Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P32297

- ACHA3_HUMAN

UniProt

P32297 - ACHA3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Neuronal acetylcholine receptor subunit alpha-3

Gene

CHRNA3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.

GO - Molecular functioni

  1. acetylcholine-activated cation-selective channel activity Source: UniProtKB
  2. acetylcholine binding Source: UniProtKB
  3. acetylcholine receptor activity Source: UniProtKB
  4. ligand-gated ion channel activity Source: DFLAT

GO - Biological processi

  1. activation of transmembrane receptor protein tyrosine kinase activity Source: UniProtKB
  2. behavioral response to nicotine Source: UniProtKB
  3. cation transmembrane transport Source: GOC
  4. cation transport Source: GOC
  5. ion transmembrane transport Source: GOC
  6. ion transport Source: UniProtKB
  7. locomotory behavior Source: UniProtKB
  8. nervous system development Source: UniProtKB
  9. regulation of acetylcholine secretion, neurotransmission Source: UniProtKB
  10. regulation of dendrite morphogenesis Source: UniProtKB
  11. regulation of excitatory postsynaptic membrane potential Source: UniProtKB
  12. regulation of membrane potential Source: UniProtKB
  13. regulation of smooth muscle contraction Source: UniProtKB
  14. signal transduction Source: UniProtKB
  15. synaptic transmission Source: Reactome
  16. synaptic transmission, cholinergic Source: UniProtKB
  17. synaptic transmission involved in micturition Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Ion channel, Ligand-gated ion channel, Receptor

Keywords - Biological processi

Ion transport, Transport

Enzyme and pathway databases

ReactomeiREACT_22223. Highly sodium permeable acetylcholine nicotinic receptors.
REACT_22303. Highly calcium permeable postsynaptic nicotinic acetylcholine receptors.
REACT_22352. Highly calcium permeable nicotinic acetylcholine receptors.

Names & Taxonomyi

Protein namesi
Recommended name:
Neuronal acetylcholine receptor subunit alpha-3
Gene namesi
Name:CHRNA3
Synonyms:NACHRA3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 15

Organism-specific databases

HGNCiHGNC:1957. CHRNA3.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini32 – 240209ExtracellularSequence AnalysisAdd
BLAST
Transmembranei241 – 26525HelicalSequence AnalysisAdd
BLAST
Transmembranei273 – 29119HelicalSequence AnalysisAdd
BLAST
Transmembranei307 – 32822HelicalSequence AnalysisAdd
BLAST
Topological domaini329 – 477149CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei478 – 49720HelicalSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. acetylcholine-gated channel complex Source: UniProtKB
  2. cell junction Source: UniProtKB-KW
  3. dendrite Source: UniProtKB
  4. integral component of membrane Source: UniProtKB
  5. neuronal cell body Source: UniProtKB
  6. plasma membrane Source: Reactome
  7. postsynaptic density Source: UniProtKB
  8. postsynaptic membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane, Postsynaptic cell membrane, Synapse

Pathology & Biotechi

Organism-specific databases

MIMi612052. phenotype.
PharmGKBiPA113.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 3131Sequence AnalysisAdd
BLAST
Chaini32 – 505474Neuronal acetylcholine receptor subunit alpha-3PRO_0000000346Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi55 – 551N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi159 ↔ 173By similarity
Glycosylationi172 – 1721N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi223 ↔ 224Associated with receptor activationBy similarity
Modified residuei413 – 4131PhosphoserineBy similarity
Modified residuei416 – 4161PhosphoserineBy similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiP32297.
PRIDEiP32297.

PTM databases

PhosphoSiteiP32297.

Expressioni

Gene expression databases

BgeeiP32297.
CleanExiHS_CHRNA3.
ExpressionAtlasiP32297. baseline and differential.
GenevestigatoriP32297.

Organism-specific databases

HPAiHPA029430.

Interactioni

Subunit structurei

Neuronal AChR is composed of two different types of subunits: alpha and beta. Alpha-3 subunit can be combined to beta-2 or beta-4 to give rise to functional receptors. Interacts with RIC3; which is required for proper folding and assembly.1 Publication

Protein-protein interaction databases

BioGridi107558. 1 interaction.
STRINGi9606.ENSP00000315602.

Structurei

3D structure databases

ProteinModelPortaliP32297.
SMRiP32297. Positions 31-499.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG290206.
GeneTreeiENSGT00760000118930.
HOVERGENiHBG003756.
InParanoidiP32297.
KOiK04805.
OMAiRTESKGC.
OrthoDBiEOG72JWGV.
PhylomeDBiP32297.
TreeFamiTF315605.

Family and domain databases

Gene3Di1.20.120.370. 2 hits.
2.70.170.10. 1 hit.
InterProiIPR027361. Acetylcholine_rcpt_TM.
IPR006202. Neur_chan_lig-bd.
IPR006201. Neur_channel.
IPR006029. Neurotrans-gated_channel_TM.
IPR018000. Neurotransmitter_ion_chnl_CS.
IPR002394. Nicotinic_acetylcholine_rcpt.
[Graphical view]
PANTHERiPTHR18945. PTHR18945. 1 hit.
PfamiPF02931. Neur_chan_LBD. 1 hit.
PF02932. Neur_chan_memb. 1 hit.
[Graphical view]
PRINTSiPR00254. NICOTINICR.
PR00252. NRIONCHANNEL.
SUPFAMiSSF63712. SSF63712. 1 hit.
SSF90112. SSF90112. 1 hit.
TIGRFAMsiTIGR00860. LIC. 1 hit.
PROSITEiPS00236. NEUROTR_ION_CHANNEL. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 2 (identifier: P32297-2) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGSGPLSLPL ALSPPRLLLL LLLSLLPVAR ASEAEHRLFE RLFEDYNEII
60 70 80 90 100
RPVANVSDPV IIHFEVSMSQ LVKVDEVNQI METNLWLKQI WNDYKLKWNP
110 120 130 140 150
SDYGGAEFMR VPAQKIWKPD IVLYNNAVGD FQVDDKTKAL LKYTGEVTWI
160 170 180 190 200
PPAIFKSSCK IDVTYFPFDY QNCTMKFGSW SYDKAKIDLV LIGSSMNLKD
210 220 230 240 250
YWESGEWAII KAPGYKHDIK YNCCEEIYPD ITYSLYIRRL PLFYTINLII
260 270 280 290 300
PCLLISFLTV LVFYLPSDCG EKVTLCISVL LSLTVFLLVI TETIPSTSLV
310 320 330 340 350
IPLIGEYLLF TMIFVTLSIV ITVFVLNVHY RTPTTHTMPS WVKTVFLNLL
360 370 380 390 400
PRVMFMTRPT SNEGNAQKPR PLYGAELSNL NCFSRAESKG CKEGYPCQDG
410 420 430 440 450
MCGYCHHRRI KISNFSANLT RSSSSESVDA VLSLSALSPE IKEAIQSVKY
460 470 480 490 500
IAENMKAQNE AKEIQDDWKY VAMVIDRIFL WVFTLVCILG TAGLFLQPLM

AREDA
Length:505
Mass (Da):57,480
Last modified:July 28, 2009 - v4
Checksum:i478D7712D59ACB2D
GO
Isoform 1 (identifier: P32297-1) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-6: MGSGPL → MALAV

Show »
Length:504
Mass (Da):57,423
Checksum:iF4D2DA153F2B3476
GO
Isoform 3 (identifier: P32297-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     464-505: IQDDWKYVAMVIDRIFLWVFTLVCILGTAGLFLQPLMAREDA → EQKAQEIQQLKRKEKSTETSDQEPGL

Show »
Length:489
Mass (Da):55,637
Checksum:iF8C4F79BDC30A44E
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti5 – 1410PLSLPLALSP → ALAAPGAVA in AAA59942. (PubMed:1989896)Curated
Sequence conflicti12 – 154LSPP → CRA in AAC84176. (PubMed:2336208)Curated
Sequence conflicti102 – 1021D → G in AAC84176. (PubMed:2336208)Curated
Sequence conflicti134 – 1352DD → TT in AAC84176. (PubMed:2336208)Curated
Sequence conflicti237 – 2371I → S in AAC84176. (PubMed:2336208)Curated
Sequence conflicti432 – 4321L → V in AAC84176. (PubMed:2336208)Curated

Polymorphismi

Genetic variations in CHRNA3 have been associated with susceptibility to smoking-related behavioral traits and lung cancer, contributing to the smoking quantitative trait locus 3 (SQTL3) [MIMi:612052].

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti23 – 231Missing.4 Publications
VAR_013240
Natural varianti37 – 371R → H.
Corresponds to variant rs8192475 [ dbSNP | Ensembl ].
VAR_059110

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 66MGSGPL → MALAV in isoform 1. 3 PublicationsVSP_037750
Alternative sequencei464 – 50542IQDDW…AREDA → EQKAQEIQQLKRKEKSTETS DQEPGL in isoform 3. 2 PublicationsVSP_037751Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M86383 mRNA. Translation: AAC84176.1.
M37981 mRNA. Translation: AAA59942.1.
U62432 mRNA. Translation: AAB40110.1.
Y08418 mRNA. Translation: CAA69695.1.
AJ007783
, AJ007784, AJ007785, AJ007786, AJ007787 Genomic DNA. Translation: CAA07682.1.
BT006646 mRNA. Translation: AAP35292.1.
BT006897 mRNA. Translation: AAP35543.1.
AC027228 Genomic DNA. No translation available.
AC067863 Genomic DNA. No translation available.
BC000513 mRNA. Translation: AAH00513.1.
BC001642 mRNA. Translation: AAH01642.1.
BC002996 mRNA. Translation: AAH02996.1.
BC006114 mRNA. Translation: AAH06114.1.
BC098443 mRNA. Translation: AAH98443.1.
AF385584 mRNA. Translation: AAK68110.1.
X53559 mRNA. Translation: CAA37625.1.
CCDSiCCDS10305.1. [P32297-2]
CCDS53964.1. [P32297-3]
PIRiA37040.
A53956.
RefSeqiNP_000734.2. NM_000743.4. [P32297-2]
NP_001160166.1. NM_001166694.1. [P32297-3]
UniGeneiHs.89605.

Genome annotation databases

EnsembliENST00000326828; ENSP00000315602; ENSG00000080644. [P32297-2]
ENST00000348639; ENSP00000267951; ENSG00000080644. [P32297-3]
ENST00000559658; ENSP00000452896; ENSG00000080644. [P32297-2]
GeneIDi1136.
KEGGihsa:1136.
UCSCiuc002beb.3. human. [P32297-3]
uc002bec.3. human. [P32297-2]

Polymorphism databases

DMDMi254763435.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M86383 mRNA. Translation: AAC84176.1 .
M37981 mRNA. Translation: AAA59942.1 .
U62432 mRNA. Translation: AAB40110.1 .
Y08418 mRNA. Translation: CAA69695.1 .
AJ007783
, AJ007784 , AJ007785 , AJ007786 , AJ007787 Genomic DNA. Translation: CAA07682.1 .
BT006646 mRNA. Translation: AAP35292.1 .
BT006897 mRNA. Translation: AAP35543.1 .
AC027228 Genomic DNA. No translation available.
AC067863 Genomic DNA. No translation available.
BC000513 mRNA. Translation: AAH00513.1 .
BC001642 mRNA. Translation: AAH01642.1 .
BC002996 mRNA. Translation: AAH02996.1 .
BC006114 mRNA. Translation: AAH06114.1 .
BC098443 mRNA. Translation: AAH98443.1 .
AF385584 mRNA. Translation: AAK68110.1 .
X53559 mRNA. Translation: CAA37625.1 .
CCDSi CCDS10305.1. [P32297-2 ]
CCDS53964.1. [P32297-3 ]
PIRi A37040.
A53956.
RefSeqi NP_000734.2. NM_000743.4. [P32297-2 ]
NP_001160166.1. NM_001166694.1. [P32297-3 ]
UniGenei Hs.89605.

3D structure databases

ProteinModelPortali P32297.
SMRi P32297. Positions 31-499.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 107558. 1 interaction.
STRINGi 9606.ENSP00000315602.

Chemistry

BindingDBi P32297.
ChEMBLi CHEMBL2111384.
DrugBanki DB01156. Bupropion.
DB00514. Dextromethorphan.
DB00674. Galantamine.
DB01227. Levomethadyl Acetate.
DB00184. Nicotine.
DB01090. Pentolinium.
DB01273. Varenicline.
GuidetoPHARMACOLOGYi 464.

PTM databases

PhosphoSitei P32297.

Polymorphism databases

DMDMi 254763435.

Proteomic databases

PaxDbi P32297.
PRIDEi P32297.

Protocols and materials databases

DNASUi 1136.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000326828 ; ENSP00000315602 ; ENSG00000080644 . [P32297-2 ]
ENST00000348639 ; ENSP00000267951 ; ENSG00000080644 . [P32297-3 ]
ENST00000559658 ; ENSP00000452896 ; ENSG00000080644 . [P32297-2 ]
GeneIDi 1136.
KEGGi hsa:1136.
UCSCi uc002beb.3. human. [P32297-3 ]
uc002bec.3. human. [P32297-2 ]

Organism-specific databases

CTDi 1136.
GeneCardsi GC15M078885.
H-InvDB HIX0017542.
HGNCi HGNC:1957. CHRNA3.
HPAi HPA029430.
MIMi 118503. gene.
612052. phenotype.
neXtProti NX_P32297.
PharmGKBi PA113.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG290206.
GeneTreei ENSGT00760000118930.
HOVERGENi HBG003756.
InParanoidi P32297.
KOi K04805.
OMAi RTESKGC.
OrthoDBi EOG72JWGV.
PhylomeDBi P32297.
TreeFami TF315605.

Enzyme and pathway databases

Reactomei REACT_22223. Highly sodium permeable acetylcholine nicotinic receptors.
REACT_22303. Highly calcium permeable postsynaptic nicotinic acetylcholine receptors.
REACT_22352. Highly calcium permeable nicotinic acetylcholine receptors.

Miscellaneous databases

ChiTaRSi CHRNA3. human.
GeneWikii CHRNA3.
GenomeRNAii 1136.
NextBioi 4726.
PROi P32297.
SOURCEi Search...

Gene expression databases

Bgeei P32297.
CleanExi HS_CHRNA3.
ExpressionAtlasi P32297. baseline and differential.
Genevestigatori P32297.

Family and domain databases

Gene3Di 1.20.120.370. 2 hits.
2.70.170.10. 1 hit.
InterProi IPR027361. Acetylcholine_rcpt_TM.
IPR006202. Neur_chan_lig-bd.
IPR006201. Neur_channel.
IPR006029. Neurotrans-gated_channel_TM.
IPR018000. Neurotransmitter_ion_chnl_CS.
IPR002394. Nicotinic_acetylcholine_rcpt.
[Graphical view ]
PANTHERi PTHR18945. PTHR18945. 1 hit.
Pfami PF02931. Neur_chan_LBD. 1 hit.
PF02932. Neur_chan_memb. 1 hit.
[Graphical view ]
PRINTSi PR00254. NICOTINICR.
PR00252. NRIONCHANNEL.
SUPFAMi SSF63712. SSF63712. 1 hit.
SSF90112. SSF90112. 1 hit.
TIGRFAMsi TIGR00860. LIC. 1 hit.
PROSITEi PS00236. NEUROTR_ION_CHANNEL. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning of human neuronal nicotinic receptor alpha 3-subunit."
    Fornasari D., Chini B., Tarroni P., Clementi F.
    Neurosci. Lett. 111:351-356(1990) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "Expression of mRNAs in human thymus coding for the alpha 3 subunit of a neuronal acetylcholine receptor."
    Mihovilovic M., Roses A.D.
    Exp. Neurol. 111:175-180(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Thymus.
  3. "Comparative structure of human neuronal alpha 2-alpha 7 and beta 2-beta 4 nicotinic acetylcholine receptor subunits and functional expression of the alpha 2, alpha 3, alpha 4, alpha 7, beta 2, and beta 4 subunits."
    Elliott K.J., Ellis S.B., Berckhan K.J., Urrutia A., Chavez-Noriega L.E., Johnson E.C., Velicelebi G., Harpold M.M.
    J. Mol. Neurosci. 7:217-228(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), VARIANT LEU-23 DEL.
  4. "Cloning and sequence of full-length cDNAs encoding the human neuronal nicotinic acetylcholine receptor (nAChR) subunits beta3 and beta4 and expression of seven nAChR subunits in the human neuroblastoma cell line SH-SY5Y and/or IMR-32."
    Groot Kormelink P.J., Luyten W.H.M.L.
    FEBS Lett. 400:309-314(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT LEU-23 DEL.
  5. "The structures of the human neuronal nicotinic acetylcholine receptor beta2- and alpha3-subunit genes (CHRNB2 and CHRNA3)."
    Rempel N., Heyers S., Engels H., Sleegers E., Steinlein O.K.
    Hum. Genet. 103:645-653(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 2), VARIANT LEU-23 DEL.
  6. "Characterization of the human beta4 nAChR gene and polymorphisms in CHRNA3 and CHRNB4."
    Lev-Lehman E., Bercovich D., Xu W., Stockton D.W., Beaudet A.L.
    J. Hum. Genet. 46:362-366(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  7. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
    Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
    Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
  8. "Analysis of the DNA sequence and duplication history of human chromosome 15."
    Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A.
    , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.
    Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  9. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3), VARIANT LEU-23 DEL.
    Tissue: Brain and Lung.
  10. "Cloning cholinergic receptors in human keratinocytes."
    Arredondo J., Grando S.A.
    Submitted (MAY-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 7-495 (ISOFORMS 1/2).
    Tissue: Keratinocyte.
  11. Anand R., Lindstrom J.
    Submitted (JUN-1990) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 32-505 (ISOFORMS 1/2).
    Tissue: Brain.
  12. "RIC-3 enhances functional expression of multiple nicotinic acetylcholine receptor subtypes in mammalian cells."
    Lansdell S.J., Gee V.J., Harkness P.C., Doward A.I., Baker E.R., Gibb A.J., Millar N.S.
    Mol. Pharmacol. 68:1431-1438(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH RIC3.
  13. Cited for: INVOLVEMENT IN SQTL3 AND LUNG CANCER.
  14. "A susceptibility locus for lung cancer maps to nicotinic acetylcholine receptor subunit genes on 15q25."
    Hung R.J., McKay J.D., Gaborieau V., Boffetta P., Hashibe M., Zaridze D., Mukeria A., Szeszenia-Dabrowska N., Lissowska J., Rudnai P., Fabianova E., Mates D., Bencko V., Foretova L., Janout V., Chen C., Goodman G., Field J.K.
    , Liloglou T., Xinarianos G., Cassidy A., McLaughlin J., Liu G., Narod S., Krokan H.E., Skorpen F., Elvestad M.B., Hveem K., Vatten L., Linseisen J., Clavel-Chapelon F., Vineis P., Bueno-de-Mesquita H.B., Lund E., Martinez C., Bingham S., Rasmuson T., Hainaut P., Riboli E., Ahrens W., Benhamou S., Lagiou P., Trichopoulos D., Holcatova I., Merletti F., Kjaerheim K., Agudo A., Macfarlane G., Talamini R., Simonato L., Lowry R., Conway D.I., Znaor A., Healy C., Zelenika D., Boland A., Delepine M., Foglio M., Lechner D., Matsuda F., Blanche H., Gut I., Heath S., Lathrop M., Brennan P.
    Nature 452:633-637(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: INVOLVEMENT IN SQTL3 AND LUNG CANCER.
  15. "A variant associated with nicotine dependence, lung cancer and peripheral arterial disease."
    Thorgeirsson T.E., Geller F., Sulem P., Rafnar T., Wiste A., Magnusson K.P., Manolescu A., Thorleifsson G., Stefansson H., Ingason A., Stacey S.N., Bergthorsson J.T., Thorlacius S., Gudmundsson J., Jonsson T., Jakobsdottir M., Saemundsdottir J., Olafsdottir O.
    , Gudmundsson L.J., Bjornsdottir G., Kristjansson K., Skuladottir H., Isaksson H.J., Gudbjartsson T., Jones G.T., Mueller T., Gottsaeter A., Flex A., Aben K.K.H., de Vegt F., Mulders P.F.A., Isla D., Vidal M.J., Asin L., Saez B., Murillo L., Blondal T., Kolbeinsson H., Stefansson J.G., Hansdottir I., Runarsdottir V., Pola R., Lindblad B., van Rij A.M., Dieplinger B., Haltmayer M., Mayordomo J.I., Kiemeney L.A., Matthiasson S.E., Oskarsson H., Tyrfingsson T., Gudbjartsson D.F., Gulcher J.R., Jonsson S., Thorsteinsdottir U., Kong A., Stefansson K.
    Nature 452:638-642(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: INVOLVEMENT IN SQTL3 AND LUNG CANCER.
  16. Cited for: INVOLVEMENT IN SQTL3 AND LUNG CANCER.

Entry informationi

Entry nameiACHA3_HUMAN
AccessioniPrimary (citable) accession number: P32297
Secondary accession number(s): Q15823
, Q4KMN8, Q86U77, Q96RH3, Q99553, Q9BQ93, Q9BRR4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1993
Last sequence update: July 28, 2009
Last modified: November 26, 2014
This is version 158 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3