Reviewed,
UniProtKB/Swiss-Prot P32297 (ACHA3_HUMAN)
Last modified
October 13, 2009.
Version 110.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Neuronal acetylcholine receptor subunit alpha-3 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 505 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. |
| Subunit structure | Neuronal AChR is composed of two different types of subunits: alpha and beta. Alpha-3 subunit can be combined to beta-2 or beta-4 to give rise to functional receptors. Interacts with RIC3; which is required for proper folding and assembly. Ref.12 |
| Subcellular location | Cell junction › synapse › postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. |
| Involvement in disease | Genetic variations in CHRNA3 may be associated with susceptibility to lung cancer type 2 (LNCR2) [MIM:612052]. Ref.13 Ref.14 Ref.15 Ref.16 Genetic variations in CHRNA3 may be associated with susceptibility to peripheral arterial occlusive disease type 2 (PAOD2) [MIM:612052]. PAOD results from atherosclerosis of large and medium peripheral arteries, as well as the aorta. Many risk factors contribute to PAOD, including smoking, diabetes, hypertension, and hyperlipidemia. PAOD often coexists with coronary artery disease and cerebrovascular disease. |
| Sequence similarities | Belongs to the ligand-gated ionic channel (TC 1.A.9) family. [View classification] |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 2 (identifier: P32297-2) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1 (identifier: P32297-1) The sequence of this isoform differs from the canonical sequence as follows: 1-6: MGSGPL → MALAV | ||||||
| Isoform 3 (identifier: P32297-3) The sequence of this isoform differs from the canonical sequence as follows: 464-505: IQDDWKYVAMVIDRIFLWVFTLVCILGTAGLFLQPLMAREDA → EQKAQEIQQLKRKEKSTETSDQEPGL |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 31 | 31 | Potential | ||||||||
| Chain | 32 – 505 | 474 | Neuronal acetylcholine receptor subunit alpha-3 | PRO_0000000346 | |||||||
Regions | |||||||||||
| Topological domain | 32 – 240 | 209 | Extracellular Potential | ||||||||
| Transmembrane | 241 – 265 | 25 | Potential | ||||||||
| Transmembrane | 273 – 291 | 19 | Potential | ||||||||
| Transmembrane | 307 – 328 | 22 | Potential | ||||||||
| Topological domain | 329 – 477 | 149 | Cytoplasmic Potential | ||||||||
| Transmembrane | 478 – 497 | 20 | Potential | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 55 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 172 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 159 ↔ 173 | By similarity | |||||||||
| Disulfide bond | 223 ↔ 224 | Associated with receptor activation By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 6 | 6 | MGSGPL → MALAV in isoform 1. | VSP_037750 | |||||||
| Alternative sequence | 464 – 505 | 42 | IQDDW…AREDA → EQKAQEIQQLKRKEKSTETS DQEPGL in isoform 3. | VSP_037751 | |||||||
| Natural variant | 23 | 1 | Missing | VAR_013240 | |||||||
| Natural variant | 37 | 1 | R → H: dbSNP rs8192475. | VAR_059110 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 5 – 14 | 10 | PLSLPLALSP → ALAAPGAVA in AAA59942. Ref.2 | ||||||||
| Sequence conflict | 12 – 15 | 4 | LSPP → CRA in AAC84176. Ref.1 | ||||||||
| Sequence conflict | 102 | 1 | D → G in AAC84176. Ref.1 | ||||||||
| Sequence conflict | 134 – 135 | 2 | DD → TT in AAC84176. Ref.1 | ||||||||
| Sequence conflict | 237 | 1 | I → S in AAC84176. Ref.1 | ||||||||
| Sequence conflict | 432 | 1 | L → V in AAC84176. Ref.1 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning of human neuronal nicotinic receptor alpha 3-subunit." Fornasari D., Chini B., Tarroni P., Clementi F. Neurosci. Lett. 111:351-356(1990) [PubMed: 2336208] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Expression of mRNAs in human thymus coding for the alpha 3 subunit of a neuronal acetylcholine receptor." Mihovilovic M., Roses A.D. Exp. Neurol. 111:175-180(1991) [PubMed: 1989896] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Thymus. |
| [3] | "Comparative structure of human neuronal alpha 2-alpha 7 and beta 2-beta 4 nicotinic acetylcholine receptor subunits and functional expression of the alpha 2, alpha 3, alpha 4, alpha 7, beta 2, and beta 4 subunits." Elliott K.J., Ellis S.B., Berckhan K.J., Urrutia A., Chavez-Noriega L.E., Johnson E.C., Velicelebi G., Harpold M.M. J. Mol. Neurosci. 7:217-228(1996) [PubMed: 8906617] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), VARIANT LEU-23 DEL. |
| [4] | "Cloning and sequence of full-length cDNAs encoding the human neuronal nicotinic acetylcholine receptor (nAChR) subunits beta3 and beta4 and expression of seven nAChR subunits in the human neuroblastoma cell line SH-SY5Y and/or IMR-32." Groot Kormelink P.J., Luyten W.H.M.L. FEBS Lett. 400:309-314(1997) [PubMed: 9009220] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT LEU-23 DEL. |
| [5] | "The structures of the human neuronal nicotinic acetylcholine receptor beta2- and alpha3-subunit genes (CHRNB2 and CHRNA3)." Rempel N., Heyers S., Engels H., Sleegers E., Steinlein O.K. Hum. Genet. 103:645-653(1998) [PubMed: 9921897] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 2), VARIANT LEU-23 DEL. |
| [6] | "Characterization of the human beta4 nAChR gene and polymorphisms in CHRNA3 and CHRNB4." Lev-Lehman E., Bercovich D., Xu W., Stockton D.W., Beaudet A.L. J. Hum. Genet. 46:362-366(2001) [PubMed: 11450844] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [7] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3). |
| [8] | "Analysis of the DNA sequence and duplication history of human chromosome 15." Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A. Nusbaum C.Nature 440:671-675(2006) [PubMed: 16572171] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3), VARIANT LEU-23 DEL. Tissue: Brain and Lung. |
| [10] | "Cloning cholinergic receptors in human keratinocytes." Arredondo J., Grando S.A. Submitted (MAY-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 7-495 (ISOFORM 1/2). Tissue: Keratinocyte. |
| [11] | Anand R., Lindstrom J. Submitted (JUN-1990) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 32-505 (ISOFORM 1/2). Tissue: Brain. |
| [12] | "RIC-3 enhances functional expression of multiple nicotinic acetylcholine receptor subtypes in mammalian cells." Lansdell S.J., Gee V.J., Harkness P.C., Doward A.I., Baker E.R., Gibb A.J., Millar N.S. Mol. Pharmacol. 68:1431-1438(2005) [PubMed: 16120769] [Abstract] Cited for: INTERACTION WITH RIC3. |
| [13] | "Genomics: when the smoke clears." Chanock S.J., Hunter D.J. Nature 452:537-538(2008) [PubMed: 18385720] [Abstract] Cited for: INVOLVEMENT IN LNCR2. |
| [14] | "A susceptibility locus for lung cancer maps to nicotinic acetylcholine receptor subunit genes on 15q25." Hung R.J., McKay J.D., Gaborieau V., Boffetta P., Hashibe M., Zaridze D., Mukeria A., Szeszenia-Dabrowska N., Lissowska J., Rudnai P., Fabianova E., Mates D., Bencko V., Foretova L., Janout V., Chen C., Goodman G., Field J.K. Brennan P.Nature 452:633-637(2008) [PubMed: 18385738] [Abstract] Cited for: INVOLVEMENT IN LNCR2. |
| [15] | "A variant associated with nicotine dependence, lung cancer and peripheral arterial disease." Thorgeirsson T.E., Geller F., Sulem P., Rafnar T., Wiste A., Magnusson K.P., Manolescu A., Thorleifsson G., Stefansson H., Ingason A., Stacey S.N., Bergthorsson J.T., Thorlacius S., Gudmundsson J., Jonsson T., Jakobsdottir M., Saemundsdottir J., Olafsdottir O. Stefansson K.Nature 452:638-642(2008) [PubMed: 18385739] [Abstract] Cited for: INVOLVEMENT IN LNCR2, INVOLVEMENT IN PAOD2. |
| [16] | "Genome-wide association scan of tag SNPs identifies a susceptibility locus for lung cancer at 15q25.1." Amos C.I., Wu X., Broderick P., Gorlov I.P., Gu J., Eisen T., Dong Q., Zhang Q., Gu X., Vijayakrishnan J., Sullivan K., Matakidou A., Wang Y., Mills G., Doheny K., Tsai Y.-Y., Chen W.V., Shete S., Spitz M.R., Houlston R.S. Nat. Genet. 40:616-622(2008) [PubMed: 18385676] [Abstract] Cited for: INVOLVEMENT IN LNCR2. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| M86383 mRNA. Translation: AAC84176.1. M37981 mRNA. Translation: AAA59942.1. U62432 mRNA. Translation: AAB40110.1. Y08418 mRNA. Translation: CAA69695.1. AJ007783 AJ007787 Genomic DNA. Translation: CAA07682.1. BT006646 mRNA. Translation: AAP35292.1. BT006897 mRNA. Translation: AAP35543.1. AC027228 Genomic DNA. No translation available. AC067863 Genomic DNA. No translation available. BC000513 mRNA. Translation: AAH00513.1. BC001642 mRNA. Translation: AAH01642.1. BC002996 mRNA. Translation: AAH02996.1. BC006114 mRNA. Translation: AAH06114.1. BC098443 mRNA. Translation: AAH98443.1. AF385584 mRNA. Translation: AAK68110.1. X53559 mRNA. Translation: CAA37625.1. | |
| IPI | IPI00297165. IPI00852613. IPI00939562. |
| PIR | A37040. A53956. |
| RefSeq | NP_000734.2. |
| UniGene | Hs.89605 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | P32297. |
PTM databases | |
| PhosphoSite | P32297. |
Proteomic databases | |
| PRIDE | P32297. |
Genome annotation databases | |
| Ensembl | ENST00000326828; ENSP00000315602; ENSG00000080644; Homo sapiens. [Genome view] ENST00000326858; ENSP00000319241; ENSG00000080644; Homo sapiens. [Genome view] ENST00000348639; ENSP00000267951; ENSG00000080644; Homo sapiens. [Genome view] |
| GeneID | 1136. |
| KEGG | hsa:1136. |
| UCSC | uc002beb.2. human. uc002bec.1. human. |
Organism-specific databases | |
| GeneCards | GC15M076672. |
| HGNC | HGNC:1957. CHRNA3. |
| MIM | 118503. gene. 612052. phenotype. |
| PharmGKB | PA113. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | P32297. |
Gene expression databases | |
| ArrayExpress | P32297. |
| Bgee | P32297. |
| CleanEx | HS_CHRNA3. |
| Genevestigator | P32297. |
| GermOnline | ENSG00000080644. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR006029. Neu_channel_TM. IPR006202. Neur_chan_lig_bd. IPR006201. Neur_channel. IPR018000. Neurotransmitter_ion_chnl_CS. IPR002394. Nicotinic_acetylcholine_rcpt_N. [Graphical view] |
| Gene3D | G3DSA:2.70.170.10. Neur_chan_lig_bd. 1 hit. |
| PANTHER | PTHR18945. Neur_channel. 1 hit. |
| Pfam | PF02931. Neur_chan_LBD. 1 hit. PF02932. Neur_chan_memb. 1 hit. [Graphical view] |
| PRINTS | PR00254. NICOTINICR. PR00252. NRIONCHANNEL. |
| TIGRFAMs | TIGR00860. LIC. 1 hit. |
| PROSITE | PS00236. NEUROTR_ION_CHANNEL. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 4726. |
| SOURCE | Search... |
Entry information
| Entry name | ACHA3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P32297 Secondary accession number(s): Q15823 Q9BRR4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 15 Human chromosome 15: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


