Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P33076

- C2TA_HUMAN

UniProt

P33076 - C2TA_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

MHC class II transactivator

Gene

CIITA

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Essential for transcriptional activity of the HLA class II promoter; activation is via the proximal promoter. No DNA binding of in vitro translated CIITA was detected. May act in a coactivator-like fashion through protein-protein interactions by contacting factors binding to the proximal MHC class II promoter, to elements of the transcription machinery, or both. Alternatively it may activate HLA class II transcription by modifying proteins that bind to the MHC class II promoter. Also mediates enhanced MHC class I transcription; the promoter element requirements for CIITA-mediated transcription are distinct from those of constitutive MHC class I transcription, and CIITA can functionally replace TAF1 at these genes. Exhibits intrinsic GTP-stimulated acetyltransferase activity. Exhibits serine/threonine protein kinase activity: can phosphorylate the TFIID component TAF7, the RAP74 subunit of the general transcription factor TFIIF, histone H2B at 'Ser-37' and other histones (in vitro).4 Publications

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.1 Publication

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi420 – 4278GTP

GO - Molecular functioni

  1. activating transcription factor binding Source: BHF-UCL
  2. ATP binding Source: UniProtKB-KW
  3. GTP binding Source: UniProtKB-KW
  4. kinase activity Source: UniProtKB-KW
  5. protein complex binding Source: UniProtKB
  6. protein C-terminus binding Source: UniProtKB
  7. transcription coactivator activity Source: ProtInc
  8. transcription regulatory region DNA binding Source: BHF-UCL
  9. transferase activity, transferring acyl groups Source: UniProtKB-KW

GO - Biological processi

  1. aging Source: Ensembl
  2. cellular response to electrical stimulus Source: Ensembl
  3. cellular response to exogenous dsRNA Source: Ensembl
  4. cytokine-mediated signaling pathway Source: Reactome
  5. immune response Source: ProtInc
  6. inflammatory response Source: Ensembl
  7. interferon-gamma-mediated signaling pathway Source: Reactome
  8. negative regulation of collagen biosynthetic process Source: BHF-UCL
  9. negative regulation of transcription, DNA-templated Source: BHF-UCL
  10. negative regulation of transcription from RNA polymerase II promoter Source: BHF-UCL
  11. positive regulation of MHC class I biosynthetic process Source: BHF-UCL
  12. positive regulation of MHC class II biosynthetic process Source: BHF-UCL
  13. positive regulation of transcription, DNA-templated Source: BHF-UCL
  14. positive regulation of transcription from RNA polymerase II promoter Source: BHF-UCL
  15. response to antibiotic Source: MGI
  16. response to interferon-gamma Source: BHF-UCL
  17. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Activator, Acyltransferase, Kinase, Transferase

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

ATP-binding, GTP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiREACT_25078. Interferon gamma signaling.

Names & Taxonomyi

Protein namesi
Recommended name:
MHC class II transactivator (EC:2.3.1.-, EC:2.7.11.1)
Short name:
CIITA
Gene namesi
Name:CIITA
Synonyms:MHC2TA
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 16

Organism-specific databases

HGNCiHGNC:7067. CIITA.

Subcellular locationi

Nucleus 1 Publication. NucleusPML body 1 Publication
Note: Recruited to PML body by PML.

GO - Cellular componenti

  1. cell surface Source: Ensembl
  2. nucleoplasm Source: Reactome
  3. PML body Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Involvement in diseasei

Bare lymphocyte syndrome 2 (BLS2) [MIM:209920]: A severe combined immunodeficiency disease with early onset. It is characterized by a profound defect in constitutive and interferon-gamma induced MHC II expression, absence of cellular and humoral T-cell response to antigen challenge, hypogammaglobulinemia and impaired antibody production. The consequence include extreme susceptibility to viral, bacterial and fungal infections.5 Publications
Note: The disease is caused by mutations affecting the gene represented in this entry.
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti120 – 1201K → IE in BLS2.
VAR_005127
Natural varianti469 – 4691L → P in BLS2; mild immunodeficiency; has residual MHC class II trans activation activity. 1 Publication
VAR_015551
Natural varianti940 – 96324Missing in BLS2. 1 Publication
VAR_005129Add
BLAST
Natural varianti962 – 9621F → S in BLS2. 1 Publication
VAR_015553
Natural varianti964 – 99128Missing in BLS2.
VAR_015554Add
BLAST
Natural varianti1027 – 10271Missing in BLS2. 1 Publication
VAR_015555

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi420 – 4212Missing: Strongly reduces GTP-binding and abolishes transactivation at MHC promoters. 1 Publication
Mutagenesisi561 – 5611D → A: Strongly reduces GTP-binding and abolishes transactivation at MHC promoters. 1 Publication

Keywords - Diseasei

Disease mutation, SCID

Organism-specific databases

MIMi209920. phenotype.
Orphaneti572. Immunodeficiency by defective expression of HLA class 2.
PharmGKBiPA30795.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 11301130MHC class II transactivatorPRO_0000089241Add
BLAST

Post-translational modificationi

Autophosphorylated, affecting interaction with TAF7.

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiP33076.
PRIDEiP33076.

PTM databases

PhosphoSiteiP33076.

Expressioni

Gene expression databases

BgeeiP33076.
CleanExiHS_CIITA.
ExpressionAtlasiP33076. baseline and differential.
GenevestigatoriP33076.

Organism-specific databases

HPAiCAB016084.

Interactioni

Subunit structurei

Interacts with ZXDA and ZXDC. Interacts with PML (isoform PML-2).3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
SIRT1Q96EB64EBI-1538819,EBI-1802965
ZXDAP981684EBI-1538819,EBI-1538980
ZXDCQ2QGD76EBI-1538819,EBI-1538838

Protein-protein interaction databases

BioGridi110416. 20 interactions.
IntActiP33076. 3 interactions.
STRINGi9606.ENSP00000316328.

Structurei

3D structure databases

ProteinModelPortaliP33076.
SMRiP33076. Positions 1009-1120.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini414 – 724311NACHTPROSITE-ProRule annotationAdd
BLAST
Repeati985 – 100824LRR 1Add
BLAST
Repeati1016 – 103722LRR 2Add
BLAST
Repeati1045 – 106622LRR 3Add
BLAST
Repeati1073 – 109321LRR 4Add
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni94 – 13239Required for acetyltransferase activityAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi52 – 13786Asp/Glu-rich (acidic)Add
BLAST

Domaini

The acetyltransferase domain is necessary for activation of both class I and class II transcription.
The GTP-binding motif doesn't confer GTPase activity but promotes nuclear localization.

Sequence similaritiesi

Contains 4 LRR (leucine-rich) repeats.Curated
Contains 1 NACHT domain.PROSITE-ProRule annotation

Keywords - Domaini

Leucine-rich repeat, Repeat

Phylogenomic databases

eggNOGiNOG269671.
GeneTreeiENSGT00710000106284.
HOGENOMiHOG000107439.
HOVERGENiHBG000174.
InParanoidiP33076.
KOiK08060.
OMAiQKRPFPE.
OrthoDBiEOG7P5T07.
PhylomeDBiP33076.
TreeFamiTF352118.

Family and domain databases

InterProiIPR001611. Leu-rich_rpt.
IPR025875. Leu-rich_rpt_4.
IPR008095. MHC_II_transact.
IPR007111. NACHT_NTPase.
IPR027417. P-loop_NTPase.
[Graphical view]
PfamiPF12799. LRR_4. 1 hit.
[Graphical view]
PRINTSiPR01719. MHCIIACTVATR.
SUPFAMiSSF52540. SSF52540. 1 hit.
PROSITEiPS51450. LRR. 4 hits.
PS50837. NACHT. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P33076-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRCLAPRPAG SYLSEPQGSS QCATMELGPL EGGYLELLNS DADPLCLYHF
60 70 80 90 100
YDQMDLAGEE EIELYSEPDT DTINCDQFSR LLCDMEGDEE TREAYANIAE
110 120 130 140 150
LDQYVFQDSQ LEGLSKDIFK HIGPDEVIGE SMEMPAEVGQ KSQKRPFPEE
160 170 180 190 200
LPADLKHWKP AEPPTVVTGS LLVRPVSDCS TLPCLPLPAL FNQEPASGQM
210 220 230 240 250
RLEKTDQIPM PFSSSSLSCL NLPEGPIQFV PTISTLPHGL WQISEAGTGV
260 270 280 290 300
SSIFIYHGEV PQASQVPPPS GFTVHGLPTS PDRPGSTSPF APSATDLPSM
310 320 330 340 350
PEPALTSRAN MTEHKTSPTQ CPAAGEVSNK LPKWPEPVEQ FYRSLQDTYG
360 370 380 390 400
AEPAGPDGIL VEVDLVQARL ERSSSKSLER ELATPDWAER QLAQGGLAEV
410 420 430 440 450
LLAAKEHRRP RETRVIAVLG KAGQGKSYWA GAVSRAWACG RLPQYDFVFS
460 470 480 490 500
VPCHCLNRPG DAYGLQDLLF SLGPQPLVAA DEVFSHILKR PDRVLLILDG
510 520 530 540 550
FEELEAQDGF LHSTCGPAPA EPCSLRGLLA GLFQKKLLRG CTLLLTARPR
560 570 580 590 600
GRLVQSLSKA DALFELSGFS MEQAQAYVMR YFESSGMTEH QDRALTLLRD
610 620 630 640 650
RPLLLSHSHS PTLCRAVCQL SEALLELGED AKLPSTLTGL YVGLLGRAAL
660 670 680 690 700
DSPPGALAEL AKLAWELGRR HQSTLQEDQF PSADVRTWAM AKGLVQHPPR
710 720 730 740 750
AAESELAFPS FLLQCFLGAL WLALSGEIKD KELPQYLALT PRKKRPYDNW
760 770 780 790 800
LEGVPRFLAG LIFQPPARCL GALLGPSAAA SVDRKQKVLA RYLKRLQPGT
810 820 830 840 850
LRARQLLELL HCAHEAEEAG IWQHVVQELP GRLSFLGTRL TPPDAHVLGK
860 870 880 890 900
ALEAAGQDFS LDLRSTGICP SGLGSLVGLS CVTRFRAALS DTVALWESLQ
910 920 930 940 950
QHGETKLLQA AEEKFTIEPF KAKSLKDVED LGKLVQTQRT RSSSEDTAGE
960 970 980 990 1000
LPAVRDLKKL EFALGPVSGP QAFPKLVRIL TAFSSLQHLD LDALSENKIG
1010 1020 1030 1040 1050
DEGVSQLSAT FPQLKSLETL NLSQNNITDL GAYKLAEALP SLAASLLRLS
1060 1070 1080 1090 1100
LYNNCICDVG AESLARVLPD MVSLRVMDVQ YNKFTAAGAQ QLAASLRRCP
1110 1120 1130
HVETLAMWTP TIPFSVQEHL QQQDSRISLR
Length:1,130
Mass (Da):123,514
Last modified:January 11, 2011 - v3
Checksum:i7A61CAA4F3FFECE0
GO
Isoform 2 (identifier: P33076-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     161-210: AEPPTVVTGSLLVRPVSDCSTLPCLPLPALFNQEPASGQMRLEKTDQIPM → V
     887-930: AALSDTVALW...KAKSLKDVED → WGEGLGRDIL...RVGQNGFSPF
     931-1128: Missing.

Show »
Length:883
Mass (Da):96,429
Checksum:iC2D59921C3D5F6C5
GO
Isoform 3 (identifier: P33076-3) [UniParc]FASTAAdd to Basket

Also known as: hCIITA'

The sequence of this isoform differs from the canonical sequence as follows:
     161-210: AEPPTVVTGSLLVRPVSDCSTLPCLPLPALFNQEPASGQMRLEKTDQIPM → V
     336-350: EPVEQFYRSLQDTYG → GLAWSPCLGLRPSLH
     351-885: Missing.

Note: Exhibits dominant-negative suppression of MHC class II gene expression.

Show »
Length:546
Mass (Da):59,641
Checksum:i95471F528074C11A
GO
Isoform 4 (identifier: P33076-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     887-930: AALSDTVALW...KAKSLKDVED → WGEGLGRDIL...RVGQNGFSPF
     931-1128: Missing.

Show »
Length:932
Mass (Da):101,661
Checksum:i1C9D9F9BF43DD142
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti1020 – 10212LN → RS in ABK41930. (PubMed:12859996)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti45 – 451L → V.
Corresponds to variant rs2229317 [ dbSNP | Ensembl ].
VAR_029270
Natural varianti120 – 1201K → IE in BLS2.
VAR_005127
Natural varianti174 – 1741R → G.4 Publications
Corresponds to variant rs8046121 [ dbSNP | Ensembl ].
VAR_047907
Natural varianti469 – 4691L → P in BLS2; mild immunodeficiency; has residual MHC class II trans activation activity. 1 Publication
VAR_015551
Natural varianti500 – 5001G → A.3 Publications
Corresponds to variant rs4774 [ dbSNP | Ensembl ].
VAR_005128
Natural varianti658 – 6581A → G.
Corresponds to variant rs2229319 [ dbSNP | Ensembl ].
VAR_015552
Natural varianti781 – 7811S → L.
Corresponds to variant rs13330686 [ dbSNP | Ensembl ].
VAR_060104
Natural varianti782 – 7821V → A.
Corresponds to variant rs13336804 [ dbSNP | Ensembl ].
VAR_057711
Natural varianti900 – 9001Q → R.4 Publications
Corresponds to variant rs7197779 [ dbSNP | Ensembl ].
VAR_047908
Natural varianti940 – 96324Missing in BLS2. 1 Publication
VAR_005129Add
BLAST
Natural varianti962 – 9621F → S in BLS2. 1 Publication
VAR_015553
Natural varianti964 – 99128Missing in BLS2.
VAR_015554Add
BLAST
Natural varianti1027 – 10271Missing in BLS2. 1 Publication
VAR_015555

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei161 – 21050AEPPT…DQIPM → V in isoform 2 and isoform 3. 2 PublicationsVSP_055099Add
BLAST
Alternative sequencei336 – 35015EPVEQ…QDTYG → GLAWSPCLGLRPSLH in isoform 3. 1 PublicationVSP_055100Add
BLAST
Alternative sequencei351 – 885535Missing in isoform 3. 1 PublicationVSP_055101Add
BLAST
Alternative sequencei887 – 93044AALSD…KDVED → WGEGLGRDILVLGINCGLGA KPSALWGPFSMQSSRVGQNG FSPF in isoform 2 and isoform 4. 2 PublicationsVSP_055102Add
BLAST
Alternative sequencei931 – 1128198Missing in isoform 2 and isoform 4. 2 PublicationsVSP_055103Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X74301 mRNA. Translation: CAA52354.1.
U18259 mRNA. Translation: AAA88861.1.
U18288 mRNA. Translation: AAA88862.1.
AY084054 mRNA. Translation: AAM15723.1.
AF410154 mRNA. Translation: AAL04118.1.
EF064747 Genomic DNA. Translation: ABK41930.1.
AC133065 Genomic DNA. No translation available.
CH471112 Genomic DNA. Translation: EAW85169.1.
CH471112 Genomic DNA. Translation: EAW85172.1.
CH471112 Genomic DNA. Translation: EAW85173.1.
CCDSiCCDS10544.1. [P33076-1]
CCDS66943.1. [P33076-3]
PIRiA48843.
RefSeqiNP_000237.2. NM_000246.3.
NP_001273332.1. NM_001286403.1. [P33076-3]
UniGeneiHs.701991.

Genome annotation databases

EnsembliENST00000381835; ENSP00000371257; ENSG00000179583. [P33076-3]
GeneIDi4261.
KEGGihsa:4261.
UCSCiuc002dag.2. human. [P33076-1]

Polymorphism databases

DMDMi317373472.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

CIITAbase

CIITA mutation db

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X74301 mRNA. Translation: CAA52354.1 .
U18259 mRNA. Translation: AAA88861.1 .
U18288 mRNA. Translation: AAA88862.1 .
AY084054 mRNA. Translation: AAM15723.1 .
AF410154 mRNA. Translation: AAL04118.1 .
EF064747 Genomic DNA. Translation: ABK41930.1 .
AC133065 Genomic DNA. No translation available.
CH471112 Genomic DNA. Translation: EAW85169.1 .
CH471112 Genomic DNA. Translation: EAW85172.1 .
CH471112 Genomic DNA. Translation: EAW85173.1 .
CCDSi CCDS10544.1. [P33076-1 ]
CCDS66943.1. [P33076-3 ]
PIRi A48843.
RefSeqi NP_000237.2. NM_000246.3.
NP_001273332.1. NM_001286403.1. [P33076-3 ]
UniGenei Hs.701991.

3D structure databases

ProteinModelPortali P33076.
SMRi P33076. Positions 1009-1120.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 110416. 20 interactions.
IntActi P33076. 3 interactions.
STRINGi 9606.ENSP00000316328.

PTM databases

PhosphoSitei P33076.

Polymorphism databases

DMDMi 317373472.

Proteomic databases

PaxDbi P33076.
PRIDEi P33076.

Protocols and materials databases

DNASUi 4261.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000381835 ; ENSP00000371257 ; ENSG00000179583 . [P33076-3 ]
GeneIDi 4261.
KEGGi hsa:4261.
UCSCi uc002dag.2. human. [P33076-1 ]

Organism-specific databases

CTDi 4261.
GeneCardsi GC16P010971.
HGNCi HGNC:7067. CIITA.
HPAi CAB016084.
MIMi 209920. phenotype.
600005. gene.
neXtProti NX_P33076.
Orphaneti 572. Immunodeficiency by defective expression of HLA class 2.
PharmGKBi PA30795.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG269671.
GeneTreei ENSGT00710000106284.
HOGENOMi HOG000107439.
HOVERGENi HBG000174.
InParanoidi P33076.
KOi K08060.
OMAi QKRPFPE.
OrthoDBi EOG7P5T07.
PhylomeDBi P33076.
TreeFami TF352118.

Enzyme and pathway databases

Reactomei REACT_25078. Interferon gamma signaling.

Miscellaneous databases

GeneWikii CIITA.
GenomeRNAii 4261.
NextBioi 16805.
PROi P33076.
SOURCEi Search...

Gene expression databases

Bgeei P33076.
CleanExi HS_CIITA.
ExpressionAtlasi P33076. baseline and differential.
Genevestigatori P33076.

Family and domain databases

InterProi IPR001611. Leu-rich_rpt.
IPR025875. Leu-rich_rpt_4.
IPR008095. MHC_II_transact.
IPR007111. NACHT_NTPase.
IPR027417. P-loop_NTPase.
[Graphical view ]
Pfami PF12799. LRR_4. 1 hit.
[Graphical view ]
PRINTSi PR01719. MHCIIACTVATR.
SUPFAMi SSF52540. SSF52540. 1 hit.
PROSITEi PS51450. LRR. 4 hits.
PS50837. NACHT. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Complementation cloning of an MHC class II transactivator mutated in hereditary MHC class II deficiency (or bare lymphocyte syndrome)."
    Steimle V., Otten L.A., Zufferey M., Mach B.
    Cell 75:135-146(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS BLS2 LYS-120 DEL ILE-GLU INS AND 940-THR--ALA-963 DEL, VARIANTS GLY-174; ALA-500 AND ARG-900.
  2. "Activation of class II MHC genes requires both the X box region and the class II transactivator (CIITA)."
    Riley J.L., Westerheide S.D., Price J.A., Brown J.A., Boss J.M.
    Immunity 2:533-543(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), VARIANTS BLS2 LYS-120 DEL ILE-GLU INS; GLY-174; ALA-500 AND ARG-900, ALTERNATIVE SPLICING.
  3. "Structural and functional characteristics of a dominant-negative isoform of porcine MHC class II transactivator."
    Quinn G., Bower R., Dos-Santos Cruz G., Giovino M., Xu Y., Patience C., Schuurman H.J.
    Eur. J. Immunogenet. 30:259-270(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), VARIANT ARG-900, ALTERNATIVE SPLICING.
  4. "K-562 cells lack MHC class II expression due to an alternatively spliced CIITA transcript with a truncated coding region."
    Day N.E., Ugai H., Yokoyama K.K., Ichiki A.T.
    Leuk. Res. 27:1027-1038(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), VARIANTS GLY-174 AND ALA-500, ALTERNATIVE SPLICING.
  5. Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS GLY-174 AND ARG-900.
  6. "The sequence and analysis of duplication-rich human chromosome 16."
    Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
    , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
    Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "GTP binding by class II transactivator: role in nuclear import."
    Harton J.A., Cressman D.E., Chin K.C., Der C.J., Ting J.P.
    Science 285:1402-1405(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: GTP-BINDING, MUTAGENESIS OF 420-GLY-LYS-421 AND ASP-561.
  9. "Transcriptional coactivator, CIITA, is an acetyltransferase that bypasses a promoter requirement for TAF(II)250."
    Raval A., Howcroft T.K., Weissman J.D., Kirshner S., Zhu X.S., Yokoyama K., Ting J., Singer D.S.
    Mol. Cell 7:105-115(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION AS ACETYLTRANSFERASE, GTP-BINDING, ACETYLTRANSFERASE REGION.
  10. "The zinc finger proteins ZXDA and ZXDC form a complex that binds CIITA and regulates MHC II gene transcription."
    Al-Kandari W., Koneni R., Navalgund V., Aleksandrova A., Jambunathan S., Fontes J.D.
    J. Mol. Biol. 369:1175-1187(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH ZXDA AND ZXDC.
  11. "ZXDC, a novel zinc finger protein that binds CIITA and activates MHC gene transcription."
    Al-Kandari W., Jambunathan S., Navalgund V., Koneni R., Freer M., Parimi N., Mudhasani R., Fontes J.D.
    Mol. Immunol. 44:311-321(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH ZXDC.
  12. "PML promotes MHC class II gene expression by stabilizing the class II transactivator."
    Ulbricht T., Alzrigat M., Horch A., Reuter N., von Mikecz A., Steimle V., Schmitt E., Kraemer O.H., Stamminger T., Hemmerich P.
    J. Cell Biol. 199:49-63(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION, INTERACTION WITH PML.
  13. "Transcriptional coactivator CIITA, a functional homolog of TAF1, has kinase activity."
    Soe K.C., Devaiah B.N., Singer D.S.
    Biochim. Biophys. Acta 1829:1184-1190(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION AS KINASE, CATALYTIC ACTIVITY, AUTOPHOSPHORYLATION.
  14. "Absence of MHC class II gene expression in a patient with a single amino acid substitution in the class II transactivator protein CIITA."
    Quan V., Towey M., Sacks S., Kelly A.P.
    Immunogenetics 49:957-963(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT BLS2 GROUP A SER-962.
  15. Cited for: VARIANT BLS2 GROUP A PRO-469.
  16. Cited for: VARIANTS BLS2 GROUP A 964-LEU--ASP-991 DEL AND ILE-1027 DEL.

Entry informationi

Entry nameiC2TA_HUMAN
AccessioniPrimary (citable) accession number: P33076
Secondary accession number(s): A0N0N9
, D3DUG0, E9PFE0, Q29675, Q8SNB8, Q96KL4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1993
Last sequence update: January 11, 2011
Last modified: November 26, 2014
This is version 150 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3