAPRIRY. |
| OrthoDB | EOG4QBZMV. |
Gene expression databases | |
| Bgee | P33085. |
| GermOnline | CG32508. Drosophila melanogaster. |
Family and domain databases | |
| InterPro | IPR000990. Innexin. [Graphical view] |
| PANTHER | PTHR11893. PTHR11893. 1 hit. |
| Pfam | PF00876. Innexin. 1 hit. [Graphical view] |
| PRINTS | PR01262. INNEXIN. |
| PROSITE | PS51013. PANNEXIN. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 33062. |
| NextBio | 781749. |
Entry information
| Entry name | SHAKB_DROME | ||||||||
| Accession | Primary (citable) accession number: P33085 Secondary accession number(s): A8JUT3 Q9VRC2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Drosophila annotation project | ||||||||
Relevant documents
| Drosophila Drosophila: entries, gene names and cross-references to FlyBase |
| SIMILARITY comments Index of protein domains and families |

Clusters with
