Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P33076

- C2TA_HUMAN

UniProt

P33076 - C2TA_HUMAN

Protein

MHC class II transactivator

Gene

CIITA

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 148 (01 Oct 2014)
      Sequence version 3 (11 Jan 2011)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Essential for transcriptional activity of the HLA class II promoter; activation is via the proximal promoter. No DNA binding of in vitro translated CIITA was detected. May act in a coactivator-like fashion through protein-protein interactions by contacting factors binding to the proximal MHC class II promoter, to elements of the transcription machinery, or both. Alternatively it may activate HLA class II transcription by modifying proteins that bind to the MHC class II promoter. Also mediates enhanced MHC class I transcription; the promoter element requirements for CIITA-mediated transcription are distinct from those of constitutive MHC class I transcription, and CIITA can functionally replace TAF1 at these genes. Exhibits intrinsic GTP-stimulated acetyltransferase activity. Exhibits serine/threonine protein kinase activity: can phosphorylate the TFIID component TAF7, the RAP74 subunit of the general transcription factor TFIIF, histone H2B at 'Ser-37' and other histones (in vitro).4 Publications

    Catalytic activityi

    ATP + a protein = ADP + a phosphoprotein.1 Publication

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi420 – 4278GTP

    GO - Molecular functioni

    1. activating transcription factor binding Source: BHF-UCL
    2. ATP binding Source: UniProtKB-KW
    3. GTP binding Source: UniProtKB-KW
    4. kinase activity Source: UniProtKB-KW
    5. protein binding Source: UniProtKB
    6. protein complex binding Source: UniProtKB
    7. protein C-terminus binding Source: UniProtKB
    8. transcription coactivator activity Source: ProtInc
    9. transcription regulatory region DNA binding Source: BHF-UCL
    10. transferase activity, transferring acyl groups Source: UniProtKB-KW

    GO - Biological processi

    1. aging Source: Ensembl
    2. cellular response to electrical stimulus Source: Ensembl
    3. cellular response to exogenous dsRNA Source: Ensembl
    4. cytokine-mediated signaling pathway Source: Reactome
    5. immune response Source: ProtInc
    6. inflammatory response Source: Ensembl
    7. interferon-gamma-mediated signaling pathway Source: Reactome
    8. negative regulation of collagen biosynthetic process Source: BHF-UCL
    9. negative regulation of transcription, DNA-templated Source: BHF-UCL
    10. negative regulation of transcription from RNA polymerase II promoter Source: BHF-UCL
    11. positive regulation of MHC class I biosynthetic process Source: BHF-UCL
    12. positive regulation of MHC class II biosynthetic process Source: BHF-UCL
    13. positive regulation of transcription, DNA-templated Source: BHF-UCL
    14. positive regulation of transcription from RNA polymerase II promoter Source: BHF-UCL
    15. response to antibiotic Source: MGI
    16. response to interferon-gamma Source: BHF-UCL
    17. transcription, DNA-templated Source: UniProtKB-KW

    Keywords - Molecular functioni

    Activator, Acyltransferase, Kinase, Transferase

    Keywords - Biological processi

    Transcription, Transcription regulation

    Keywords - Ligandi

    ATP-binding, GTP-binding, Nucleotide-binding

    Enzyme and pathway databases

    ReactomeiREACT_25078. Interferon gamma signaling.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    MHC class II transactivator (EC:2.3.1.-, EC:2.7.11.1)
    Short name:
    CIITA
    Gene namesi
    Name:CIITA
    Synonyms:MHC2TA
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 16

    Organism-specific databases

    HGNCiHGNC:7067. CIITA.

    Subcellular locationi

    Nucleus 1 Publication. NucleusPML body 1 Publication
    Note: Recruited to PML body by PML.

    GO - Cellular componenti

    1. cell surface Source: Ensembl
    2. nucleoplasm Source: Reactome
    3. PML body Source: UniProtKB

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Involvement in diseasei

    Bare lymphocyte syndrome 2 (BLS2) [MIM:209920]: A severe combined immunodeficiency disease with early onset. It is characterized by a profound defect in constitutive and interferon-gamma induced MHC II expression, absence of cellular and humoral T-cell response to antigen challenge, hypogammaglobulinemia and impaired antibody production. The consequence include extreme susceptibility to viral, bacterial and fungal infections.5 Publications
    Note: The disease is caused by mutations affecting the gene represented in this entry.
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti120 – 1201K → IE in BLS2.
    VAR_005127
    Natural varianti469 – 4691L → P in BLS2; mild immunodeficiency; has residual MHC class II trans activation activity. 1 Publication
    VAR_015551
    Natural varianti940 – 96324Missing in BLS2.
    VAR_005129Add
    BLAST
    Natural varianti962 – 9621F → S in BLS2. 1 Publication
    VAR_015553
    Natural varianti964 – 99128Missing in BLS2.
    VAR_015554Add
    BLAST
    Natural varianti1027 – 10271Missing in BLS2. 1 Publication
    VAR_015555

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi420 – 4212Missing: Strongly reduces GTP-binding and abolishes transactivation at MHC promoters.
    Mutagenesisi561 – 5611D → A: Strongly reduces GTP-binding and abolishes transactivation at MHC promoters. 1 Publication

    Keywords - Diseasei

    Disease mutation, SCID

    Organism-specific databases

    MIMi209920. phenotype.
    Orphaneti572. Immunodeficiency by defective expression of HLA class 2.
    PharmGKBiPA30795.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 11301130MHC class II transactivatorPRO_0000089241Add
    BLAST

    Post-translational modificationi

    Autophosphorylated, affecting interaction with TAF7.

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    PaxDbiP33076.
    PRIDEiP33076.

    PTM databases

    PhosphoSiteiP33076.

    Expressioni

    Gene expression databases

    ArrayExpressiP33076.
    BgeeiP33076.
    CleanExiHS_CIITA.
    GenevestigatoriP33076.

    Organism-specific databases

    HPAiCAB016084.

    Interactioni

    Subunit structurei

    Interacts with ZXDA and ZXDC. Interacts with PML (isoform PML-2).3 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    SIRT1Q96EB64EBI-1538819,EBI-1802965
    ZXDAP981684EBI-1538819,EBI-1538980
    ZXDCQ2QGD76EBI-1538819,EBI-1538838

    Protein-protein interaction databases

    BioGridi110416. 19 interactions.
    IntActiP33076. 3 interactions.
    STRINGi9606.ENSP00000316328.

    Structurei

    3D structure databases

    ProteinModelPortaliP33076.
    SMRiP33076. Positions 416-501, 832-878, 951-1120.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini414 – 724311NACHTPROSITE-ProRule annotationAdd
    BLAST
    Repeati985 – 100824LRR 1Add
    BLAST
    Repeati1016 – 103722LRR 2Add
    BLAST
    Repeati1045 – 106622LRR 3Add
    BLAST
    Repeati1073 – 109321LRR 4Add
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni94 – 13239Required for acetyltransferase activityAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi52 – 13786Asp/Glu-rich (acidic)Add
    BLAST

    Domaini

    The acetyltransferase domain is necessary for activation of both class I and class II transcription.
    The GTP-binding motif doesn't confer GTPase activity but promotes nuclear localization.

    Sequence similaritiesi

    Contains 4 LRR (leucine-rich) repeats.Curated
    Contains 1 NACHT domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Leucine-rich repeat, Repeat

    Phylogenomic databases

    eggNOGiNOG269671.
    HOGENOMiHOG000107439.
    HOVERGENiHBG000174.
    KOiK08060.
    OMAiQKRPFPE.
    OrthoDBiEOG7P5T07.
    PhylomeDBiP33076.
    TreeFamiTF352118.

    Family and domain databases

    InterProiIPR001611. Leu-rich_rpt.
    IPR025875. Leu-rich_rpt_4.
    IPR008095. MHC_II_transact.
    IPR007111. NACHT_NTPase.
    IPR027417. P-loop_NTPase.
    [Graphical view]
    PfamiPF12799. LRR_4. 1 hit.
    [Graphical view]
    PRINTSiPR01719. MHCIIACTVATR.
    SUPFAMiSSF52540. SSF52540. 1 hit.
    PROSITEiPS51450. LRR. 4 hits.
    PS50837. NACHT. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P33076-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MRCLAPRPAG SYLSEPQGSS QCATMELGPL EGGYLELLNS DADPLCLYHF     50
    YDQMDLAGEE EIELYSEPDT DTINCDQFSR LLCDMEGDEE TREAYANIAE 100
    LDQYVFQDSQ LEGLSKDIFK HIGPDEVIGE SMEMPAEVGQ KSQKRPFPEE 150
    LPADLKHWKP AEPPTVVTGS LLVRPVSDCS TLPCLPLPAL FNQEPASGQM 200
    RLEKTDQIPM PFSSSSLSCL NLPEGPIQFV PTISTLPHGL WQISEAGTGV 250
    SSIFIYHGEV PQASQVPPPS GFTVHGLPTS PDRPGSTSPF APSATDLPSM 300
    PEPALTSRAN MTEHKTSPTQ CPAAGEVSNK LPKWPEPVEQ FYRSLQDTYG 350
    AEPAGPDGIL VEVDLVQARL ERSSSKSLER ELATPDWAER QLAQGGLAEV 400
    LLAAKEHRRP RETRVIAVLG KAGQGKSYWA GAVSRAWACG RLPQYDFVFS 450
    VPCHCLNRPG DAYGLQDLLF SLGPQPLVAA DEVFSHILKR PDRVLLILDG 500
    FEELEAQDGF LHSTCGPAPA EPCSLRGLLA GLFQKKLLRG CTLLLTARPR 550
    GRLVQSLSKA DALFELSGFS MEQAQAYVMR YFESSGMTEH QDRALTLLRD 600
    RPLLLSHSHS PTLCRAVCQL SEALLELGED AKLPSTLTGL YVGLLGRAAL 650
    DSPPGALAEL AKLAWELGRR HQSTLQEDQF PSADVRTWAM AKGLVQHPPR 700
    AAESELAFPS FLLQCFLGAL WLALSGEIKD KELPQYLALT PRKKRPYDNW 750
    LEGVPRFLAG LIFQPPARCL GALLGPSAAA SVDRKQKVLA RYLKRLQPGT 800
    LRARQLLELL HCAHEAEEAG IWQHVVQELP GRLSFLGTRL TPPDAHVLGK 850
    ALEAAGQDFS LDLRSTGICP SGLGSLVGLS CVTRFRAALS DTVALWESLQ 900
    QHGETKLLQA AEEKFTIEPF KAKSLKDVED LGKLVQTQRT RSSSEDTAGE 950
    LPAVRDLKKL EFALGPVSGP QAFPKLVRIL TAFSSLQHLD LDALSENKIG 1000
    DEGVSQLSAT FPQLKSLETL NLSQNNITDL GAYKLAEALP SLAASLLRLS 1050
    LYNNCICDVG AESLARVLPD MVSLRVMDVQ YNKFTAAGAQ QLAASLRRCP 1100
    HVETLAMWTP TIPFSVQEHL QQQDSRISLR 1130
    Length:1,130
    Mass (Da):123,514
    Last modified:January 11, 2011 - v3
    Checksum:i7A61CAA4F3FFECE0
    GO
    Isoform 2 (identifier: P33076-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         161-210: AEPPTVVTGSLLVRPVSDCSTLPCLPLPALFNQEPASGQMRLEKTDQIPM → V
         887-930: AALSDTVALW...KAKSLKDVED → WGEGLGRDIL...RVGQNGFSPF
         931-1128: Missing.

    Show »
    Length:883
    Mass (Da):96,429
    Checksum:iC2D59921C3D5F6C5
    GO
    Isoform 3 (identifier: P33076-3) [UniParc]FASTAAdd to Basket

    Also known as: hCIITA'

    The sequence of this isoform differs from the canonical sequence as follows:
         161-210: AEPPTVVTGSLLVRPVSDCSTLPCLPLPALFNQEPASGQMRLEKTDQIPM → V
         336-350: EPVEQFYRSLQDTYG → GLAWSPCLGLRPSLH
         351-885: Missing.

    Note: Exhibits dominant-negative suppression of MHC class II gene expression.

    Show »
    Length:546
    Mass (Da):59,641
    Checksum:i95471F528074C11A
    GO
    Isoform 4 (identifier: P33076-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         887-930: AALSDTVALW...KAKSLKDVED → WGEGLGRDIL...RVGQNGFSPF
         931-1128: Missing.

    Show »
    Length:932
    Mass (Da):101,661
    Checksum:i1C9D9F9BF43DD142
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti1020 – 10212LN → RS in ABK41930. (PubMed:12859996)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti45 – 451L → V.
    Corresponds to variant rs2229317 [ dbSNP | Ensembl ].
    VAR_029270
    Natural varianti120 – 1201K → IE in BLS2.
    VAR_005127
    Natural varianti174 – 1741R → G.4 Publications
    Corresponds to variant rs8046121 [ dbSNP | Ensembl ].
    VAR_047907
    Natural varianti469 – 4691L → P in BLS2; mild immunodeficiency; has residual MHC class II trans activation activity. 1 Publication
    VAR_015551
    Natural varianti500 – 5001G → A.3 Publications
    Corresponds to variant rs4774 [ dbSNP | Ensembl ].
    VAR_005128
    Natural varianti658 – 6581A → G.
    Corresponds to variant rs2229319 [ dbSNP | Ensembl ].
    VAR_015552
    Natural varianti781 – 7811S → L.
    Corresponds to variant rs13330686 [ dbSNP | Ensembl ].
    VAR_060104
    Natural varianti782 – 7821V → A.
    Corresponds to variant rs13336804 [ dbSNP | Ensembl ].
    VAR_057711
    Natural varianti900 – 9001Q → R.4 Publications
    Corresponds to variant rs7197779 [ dbSNP | Ensembl ].
    VAR_047908
    Natural varianti940 – 96324Missing in BLS2.
    VAR_005129Add
    BLAST
    Natural varianti962 – 9621F → S in BLS2. 1 Publication
    VAR_015553
    Natural varianti964 – 99128Missing in BLS2.
    VAR_015554Add
    BLAST
    Natural varianti1027 – 10271Missing in BLS2. 1 Publication
    VAR_015555

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei161 – 21050AEPPT…DQIPM → V in isoform 2 and isoform 3. 2 PublicationsVSP_055099Add
    BLAST
    Alternative sequencei336 – 35015EPVEQ…QDTYG → GLAWSPCLGLRPSLH in isoform 3. 1 PublicationVSP_055100Add
    BLAST
    Alternative sequencei351 – 885535Missing in isoform 3. 1 PublicationVSP_055101Add
    BLAST
    Alternative sequencei887 – 93044AALSD…KDVED → WGEGLGRDILVLGINCGLGA KPSALWGPFSMQSSRVGQNG FSPF in isoform 2 and isoform 4. 2 PublicationsVSP_055102Add
    BLAST
    Alternative sequencei931 – 1128198Missing in isoform 2 and isoform 4. 2 PublicationsVSP_055103Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X74301 mRNA. Translation: CAA52354.1.
    U18259 mRNA. Translation: AAA88861.1.
    U18288 mRNA. Translation: AAA88862.1.
    AY084054 mRNA. Translation: AAM15723.1.
    AF410154 mRNA. Translation: AAL04118.1.
    EF064747 Genomic DNA. Translation: ABK41930.1.
    AC133065 Genomic DNA. No translation available.
    CH471112 Genomic DNA. Translation: EAW85169.1.
    CH471112 Genomic DNA. Translation: EAW85172.1.
    CH471112 Genomic DNA. Translation: EAW85173.1.
    CCDSiCCDS10544.1. [P33076-1]
    CCDS66943.1. [P33076-3]
    PIRiA48843.
    RefSeqiNP_000237.2. NM_000246.3.
    NP_001273332.1. NM_001286403.1.
    UniGeneiHs.701991.

    Genome annotation databases

    EnsembliENST00000324288; ENSP00000316328; ENSG00000179583. [P33076-1]
    ENST00000381835; ENSP00000371257; ENSG00000179583. [P33076-3]
    GeneIDi4261.
    KEGGihsa:4261.
    UCSCiuc002dag.2. human. [P33076-1]

    Polymorphism databases

    DMDMi317373472.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    CIITAbase

    CIITA mutation db

    Atlas of Genetics and Cytogenetics in Oncology and Haematology

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X74301 mRNA. Translation: CAA52354.1 .
    U18259 mRNA. Translation: AAA88861.1 .
    U18288 mRNA. Translation: AAA88862.1 .
    AY084054 mRNA. Translation: AAM15723.1 .
    AF410154 mRNA. Translation: AAL04118.1 .
    EF064747 Genomic DNA. Translation: ABK41930.1 .
    AC133065 Genomic DNA. No translation available.
    CH471112 Genomic DNA. Translation: EAW85169.1 .
    CH471112 Genomic DNA. Translation: EAW85172.1 .
    CH471112 Genomic DNA. Translation: EAW85173.1 .
    CCDSi CCDS10544.1. [P33076-1 ]
    CCDS66943.1. [P33076-3 ]
    PIRi A48843.
    RefSeqi NP_000237.2. NM_000246.3.
    NP_001273332.1. NM_001286403.1.
    UniGenei Hs.701991.

    3D structure databases

    ProteinModelPortali P33076.
    SMRi P33076. Positions 416-501, 832-878, 951-1120.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 110416. 19 interactions.
    IntActi P33076. 3 interactions.
    STRINGi 9606.ENSP00000316328.

    PTM databases

    PhosphoSitei P33076.

    Polymorphism databases

    DMDMi 317373472.

    Proteomic databases

    PaxDbi P33076.
    PRIDEi P33076.

    Protocols and materials databases

    DNASUi 4261.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000324288 ; ENSP00000316328 ; ENSG00000179583 . [P33076-1 ]
    ENST00000381835 ; ENSP00000371257 ; ENSG00000179583 . [P33076-3 ]
    GeneIDi 4261.
    KEGGi hsa:4261.
    UCSCi uc002dag.2. human. [P33076-1 ]

    Organism-specific databases

    CTDi 4261.
    GeneCardsi GC16P010879.
    HGNCi HGNC:7067. CIITA.
    HPAi CAB016084.
    MIMi 209920. phenotype.
    600005. gene.
    neXtProti NX_P33076.
    Orphaneti 572. Immunodeficiency by defective expression of HLA class 2.
    PharmGKBi PA30795.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG269671.
    HOGENOMi HOG000107439.
    HOVERGENi HBG000174.
    KOi K08060.
    OMAi QKRPFPE.
    OrthoDBi EOG7P5T07.
    PhylomeDBi P33076.
    TreeFami TF352118.

    Enzyme and pathway databases

    Reactomei REACT_25078. Interferon gamma signaling.

    Miscellaneous databases

    GeneWikii CIITA.
    GenomeRNAii 4261.
    NextBioi 16805.
    PROi P33076.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P33076.
    Bgeei P33076.
    CleanExi HS_CIITA.
    Genevestigatori P33076.

    Family and domain databases

    InterProi IPR001611. Leu-rich_rpt.
    IPR025875. Leu-rich_rpt_4.
    IPR008095. MHC_II_transact.
    IPR007111. NACHT_NTPase.
    IPR027417. P-loop_NTPase.
    [Graphical view ]
    Pfami PF12799. LRR_4. 1 hit.
    [Graphical view ]
    PRINTSi PR01719. MHCIIACTVATR.
    SUPFAMi SSF52540. SSF52540. 1 hit.
    PROSITEi PS51450. LRR. 4 hits.
    PS50837. NACHT. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complementation cloning of an MHC class II transactivator mutated in hereditary MHC class II deficiency (or bare lymphocyte syndrome)."
      Steimle V., Otten L.A., Zufferey M., Mach B.
      Cell 75:135-146(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS BLS2 LYS-120 DEL ILE-GLU INS AND 940-THR--ALA-963 DEL, VARIANTS GLY-174; ALA-500 AND ARG-900.
    2. "Activation of class II MHC genes requires both the X box region and the class II transactivator (CIITA)."
      Riley J.L., Westerheide S.D., Price J.A., Brown J.A., Boss J.M.
      Immunity 2:533-543(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), VARIANTS BLS2 LYS-120 DEL ILE-GLU INS; GLY-174; ALA-500 AND ARG-900, ALTERNATIVE SPLICING.
    3. "Structural and functional characteristics of a dominant-negative isoform of porcine MHC class II transactivator."
      Quinn G., Bower R., Dos-Santos Cruz G., Giovino M., Xu Y., Patience C., Schuurman H.J.
      Eur. J. Immunogenet. 30:259-270(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), VARIANT ARG-900, ALTERNATIVE SPLICING.
    4. "K-562 cells lack MHC class II expression due to an alternatively spliced CIITA transcript with a truncated coding region."
      Day N.E., Ugai H., Yokoyama K.K., Ichiki A.T.
      Leuk. Res. 27:1027-1038(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), VARIANTS GLY-174 AND ALA-500, ALTERNATIVE SPLICING.
    5. Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS GLY-174 AND ARG-900.
    6. "The sequence and analysis of duplication-rich human chromosome 16."
      Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
      , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
      Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. "GTP binding by class II transactivator: role in nuclear import."
      Harton J.A., Cressman D.E., Chin K.C., Der C.J., Ting J.P.
      Science 285:1402-1405(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: GTP-BINDING, MUTAGENESIS OF 420-GLY-LYS-421 AND ASP-561.
    9. "Transcriptional coactivator, CIITA, is an acetyltransferase that bypasses a promoter requirement for TAF(II)250."
      Raval A., Howcroft T.K., Weissman J.D., Kirshner S., Zhu X.S., Yokoyama K., Ting J., Singer D.S.
      Mol. Cell 7:105-115(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION AS ACETYLTRANSFERASE, GTP-BINDING, ACETYLTRANSFERASE REGION.
    10. "The zinc finger proteins ZXDA and ZXDC form a complex that binds CIITA and regulates MHC II gene transcription."
      Al-Kandari W., Koneni R., Navalgund V., Aleksandrova A., Jambunathan S., Fontes J.D.
      J. Mol. Biol. 369:1175-1187(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH ZXDA AND ZXDC.
    11. "ZXDC, a novel zinc finger protein that binds CIITA and activates MHC gene transcription."
      Al-Kandari W., Jambunathan S., Navalgund V., Koneni R., Freer M., Parimi N., Mudhasani R., Fontes J.D.
      Mol. Immunol. 44:311-321(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH ZXDC.
    12. "PML promotes MHC class II gene expression by stabilizing the class II transactivator."
      Ulbricht T., Alzrigat M., Horch A., Reuter N., von Mikecz A., Steimle V., Schmitt E., Kraemer O.H., Stamminger T., Hemmerich P.
      J. Cell Biol. 199:49-63(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION, INTERACTION WITH PML.
    13. "Transcriptional coactivator CIITA, a functional homolog of TAF1, has kinase activity."
      Soe K.C., Devaiah B.N., Singer D.S.
      Biochim. Biophys. Acta 1829:1184-1190(2013) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION AS KINASE, CATALYTIC ACTIVITY, AUTOPHOSPHORYLATION.
    14. "Absence of MHC class II gene expression in a patient with a single amino acid substitution in the class II transactivator protein CIITA."
      Quan V., Towey M., Sacks S., Kelly A.P.
      Immunogenetics 49:957-963(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANT BLS2 GROUP A SER-962.
    15. Cited for: VARIANT BLS2 GROUP A PRO-469.
    16. Cited for: VARIANTS BLS2 GROUP A 964-LEU--ASP-991 DEL AND ILE-1027 DEL.

    Entry informationi

    Entry nameiC2TA_HUMAN
    AccessioniPrimary (citable) accession number: P33076
    Secondary accession number(s): A0N0N9
    , D3DUG0, E9PFE0, Q29675, Q8SNB8, Q96KL4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 1, 1993
    Last sequence update: January 11, 2011
    Last modified: October 1, 2014
    This is version 148 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 16
      Human chromosome 16: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3