SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P32241

- VIPR1_HUMAN

UniProt

P32241 - VIPR1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Vasoactive intestinal polypeptide receptor 1
Gene
VIPR1
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

This is a receptor for VIP. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. The affinity is VIP = PACAP-27 > PACAP-38.1 Publication

GO - Molecular functioni

  1. protein binding Source: IntAct
  2. vasoactive intestinal polypeptide receptor activity Source: ProtInc

GO - Biological processi

  1. G-protein coupled receptor signaling pathway Source: ProtInc
  2. G-protein coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger Source: ProtInc
  3. digestion Source: ProtInc
  4. immune response Source: ProtInc
  5. muscle contraction Source: ProtInc
  6. positive regulation of cell proliferation Source: ProtInc
  7. synaptic transmission Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

ReactomeiREACT_19327. G alpha (s) signalling events.

Protein family/group databases

TCDBi9.A.14.4.9. the g-protein-coupled receptor (gpcr) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Vasoactive intestinal polypeptide receptor 1
Short name:
VIP-R-1
Alternative name(s):
Pituitary adenylate cyclase-activating polypeptide type II receptor
Short name:
PACAP type II receptor
Short name:
PACAP-R-2
Short name:
PACAP-R2
VPAC1
Gene namesi
Name:VIPR1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 3

Organism-specific databases

HGNCiHGNC:12694. VIPR1.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini31 – 142112Extracellular Reviewed prediction
Add
BLAST
Transmembranei143 – 16725Helical; Name=1; Reviewed prediction
Add
BLAST
Topological domaini168 – 1747Cytoplasmic Reviewed prediction
Transmembranei175 – 19420Helical; Name=2; Reviewed prediction
Add
BLAST
Topological domaini195 – 21622Extracellular Reviewed prediction
Add
BLAST
Transmembranei217 – 24024Helical; Name=3; Reviewed prediction
Add
BLAST
Topological domaini241 – 25414Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei255 – 27622Helical; Name=4; Reviewed prediction
Add
BLAST
Topological domaini277 – 29216Extracellular Reviewed prediction
Add
BLAST
Transmembranei293 – 31624Helical; Name=5; Reviewed prediction
Add
BLAST
Topological domaini317 – 34125Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei342 – 36120Helical; Name=6; Reviewed prediction
Add
BLAST
Topological domaini362 – 37312Extracellular Reviewed prediction
Add
BLAST
Transmembranei374 – 39320Helical; Name=7; Reviewed prediction
Add
BLAST
Topological domaini394 – 45764Cytoplasmic Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. integral component of plasma membrane Source: ProtInc
  2. plasma membrane Source: Reactome
  3. receptor complex Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA37313.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 3030 Reviewed prediction
Add
BLAST
Chaini31 – 457427Vasoactive intestinal polypeptide receptor 1
PRO_0000012855Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi50 ↔ 72 By similarity
Glycosylationi58 – 581N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi63 ↔ 105 By similarity
Glycosylationi69 – 691N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi86 ↔ 122 By similarity
Glycosylationi100 – 1001N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi215 ↔ 2851 Publication
Glycosylationi290 – 2901N-linked (GlcNAc...) Reviewed prediction

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiP32241.
PRIDEiP32241.

PTM databases

PhosphoSiteiP32241.

Expressioni

Tissue specificityi

In lung, HT-29 colonic epithelial cells, Raji B-lymphoblasts. Lesser extent in brain, heart, kidney, liver and placenta. Not expressed in CD4+ or CD8+ T-cells. Expressed in the T-cell lines HARRIS, HuT 78, Jurkat and SUP-T1, but not in the T-cell lines Peer, MOLT-4, HSB and YT.1 Publication

Gene expression databases

ArrayExpressiP32241.
BgeeiP32241.
CleanExiHS_VIPR1.
GenevestigatoriP32241.

Organism-specific databases

HPAiHPA026777.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
VIPP012822EBI-3917984,EBI-6656819

Protein-protein interaction databases

BioGridi113274. 7 interactions.
IntActiP32241. 3 interactions.
MINTiMINT-1217405.
STRINGi9606.ENSP00000327246.

Structurei

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1OF2X-ray2.20C400-408[»]
1OGTX-ray1.47C400-408[»]
3B3IX-ray1.86C400-408[»]
3B6SX-ray1.80C400-408[»]
3DTXX-ray2.10C400-408[»]
3HCVX-ray1.95C400-408[»]
ProteinModelPortaliP32241.
SMRiP32241. Positions 46-398.

Miscellaneous databases

EvolutionaryTraceiP32241.

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG293423.
HOGENOMiHOG000008249.
HOVERGENiHBG008318.
InParanoidiP32241.
KOiK04589.
OMAiEDYGCWD.
OrthoDBiEOG7TF78W.
PhylomeDBiP32241.
TreeFamiTF315710.

Family and domain databases

Gene3Di1.20.1070.10. 1 hit.
InterProiIPR017981. GPCR_2-like.
IPR001879. GPCR_2_extracellular_dom.
IPR000832. GPCR_2_secretin-like.
IPR017983. GPCR_2_secretin-like_CS.
IPR001571. GPCR_2_VIP_rcpt.
IPR001771. GPCR_2_VIP_rcpt_1.
IPR017452. GPCR_Rhodpsn_7TM.
[Graphical view]
PfamiPF00002. 7tm_2. 1 hit.
PF02793. HRM. 1 hit.
[Graphical view]
PRINTSiPR00249. GPCRSECRETIN.
PR00491. VASOACTVEIPR.
PR01154. VIP1RECEPTOR.
SMARTiSM00008. HormR. 1 hit.
[Graphical view]
PROSITEiPS00649. G_PROTEIN_RECEP_F2_1. 1 hit.
PS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
PS50227. G_PROTEIN_RECEP_F2_3. 1 hit.
PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform Short (identifier: P32241-1) [UniParc]FASTAAdd to Basket

Also known as: hIVR8

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MRPPSPLPAR WLCVLAGALA WALGPAGGQA ARLQEECDYV QMIEVQHKQC    50
LEEAQLENET IGCSKMWDNL TCWPATPRGQ VVVLACPLIF KLFSSIQGRN 100
VSRSCTDEGW THLEPGPYPI ACGLDDKAAS LDEQQTMFYG SVKTGYTIGY 150
GLSLATLLVA TAILSLFRKL HCTRNYIHMH LFISFILRAA AVFIKDLALF 200
DSGESDQCSE GSVGCKAAMV FFQYCVMANF FWLLVEGLYL YTLLAVSFFS 250
ERKYFWGYIL IGWGVPSTFT MVWTIARIHF EDYGCWDTIN SSLWWIIKGP 300
ILTSILVNFI LFICIIRILL QKLRPPDIRK SDSSPYSRLA RSTLLLIPLF 350
GVHYIMFAFF PDNFKPEVKM VFELVVGSFQ GFVVAILYCF LNGEVQAELR 400
RKWRRWHLQG VLGWNPKYRH PSGGSNGATC STQVSMLTRV SPGARRSSSF 450
QAEVSLV 457
Length:457
Mass (Da):51,547
Last modified:October 1, 1993 - v1
Checksum:iDAA40CF5BEC47D7D
GO
Isoform Long (identifier: P32241-2) [UniParc]FASTAAdd to Basket

Also known as: hIVR5

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MRPPSPLPARWLCVLAGALAWALGPAGGQAAR → MPPPPLLSLR...RAARSLLGSS

Show »
Length:492
Mass (Da):55,009
Checksum:iD6E529795785C3AA
GO
Isoform 3 (identifier: P32241-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-263: MRPPSPLPAR...YFWGYILIGW → MTRQRVWMRW...PSSLSGSTSG

Show »
Length:247
Mass (Da):28,164
Checksum:i271C125CB317C516
GO
Isoform 4 (identifier: P32241-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: MRPPSPLPARWLCVLAGALAWALGPAGGQAARLQEECDYVQMIEVQHKQCLEEAQLENETI → MRAGRRPRLGPWAG
     134-134: Missing.

Show »
Length:409
Mass (Da):46,268
Checksum:iC66EA5C02820AB12
GO
Isoform 5 (identifier: P32241-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: Missing.

Show »
Length:416
Mass (Da):47,201
Checksum:i4236FD602880CB8C
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti341 – 3411R → M.1 Publication
Corresponds to variant rs17855906 [ dbSNP | Ensembl ].
VAR_055041
Natural varianti445 – 4451R → L.
Corresponds to variant rs3733055 [ dbSNP | Ensembl ].
VAR_020021

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 263263MRPPS…ILIGW → MTRQRVWMRWAVRQPWSFSN IVSWLTSSGCWWRASTCTPC LPSPSSLSGSTSG in isoform 3.
VSP_045143Add
BLAST
Alternative sequencei1 – 6161MRPPS…ENETI → MRAGRRPRLGPWAG in isoform 4.
VSP_047271Add
BLAST
Alternative sequencei1 – 4141Missing in isoform 5.
VSP_047272Add
BLAST
Alternative sequencei1 – 3232MRPPS…GQAAR → MPPPPLLSLRRLGGGWSAVT RLVVAAAGARSRGGRGGSRG AGGGGRGGVARRRRLELRAA RSLLGSS in isoform Long.
VSP_002010Add
BLAST
Alternative sequencei134 – 1341Missing in isoform 4.
VSP_047273

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti80 – 801Q → R in BAG57795. 1 Publication
Sequence conflicti284 – 2841G → GLLR in CAA54814. 1 Publication
Sequence conflicti284 – 2841G → GLLR in CAA53046. 1 Publication
Sequence conflicti320 – 3201L → F in BAG51813. 1 Publication
Sequence conflicti369 – 3691K → R in BAG57795. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
L13288 mRNA. Translation: AAA36805.1.
U11087
, U11079, U11080, U11081, U11083, U11084, U11085, U11086 Genomic DNA. Translation: AAB60362.1.
X75299 mRNA. Translation: CAA53046.1.
X77777 mRNA. Translation: CAA54814.1.
AB065669 Genomic DNA. Translation: BAC05895.1.
EF577396 mRNA. Translation: ABQ52416.1.
AK314334 mRNA. Translation: BAG36980.1.
AK293548 mRNA. Translation: BAG57026.1.
AK294609 mRNA. Translation: BAG57795.1.
AK056819 mRNA. Translation: BAG51813.1.
AC092047 Genomic DNA. No translation available.
CH471055 Genomic DNA. Translation: EAW64649.1.
CH471055 Genomic DNA. Translation: EAW64650.1.
BC064424 mRNA. Translation: AAH64424.1.
L20295 mRNA. Translation: AAA36802.1.
CCDSiCCDS2698.1. [P32241-1]
CCDS58827.1. [P32241-4]
CCDS58828.1. [P32241-5]
CCDS58829.1. [P32241-3]
PIRiJC2194.
JC2195.
RefSeqiNP_001238811.1. NM_001251882.1. [P32241-5]
NP_001238812.1. NM_001251883.1. [P32241-3]
NP_001238813.1. NM_001251884.1. [P32241-4]
NP_001238814.1. NM_001251885.1.
NP_004615.2. NM_004624.3. [P32241-1]
XP_005265495.1. XM_005265438.2. [P32241-5]
XP_006713386.1. XM_006713323.1. [P32241-3]
UniGeneiHs.348500.

Genome annotation databases

EnsembliENST00000325123; ENSP00000327246; ENSG00000114812. [P32241-1]
ENST00000433647; ENSP00000394950; ENSG00000114812. [P32241-5]
ENST00000438259; ENSP00000415371; ENSG00000114812. [P32241-3]
ENST00000543411; ENSP00000445701; ENSG00000114812. [P32241-4]
GeneIDi7433.
KEGGihsa:7433.
UCSCiuc003clf.2. human. [P32241-1]
uc011azm.1. human.

Polymorphism databases

DMDMi418253.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
L13288 mRNA. Translation: AAA36805.1 .
U11087
, U11079 , U11080 , U11081 , U11083 , U11084 , U11085 , U11086 Genomic DNA. Translation: AAB60362.1 .
X75299 mRNA. Translation: CAA53046.1 .
X77777 mRNA. Translation: CAA54814.1 .
AB065669 Genomic DNA. Translation: BAC05895.1 .
EF577396 mRNA. Translation: ABQ52416.1 .
AK314334 mRNA. Translation: BAG36980.1 .
AK293548 mRNA. Translation: BAG57026.1 .
AK294609 mRNA. Translation: BAG57795.1 .
AK056819 mRNA. Translation: BAG51813.1 .
AC092047 Genomic DNA. No translation available.
CH471055 Genomic DNA. Translation: EAW64649.1 .
CH471055 Genomic DNA. Translation: EAW64650.1 .
BC064424 mRNA. Translation: AAH64424.1 .
L20295 mRNA. Translation: AAA36802.1 .
CCDSi CCDS2698.1. [P32241-1 ]
CCDS58827.1. [P32241-4 ]
CCDS58828.1. [P32241-5 ]
CCDS58829.1. [P32241-3 ]
PIRi JC2194.
JC2195.
RefSeqi NP_001238811.1. NM_001251882.1. [P32241-5 ]
NP_001238812.1. NM_001251883.1. [P32241-3 ]
NP_001238813.1. NM_001251884.1. [P32241-4 ]
NP_001238814.1. NM_001251885.1.
NP_004615.2. NM_004624.3. [P32241-1 ]
XP_005265495.1. XM_005265438.2. [P32241-5 ]
XP_006713386.1. XM_006713323.1. [P32241-3 ]
UniGenei Hs.348500.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1OF2 X-ray 2.20 C 400-408 [» ]
1OGT X-ray 1.47 C 400-408 [» ]
3B3I X-ray 1.86 C 400-408 [» ]
3B6S X-ray 1.80 C 400-408 [» ]
3DTX X-ray 2.10 C 400-408 [» ]
3HCV X-ray 1.95 C 400-408 [» ]
ProteinModelPortali P32241.
SMRi P32241. Positions 46-398.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 113274. 7 interactions.
IntActi P32241. 3 interactions.
MINTi MINT-1217405.
STRINGi 9606.ENSP00000327246.

Chemistry

BindingDBi P32241.
ChEMBLi CHEMBL5144.
GuidetoPHARMACOLOGYi 371.

Protein family/group databases

TCDBi 9.A.14.4.9. the g-protein-coupled receptor (gpcr) family.
GPCRDBi Search...

PTM databases

PhosphoSitei P32241.

Polymorphism databases

DMDMi 418253.

Proteomic databases

PaxDbi P32241.
PRIDEi P32241.

Protocols and materials databases

DNASUi 7433.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000325123 ; ENSP00000327246 ; ENSG00000114812 . [P32241-1 ]
ENST00000433647 ; ENSP00000394950 ; ENSG00000114812 . [P32241-5 ]
ENST00000438259 ; ENSP00000415371 ; ENSG00000114812 . [P32241-3 ]
ENST00000543411 ; ENSP00000445701 ; ENSG00000114812 . [P32241-4 ]
GeneIDi 7433.
KEGGi hsa:7433.
UCSCi uc003clf.2. human. [P32241-1 ]
uc011azm.1. human.

Organism-specific databases

CTDi 7433.
GeneCardsi GC03P042520.
HGNCi HGNC:12694. VIPR1.
HPAi HPA026777.
MIMi 192321. gene.
neXtProti NX_P32241.
PharmGKBi PA37313.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG293423.
HOGENOMi HOG000008249.
HOVERGENi HBG008318.
InParanoidi P32241.
KOi K04589.
OMAi EDYGCWD.
OrthoDBi EOG7TF78W.
PhylomeDBi P32241.
TreeFami TF315710.

Enzyme and pathway databases

Reactomei REACT_19327. G alpha (s) signalling events.

Miscellaneous databases

ChiTaRSi VIPR1. human.
EvolutionaryTracei P32241.
GeneWikii VIPR1.
GenomeRNAii 7433.
NextBioi 29114.
PROi P32241.
SOURCEi Search...

Gene expression databases

ArrayExpressi P32241.
Bgeei P32241.
CleanExi HS_VIPR1.
Genevestigatori P32241.

Family and domain databases

Gene3Di 1.20.1070.10. 1 hit.
InterProi IPR017981. GPCR_2-like.
IPR001879. GPCR_2_extracellular_dom.
IPR000832. GPCR_2_secretin-like.
IPR017983. GPCR_2_secretin-like_CS.
IPR001571. GPCR_2_VIP_rcpt.
IPR001771. GPCR_2_VIP_rcpt_1.
IPR017452. GPCR_Rhodpsn_7TM.
[Graphical view ]
Pfami PF00002. 7tm_2. 1 hit.
PF02793. HRM. 1 hit.
[Graphical view ]
PRINTSi PR00249. GPCRSECRETIN.
PR00491. VASOACTVEIPR.
PR01154. VIP1RECEPTOR.
SMARTi SM00008. HormR. 1 hit.
[Graphical view ]
PROSITEi PS00649. G_PROTEIN_RECEP_F2_1. 1 hit.
PS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
PS50227. G_PROTEIN_RECEP_F2_3. 1 hit.
PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and functional expression of a human neuroendocrine vasoactive intestinal peptide receptor."
    Sreedharan S.P., Patel D.R., Huang J.-X., Goetzl E.J.
    Biochem. Biophys. Res. Commun. 193:546-553(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM SHORT).
    Tissue: Intestine.
  2. "Human intestinal VIP receptor: cloning and functional expression of two cDNA encoding proteins with different N-terminal domains."
    Couvineau A., Rouyer-Fessard C., Darmoul D., Maoret J.J., Carrero I., Ogier-Denis E., Laburthe M.
    Biochem. Biophys. Res. Commun. 200:769-776(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS SHORT AND LONG), ALTERNATIVE SPLICING.
    Tissue: Intestine.
  3. "Genome-wide discovery and analysis of human seven transmembrane helix receptor genes."
    Suwa M., Sato T., Okouchi I., Arita M., Futami K., Matsumoto S., Tsutsumi S., Aburatani H., Asai K., Akiyama Y.
    Submitted (JUL-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  4. Martin A.L., Kaighin V.A., Aronstam R.S.
    Submitted (APR-2007) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SHORT).
    Tissue: Lung.
  5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS SHORT; 3; 4 AND 5).
    Tissue: Brain, Cerebellum, Lung and Prostate.
  6. "The DNA sequence, annotation and analysis of human chromosome 3."
    Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
    , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
    Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SHORT), VARIANT MET-341.
  9. "Molecular cloning and functional characterization of a human liver vasoactive intestinal peptide receptor."
    Gagnon A.W., Aiyar N., Elshourbagy N.A.
    Cell. Signal. 6:321-333(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 33-457.
    Tissue: Liver.
  10. "Highly conserved aspartate 68, tryptophan 73 and glycine 109 in the N-terminal extracellular domain of the human VIP receptor are essential for its ability to bind VIP."
    Couvineau A., Gaudin P., Maoret J.J., Rouyer-Fessard C., Nicole P., Laburthe M.
    Biochem. Biophys. Res. Commun. 206:246-252(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH VIP.
  11. "Predominant expression of type II vasoactive intestinal peptide receptors by human T lymphoblastoma cells: transduction of both Ca2+ and cyclic AMP signals."
    Xia M., Sreedharan S.P., Goetzl E.J.
    J. Clin. Immunol. 16:21-30(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TISSUE SPECIFICITY.
  12. "Importance of conserved cysteines in the extracellular loops of human PACAP/VIP1 receptor for ligand binding and stimulation of cAMP production."
    Knudsen S.M., Tams J.W., Wulff B.S., Fahrenkrug J.
    Ann. N. Y. Acad. Sci. 865:259-265(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: DISULFIDE BOND.
  13. Cited for: X-RAY CRYSTALLOGRAPHY (1.47 ANGSTROMS) OF 400-408 IN COMPLEX WITH MHC.
  14. "Citrullination-dependent differential presentation of a self-peptide by HLA-B27 subtypes."
    Beltrami A., Rossmann M., Fiorillo M.T., Paladini F., Sorrentino R., Saenger W., Kumar P., Ziegler A., Uchanska-Ziegler B.
    J. Biol. Chem. 283:27189-27199(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (1.86 ANGSTROMS) OF 400-408 IN COMPLEX WITH MHC.

Entry informationi

Entry nameiVIPR1_HUMAN
AccessioniPrimary (citable) accession number: P32241
Secondary accession number(s): A5JUT9
, B3KPV1, B4DEB5, B4DGI4, F5H1F5, G3V0I1, Q15871, Q6P2M6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1993
Last sequence update: October 1, 1993
Last modified: September 3, 2014
This is version 142 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi