Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P32297

- ACHA3_HUMAN

UniProt

P32297 - ACHA3_HUMAN

Protein

Neuronal acetylcholine receptor subunit alpha-3

Gene

CHRNA3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 156 (01 Oct 2014)
      Sequence version 4 (28 Jul 2009)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.

    GO - Molecular functioni

    1. acetylcholine-activated cation-selective channel activity Source: UniProtKB
    2. acetylcholine binding Source: UniProtKB
    3. acetylcholine receptor activity Source: UniProtKB
    4. ligand-gated ion channel activity Source: DFLAT

    GO - Biological processi

    1. activation of transmembrane receptor protein tyrosine kinase activity Source: UniProtKB
    2. behavioral response to nicotine Source: UniProtKB
    3. cation transport Source: GOC
    4. ion transmembrane transport Source: GOC
    5. ion transport Source: UniProtKB
    6. locomotory behavior Source: UniProtKB
    7. nervous system development Source: UniProtKB
    8. regulation of acetylcholine secretion, neurotransmission Source: UniProtKB
    9. regulation of dendrite morphogenesis Source: UniProtKB
    10. regulation of excitatory postsynaptic membrane potential Source: UniProtKB
    11. regulation of membrane potential Source: UniProtKB
    12. regulation of smooth muscle contraction Source: UniProtKB
    13. signal transduction Source: UniProtKB
    14. synaptic transmission Source: Reactome
    15. synaptic transmission, cholinergic Source: UniProtKB
    16. synaptic transmission involved in micturition Source: UniProtKB

    Keywords - Molecular functioni

    Ion channel, Ligand-gated ion channel, Receptor

    Keywords - Biological processi

    Ion transport, Transport

    Enzyme and pathway databases

    ReactomeiREACT_22223. Highly sodium permeable acetylcholine nicotinic receptors.
    REACT_22303. Highly calcium permeable postsynaptic nicotinic acetylcholine receptors.
    REACT_22352. Highly calcium permeable nicotinic acetylcholine receptors.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Neuronal acetylcholine receptor subunit alpha-3
    Gene namesi
    Name:CHRNA3
    Synonyms:NACHRA3
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 15

    Organism-specific databases

    HGNCiHGNC:1957. CHRNA3.

    Subcellular locationi

    GO - Cellular componenti

    1. acetylcholine-gated channel complex Source: UniProtKB
    2. cell junction Source: UniProtKB-KW
    3. dendrite Source: UniProtKB
    4. integral component of membrane Source: UniProtKB
    5. neuronal cell body Source: UniProtKB
    6. plasma membrane Source: Reactome
    7. postsynaptic density Source: UniProtKB
    8. postsynaptic membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell junction, Cell membrane, Membrane, Postsynaptic cell membrane, Synapse

    Pathology & Biotechi

    Organism-specific databases

    MIMi612052. phenotype.
    PharmGKBiPA113.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 3131Sequence AnalysisAdd
    BLAST
    Chaini32 – 505474Neuronal acetylcholine receptor subunit alpha-3PRO_0000000346Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi55 – 551N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi159 ↔ 173By similarity
    Glycosylationi172 – 1721N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi223 ↔ 224Associated with receptor activationBy similarity
    Modified residuei413 – 4131PhosphoserineBy similarity
    Modified residuei416 – 4161PhosphoserineBy similarity

    Keywords - PTMi

    Disulfide bond, Glycoprotein, Phosphoprotein

    Proteomic databases

    PaxDbiP32297.
    PRIDEiP32297.

    PTM databases

    PhosphoSiteiP32297.

    Expressioni

    Gene expression databases

    ArrayExpressiP32297.
    BgeeiP32297.
    CleanExiHS_CHRNA3.
    GenevestigatoriP32297.

    Organism-specific databases

    HPAiHPA029430.

    Interactioni

    Subunit structurei

    Neuronal AChR is composed of two different types of subunits: alpha and beta. Alpha-3 subunit can be combined to beta-2 or beta-4 to give rise to functional receptors. Interacts with RIC3; which is required for proper folding and assembly.1 Publication

    Protein-protein interaction databases

    BioGridi107558. 1 interaction.
    STRINGi9606.ENSP00000315602.

    Structurei

    3D structure databases

    ProteinModelPortaliP32297.
    SMRiP32297. Positions 32-345, 431-499.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini32 – 240209ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini329 – 477149CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei241 – 26525HelicalSequence AnalysisAdd
    BLAST
    Transmembranei273 – 29119HelicalSequence AnalysisAdd
    BLAST
    Transmembranei307 – 32822HelicalSequence AnalysisAdd
    BLAST
    Transmembranei478 – 49720HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Keywords - Domaini

    Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG290206.
    HOVERGENiHBG003756.
    InParanoidiP32297.
    KOiK04805.
    OMAiRTESKGC.
    OrthoDBiEOG72JWGV.
    PhylomeDBiP32297.
    TreeFamiTF315605.

    Family and domain databases

    Gene3Di1.20.120.370. 2 hits.
    2.70.170.10. 1 hit.
    InterProiIPR027361. Acetylcholine_rcpt_TM.
    IPR006202. Neur_chan_lig-bd.
    IPR006201. Neur_channel.
    IPR006029. Neurotrans-gated_channel_TM.
    IPR018000. Neurotransmitter_ion_chnl_CS.
    IPR002394. Nicotinic_acetylcholine_rcpt.
    [Graphical view]
    PANTHERiPTHR18945. PTHR18945. 1 hit.
    PfamiPF02931. Neur_chan_LBD. 1 hit.
    PF02932. Neur_chan_memb. 1 hit.
    [Graphical view]
    PRINTSiPR00254. NICOTINICR.
    PR00252. NRIONCHANNEL.
    SUPFAMiSSF63712. SSF63712. 1 hit.
    SSF90112. SSF90112. 1 hit.
    TIGRFAMsiTIGR00860. LIC. 1 hit.
    PROSITEiPS00236. NEUROTR_ION_CHANNEL. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 2 (identifier: P32297-2) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGSGPLSLPL ALSPPRLLLL LLLSLLPVAR ASEAEHRLFE RLFEDYNEII    50
    RPVANVSDPV IIHFEVSMSQ LVKVDEVNQI METNLWLKQI WNDYKLKWNP 100
    SDYGGAEFMR VPAQKIWKPD IVLYNNAVGD FQVDDKTKAL LKYTGEVTWI 150
    PPAIFKSSCK IDVTYFPFDY QNCTMKFGSW SYDKAKIDLV LIGSSMNLKD 200
    YWESGEWAII KAPGYKHDIK YNCCEEIYPD ITYSLYIRRL PLFYTINLII 250
    PCLLISFLTV LVFYLPSDCG EKVTLCISVL LSLTVFLLVI TETIPSTSLV 300
    IPLIGEYLLF TMIFVTLSIV ITVFVLNVHY RTPTTHTMPS WVKTVFLNLL 350
    PRVMFMTRPT SNEGNAQKPR PLYGAELSNL NCFSRAESKG CKEGYPCQDG 400
    MCGYCHHRRI KISNFSANLT RSSSSESVDA VLSLSALSPE IKEAIQSVKY 450
    IAENMKAQNE AKEIQDDWKY VAMVIDRIFL WVFTLVCILG TAGLFLQPLM 500
    AREDA 505
    Length:505
    Mass (Da):57,480
    Last modified:July 28, 2009 - v4
    Checksum:i478D7712D59ACB2D
    GO
    Isoform 1 (identifier: P32297-1) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-6: MGSGPL → MALAV

    Show »
    Length:504
    Mass (Da):57,423
    Checksum:iF4D2DA153F2B3476
    GO
    Isoform 3 (identifier: P32297-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         464-505: IQDDWKYVAMVIDRIFLWVFTLVCILGTAGLFLQPLMAREDA → EQKAQEIQQLKRKEKSTETSDQEPGL

    Show »
    Length:489
    Mass (Da):55,637
    Checksum:iF8C4F79BDC30A44E
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti5 – 1410PLSLPLALSP → ALAAPGAVA in AAA59942. (PubMed:1989896)Curated
    Sequence conflicti12 – 154LSPP → CRA in AAC84176. (PubMed:2336208)Curated
    Sequence conflicti102 – 1021D → G in AAC84176. (PubMed:2336208)Curated
    Sequence conflicti134 – 1352DD → TT in AAC84176. (PubMed:2336208)Curated
    Sequence conflicti237 – 2371I → S in AAC84176. (PubMed:2336208)Curated
    Sequence conflicti432 – 4321L → V in AAC84176. (PubMed:2336208)Curated

    Polymorphismi

    Genetic variations in CHRNA3 have been associated with susceptibility to smoking-related behavioral traits and lung cancer, contributing to the smoking quantitative trait locus 3 (SQTL3) [MIMi:612052].

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti23 – 231Missing.4 Publications
    VAR_013240
    Natural varianti37 – 371R → H.
    Corresponds to variant rs8192475 [ dbSNP | Ensembl ].
    VAR_059110

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 66MGSGPL → MALAV in isoform 1. 3 PublicationsVSP_037750
    Alternative sequencei464 – 50542IQDDW…AREDA → EQKAQEIQQLKRKEKSTETS DQEPGL in isoform 3. 2 PublicationsVSP_037751Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M86383 mRNA. Translation: AAC84176.1.
    M37981 mRNA. Translation: AAA59942.1.
    U62432 mRNA. Translation: AAB40110.1.
    Y08418 mRNA. Translation: CAA69695.1.
    AJ007783
    , AJ007784, AJ007785, AJ007786, AJ007787 Genomic DNA. Translation: CAA07682.1.
    BT006646 mRNA. Translation: AAP35292.1.
    BT006897 mRNA. Translation: AAP35543.1.
    AC027228 Genomic DNA. No translation available.
    AC067863 Genomic DNA. No translation available.
    BC000513 mRNA. Translation: AAH00513.1.
    BC001642 mRNA. Translation: AAH01642.1.
    BC002996 mRNA. Translation: AAH02996.1.
    BC006114 mRNA. Translation: AAH06114.1.
    BC098443 mRNA. Translation: AAH98443.1.
    AF385584 mRNA. Translation: AAK68110.1.
    X53559 mRNA. Translation: CAA37625.1.
    CCDSiCCDS10305.1. [P32297-2]
    CCDS53964.1. [P32297-3]
    PIRiA37040.
    A53956.
    RefSeqiNP_000734.2. NM_000743.4. [P32297-2]
    NP_001160166.1. NM_001166694.1. [P32297-3]
    UniGeneiHs.89605.

    Genome annotation databases

    EnsembliENST00000326828; ENSP00000315602; ENSG00000080644. [P32297-2]
    ENST00000348639; ENSP00000267951; ENSG00000080644. [P32297-3]
    ENST00000559658; ENSP00000452896; ENSG00000080644. [P32297-2]
    GeneIDi1136.
    KEGGihsa:1136.
    UCSCiuc002beb.3. human. [P32297-3]
    uc002bec.3. human. [P32297-2]

    Polymorphism databases

    DMDMi254763435.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M86383 mRNA. Translation: AAC84176.1 .
    M37981 mRNA. Translation: AAA59942.1 .
    U62432 mRNA. Translation: AAB40110.1 .
    Y08418 mRNA. Translation: CAA69695.1 .
    AJ007783
    , AJ007784 , AJ007785 , AJ007786 , AJ007787 Genomic DNA. Translation: CAA07682.1 .
    BT006646 mRNA. Translation: AAP35292.1 .
    BT006897 mRNA. Translation: AAP35543.1 .
    AC027228 Genomic DNA. No translation available.
    AC067863 Genomic DNA. No translation available.
    BC000513 mRNA. Translation: AAH00513.1 .
    BC001642 mRNA. Translation: AAH01642.1 .
    BC002996 mRNA. Translation: AAH02996.1 .
    BC006114 mRNA. Translation: AAH06114.1 .
    BC098443 mRNA. Translation: AAH98443.1 .
    AF385584 mRNA. Translation: AAK68110.1 .
    X53559 mRNA. Translation: CAA37625.1 .
    CCDSi CCDS10305.1. [P32297-2 ]
    CCDS53964.1. [P32297-3 ]
    PIRi A37040.
    A53956.
    RefSeqi NP_000734.2. NM_000743.4. [P32297-2 ]
    NP_001160166.1. NM_001166694.1. [P32297-3 ]
    UniGenei Hs.89605.

    3D structure databases

    ProteinModelPortali P32297.
    SMRi P32297. Positions 32-345, 431-499.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 107558. 1 interaction.
    STRINGi 9606.ENSP00000315602.

    Chemistry

    BindingDBi P32297.
    ChEMBLi CHEMBL2111384.
    DrugBanki DB01156. Bupropion.
    DB00514. Dextromethorphan.
    DB00674. Galantamine.
    DB01227. Levomethadyl Acetate.
    DB00184. Nicotine.
    DB01090. Pentolinium.
    DB01273. Varenicline.
    GuidetoPHARMACOLOGYi 464.

    PTM databases

    PhosphoSitei P32297.

    Polymorphism databases

    DMDMi 254763435.

    Proteomic databases

    PaxDbi P32297.
    PRIDEi P32297.

    Protocols and materials databases

    DNASUi 1136.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000326828 ; ENSP00000315602 ; ENSG00000080644 . [P32297-2 ]
    ENST00000348639 ; ENSP00000267951 ; ENSG00000080644 . [P32297-3 ]
    ENST00000559658 ; ENSP00000452896 ; ENSG00000080644 . [P32297-2 ]
    GeneIDi 1136.
    KEGGi hsa:1136.
    UCSCi uc002beb.3. human. [P32297-3 ]
    uc002bec.3. human. [P32297-2 ]

    Organism-specific databases

    CTDi 1136.
    GeneCardsi GC15M078885.
    H-InvDB HIX0017542.
    HGNCi HGNC:1957. CHRNA3.
    HPAi HPA029430.
    MIMi 118503. gene.
    612052. phenotype.
    neXtProti NX_P32297.
    PharmGKBi PA113.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG290206.
    HOVERGENi HBG003756.
    InParanoidi P32297.
    KOi K04805.
    OMAi RTESKGC.
    OrthoDBi EOG72JWGV.
    PhylomeDBi P32297.
    TreeFami TF315605.

    Enzyme and pathway databases

    Reactomei REACT_22223. Highly sodium permeable acetylcholine nicotinic receptors.
    REACT_22303. Highly calcium permeable postsynaptic nicotinic acetylcholine receptors.
    REACT_22352. Highly calcium permeable nicotinic acetylcholine receptors.

    Miscellaneous databases

    ChiTaRSi CHRNA3. human.
    GeneWikii CHRNA3.
    GenomeRNAii 1136.
    NextBioi 4726.
    PROi P32297.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P32297.
    Bgeei P32297.
    CleanExi HS_CHRNA3.
    Genevestigatori P32297.

    Family and domain databases

    Gene3Di 1.20.120.370. 2 hits.
    2.70.170.10. 1 hit.
    InterProi IPR027361. Acetylcholine_rcpt_TM.
    IPR006202. Neur_chan_lig-bd.
    IPR006201. Neur_channel.
    IPR006029. Neurotrans-gated_channel_TM.
    IPR018000. Neurotransmitter_ion_chnl_CS.
    IPR002394. Nicotinic_acetylcholine_rcpt.
    [Graphical view ]
    PANTHERi PTHR18945. PTHR18945. 1 hit.
    Pfami PF02931. Neur_chan_LBD. 1 hit.
    PF02932. Neur_chan_memb. 1 hit.
    [Graphical view ]
    PRINTSi PR00254. NICOTINICR.
    PR00252. NRIONCHANNEL.
    SUPFAMi SSF63712. SSF63712. 1 hit.
    SSF90112. SSF90112. 1 hit.
    TIGRFAMsi TIGR00860. LIC. 1 hit.
    PROSITEi PS00236. NEUROTR_ION_CHANNEL. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Molecular cloning of human neuronal nicotinic receptor alpha 3-subunit."
      Fornasari D., Chini B., Tarroni P., Clementi F.
      Neurosci. Lett. 111:351-356(1990) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "Expression of mRNAs in human thymus coding for the alpha 3 subunit of a neuronal acetylcholine receptor."
      Mihovilovic M., Roses A.D.
      Exp. Neurol. 111:175-180(1991) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Thymus.
    3. "Comparative structure of human neuronal alpha 2-alpha 7 and beta 2-beta 4 nicotinic acetylcholine receptor subunits and functional expression of the alpha 2, alpha 3, alpha 4, alpha 7, beta 2, and beta 4 subunits."
      Elliott K.J., Ellis S.B., Berckhan K.J., Urrutia A., Chavez-Noriega L.E., Johnson E.C., Velicelebi G., Harpold M.M.
      J. Mol. Neurosci. 7:217-228(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), VARIANT LEU-23 DEL.
    4. "Cloning and sequence of full-length cDNAs encoding the human neuronal nicotinic acetylcholine receptor (nAChR) subunits beta3 and beta4 and expression of seven nAChR subunits in the human neuroblastoma cell line SH-SY5Y and/or IMR-32."
      Groot Kormelink P.J., Luyten W.H.M.L.
      FEBS Lett. 400:309-314(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT LEU-23 DEL.
    5. "The structures of the human neuronal nicotinic acetylcholine receptor beta2- and alpha3-subunit genes (CHRNB2 and CHRNA3)."
      Rempel N., Heyers S., Engels H., Sleegers E., Steinlein O.K.
      Hum. Genet. 103:645-653(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 2), VARIANT LEU-23 DEL.
    6. "Characterization of the human beta4 nAChR gene and polymorphisms in CHRNA3 and CHRNB4."
      Lev-Lehman E., Bercovich D., Xu W., Stockton D.W., Beaudet A.L.
      J. Hum. Genet. 46:362-366(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    7. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
      Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
      Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
    8. "Analysis of the DNA sequence and duplication history of human chromosome 15."
      Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A.
      , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.
      Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    9. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3), VARIANT LEU-23 DEL.
      Tissue: Brain and Lung.
    10. "Cloning cholinergic receptors in human keratinocytes."
      Arredondo J., Grando S.A.
      Submitted (MAY-2001) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 7-495 (ISOFORMS 1/2).
      Tissue: Keratinocyte.
    11. Anand R., Lindstrom J.
      Submitted (JUN-1990) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 32-505 (ISOFORMS 1/2).
      Tissue: Brain.
    12. "RIC-3 enhances functional expression of multiple nicotinic acetylcholine receptor subtypes in mammalian cells."
      Lansdell S.J., Gee V.J., Harkness P.C., Doward A.I., Baker E.R., Gibb A.J., Millar N.S.
      Mol. Pharmacol. 68:1431-1438(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH RIC3.
    13. Cited for: INVOLVEMENT IN SQTL3 AND LUNG CANCER.
    14. "A susceptibility locus for lung cancer maps to nicotinic acetylcholine receptor subunit genes on 15q25."
      Hung R.J., McKay J.D., Gaborieau V., Boffetta P., Hashibe M., Zaridze D., Mukeria A., Szeszenia-Dabrowska N., Lissowska J., Rudnai P., Fabianova E., Mates D., Bencko V., Foretova L., Janout V., Chen C., Goodman G., Field J.K.
      , Liloglou T., Xinarianos G., Cassidy A., McLaughlin J., Liu G., Narod S., Krokan H.E., Skorpen F., Elvestad M.B., Hveem K., Vatten L., Linseisen J., Clavel-Chapelon F., Vineis P., Bueno-de-Mesquita H.B., Lund E., Martinez C., Bingham S., Rasmuson T., Hainaut P., Riboli E., Ahrens W., Benhamou S., Lagiou P., Trichopoulos D., Holcatova I., Merletti F., Kjaerheim K., Agudo A., Macfarlane G., Talamini R., Simonato L., Lowry R., Conway D.I., Znaor A., Healy C., Zelenika D., Boland A., Delepine M., Foglio M., Lechner D., Matsuda F., Blanche H., Gut I., Heath S., Lathrop M., Brennan P.
      Nature 452:633-637(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: INVOLVEMENT IN SQTL3 AND LUNG CANCER.
    15. "A variant associated with nicotine dependence, lung cancer and peripheral arterial disease."
      Thorgeirsson T.E., Geller F., Sulem P., Rafnar T., Wiste A., Magnusson K.P., Manolescu A., Thorleifsson G., Stefansson H., Ingason A., Stacey S.N., Bergthorsson J.T., Thorlacius S., Gudmundsson J., Jonsson T., Jakobsdottir M., Saemundsdottir J., Olafsdottir O.
      , Gudmundsson L.J., Bjornsdottir G., Kristjansson K., Skuladottir H., Isaksson H.J., Gudbjartsson T., Jones G.T., Mueller T., Gottsaeter A., Flex A., Aben K.K.H., de Vegt F., Mulders P.F.A., Isla D., Vidal M.J., Asin L., Saez B., Murillo L., Blondal T., Kolbeinsson H., Stefansson J.G., Hansdottir I., Runarsdottir V., Pola R., Lindblad B., van Rij A.M., Dieplinger B., Haltmayer M., Mayordomo J.I., Kiemeney L.A., Matthiasson S.E., Oskarsson H., Tyrfingsson T., Gudbjartsson D.F., Gulcher J.R., Jonsson S., Thorsteinsdottir U., Kong A., Stefansson K.
      Nature 452:638-642(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: INVOLVEMENT IN SQTL3 AND LUNG CANCER.
    16. Cited for: INVOLVEMENT IN SQTL3 AND LUNG CANCER.

    Entry informationi

    Entry nameiACHA3_HUMAN
    AccessioniPrimary (citable) accession number: P32297
    Secondary accession number(s): Q15823
    , Q4KMN8, Q86U77, Q96RH3, Q99553, Q9BQ93, Q9BRR4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 1, 1993
    Last sequence update: July 28, 2009
    Last modified: October 1, 2014
    This is version 156 of the entry and version 4 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 15
      Human chromosome 15: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3