Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P32241

- VIPR1_HUMAN

UniProt

P32241 - VIPR1_HUMAN

Protein

Vasoactive intestinal polypeptide receptor 1

Gene

VIPR1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 143 (01 Oct 2014)
      Sequence version 1 (01 Oct 1993)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    This is a receptor for VIP. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. The affinity is VIP = PACAP-27 > PACAP-38.1 Publication

    GO - Molecular functioni

    1. protein binding Source: IntAct
    2. vasoactive intestinal polypeptide receptor activity Source: ProtInc

    GO - Biological processi

    1. digestion Source: ProtInc
    2. G-protein coupled receptor signaling pathway Source: ProtInc
    3. G-protein coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger Source: ProtInc
    4. immune response Source: ProtInc
    5. muscle contraction Source: ProtInc
    6. positive regulation of cell proliferation Source: ProtInc
    7. synaptic transmission Source: ProtInc

    Keywords - Molecular functioni

    G-protein coupled receptor, Receptor, Transducer

    Enzyme and pathway databases

    ReactomeiREACT_19327. G alpha (s) signalling events.

    Protein family/group databases

    TCDBi9.A.14.4.9. the g-protein-coupled receptor (gpcr) family.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Vasoactive intestinal polypeptide receptor 1
    Short name:
    VIP-R-1
    Alternative name(s):
    Pituitary adenylate cyclase-activating polypeptide type II receptor
    Short name:
    PACAP type II receptor
    Short name:
    PACAP-R-2
    Short name:
    PACAP-R2
    VPAC1
    Gene namesi
    Name:VIPR1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 3

    Organism-specific databases

    HGNCiHGNC:12694. VIPR1.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of plasma membrane Source: ProtInc
    2. plasma membrane Source: Reactome
    3. receptor complex Source: MGI

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA37313.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 3030Sequence AnalysisAdd
    BLAST
    Chaini31 – 457427Vasoactive intestinal polypeptide receptor 1PRO_0000012855Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi50 ↔ 72By similarity
    Glycosylationi58 – 581N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi63 ↔ 105By similarity
    Glycosylationi69 – 691N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi86 ↔ 122By similarity
    Glycosylationi100 – 1001N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi215 ↔ 2851 Publication
    Glycosylationi290 – 2901N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiP32241.
    PRIDEiP32241.

    PTM databases

    PhosphoSiteiP32241.

    Expressioni

    Tissue specificityi

    In lung, HT-29 colonic epithelial cells, Raji B-lymphoblasts. Lesser extent in brain, heart, kidney, liver and placenta. Not expressed in CD4+ or CD8+ T-cells. Expressed in the T-cell lines HARRIS, HuT 78, Jurkat and SUP-T1, but not in the T-cell lines Peer, MOLT-4, HSB and YT.1 Publication

    Gene expression databases

    ArrayExpressiP32241.
    BgeeiP32241.
    CleanExiHS_VIPR1.
    GenevestigatoriP32241.

    Organism-specific databases

    HPAiHPA026777.

    Interactioni

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    VIPP012822EBI-3917984,EBI-6656819

    Protein-protein interaction databases

    BioGridi113274. 7 interactions.
    IntActiP32241. 3 interactions.
    MINTiMINT-1217405.
    STRINGi9606.ENSP00000327246.

    Structurei

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1OF2X-ray2.20C400-408[»]
    1OGTX-ray1.47C400-408[»]
    3B3IX-ray1.86C400-408[»]
    3B6SX-ray1.80C400-408[»]
    3DTXX-ray2.10C400-408[»]
    3HCVX-ray1.95C400-408[»]
    ProteinModelPortaliP32241.
    SMRiP32241. Positions 46-398.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiP32241.

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini31 – 142112ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini168 – 1747CytoplasmicSequence Analysis
    Topological domaini195 – 21622ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini241 – 25414CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini277 – 29216ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini317 – 34125CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini362 – 37312ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini394 – 45764CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei143 – 16725Helical; Name=1Sequence AnalysisAdd
    BLAST
    Transmembranei175 – 19420Helical; Name=2Sequence AnalysisAdd
    BLAST
    Transmembranei217 – 24024Helical; Name=3Sequence AnalysisAdd
    BLAST
    Transmembranei255 – 27622Helical; Name=4Sequence AnalysisAdd
    BLAST
    Transmembranei293 – 31624Helical; Name=5Sequence AnalysisAdd
    BLAST
    Transmembranei342 – 36120Helical; Name=6Sequence AnalysisAdd
    BLAST
    Transmembranei374 – 39320Helical; Name=7Sequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Keywords - Domaini

    Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG293423.
    HOGENOMiHOG000008249.
    HOVERGENiHBG008318.
    InParanoidiP32241.
    KOiK04589.
    OMAiEDYGCWD.
    OrthoDBiEOG7TF78W.
    PhylomeDBiP32241.
    TreeFamiTF315710.

    Family and domain databases

    Gene3Di1.20.1070.10. 1 hit.
    InterProiIPR017981. GPCR_2-like.
    IPR001879. GPCR_2_extracellular_dom.
    IPR000832. GPCR_2_secretin-like.
    IPR017983. GPCR_2_secretin-like_CS.
    IPR001571. GPCR_2_VIP_rcpt.
    IPR001771. GPCR_2_VIP_rcpt_1.
    IPR017452. GPCR_Rhodpsn_7TM.
    [Graphical view]
    PfamiPF00002. 7tm_2. 1 hit.
    PF02793. HRM. 1 hit.
    [Graphical view]
    PRINTSiPR00249. GPCRSECRETIN.
    PR00491. VASOACTVEIPR.
    PR01154. VIP1RECEPTOR.
    SMARTiSM00008. HormR. 1 hit.
    [Graphical view]
    PROSITEiPS00649. G_PROTEIN_RECEP_F2_1. 1 hit.
    PS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
    PS50227. G_PROTEIN_RECEP_F2_3. 1 hit.
    PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform Short (identifier: P32241-1) [UniParc]FASTAAdd to Basket

    Also known as: hIVR8

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MRPPSPLPAR WLCVLAGALA WALGPAGGQA ARLQEECDYV QMIEVQHKQC    50
    LEEAQLENET IGCSKMWDNL TCWPATPRGQ VVVLACPLIF KLFSSIQGRN 100
    VSRSCTDEGW THLEPGPYPI ACGLDDKAAS LDEQQTMFYG SVKTGYTIGY 150
    GLSLATLLVA TAILSLFRKL HCTRNYIHMH LFISFILRAA AVFIKDLALF 200
    DSGESDQCSE GSVGCKAAMV FFQYCVMANF FWLLVEGLYL YTLLAVSFFS 250
    ERKYFWGYIL IGWGVPSTFT MVWTIARIHF EDYGCWDTIN SSLWWIIKGP 300
    ILTSILVNFI LFICIIRILL QKLRPPDIRK SDSSPYSRLA RSTLLLIPLF 350
    GVHYIMFAFF PDNFKPEVKM VFELVVGSFQ GFVVAILYCF LNGEVQAELR 400
    RKWRRWHLQG VLGWNPKYRH PSGGSNGATC STQVSMLTRV SPGARRSSSF 450
    QAEVSLV 457
    Length:457
    Mass (Da):51,547
    Last modified:October 1, 1993 - v1
    Checksum:iDAA40CF5BEC47D7D
    GO
    Isoform Long (identifier: P32241-2) [UniParc]FASTAAdd to Basket

    Also known as: hIVR5

    The sequence of this isoform differs from the canonical sequence as follows:
         1-32: MRPPSPLPARWLCVLAGALAWALGPAGGQAAR → MPPPPLLSLR...RAARSLLGSS

    Show »
    Length:492
    Mass (Da):55,009
    Checksum:iD6E529795785C3AA
    GO
    Isoform 3 (identifier: P32241-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-263: MRPPSPLPAR...YFWGYILIGW → MTRQRVWMRW...PSSLSGSTSG

    Show »
    Length:247
    Mass (Da):28,164
    Checksum:i271C125CB317C516
    GO
    Isoform 4 (identifier: P32241-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-61: MRPPSPLPARWLCVLAGALAWALGPAGGQAARLQEECDYVQMIEVQHKQCLEEAQLENETI → MRAGRRPRLGPWAG
         134-134: Missing.

    Show »
    Length:409
    Mass (Da):46,268
    Checksum:iC66EA5C02820AB12
    GO
    Isoform 5 (identifier: P32241-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-41: Missing.

    Show »
    Length:416
    Mass (Da):47,201
    Checksum:i4236FD602880CB8C
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti80 – 801Q → R in BAG57795. (PubMed:14702039)Curated
    Sequence conflicti284 – 2841G → GLLR in CAA54814. (PubMed:8179610)Curated
    Sequence conflicti284 – 2841G → GLLR in CAA53046. (PubMed:8179610)Curated
    Sequence conflicti320 – 3201L → F in BAG51813. (PubMed:14702039)Curated
    Sequence conflicti369 – 3691K → R in BAG57795. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti341 – 3411R → M.1 Publication
    Corresponds to variant rs17855906 [ dbSNP | Ensembl ].
    VAR_055041
    Natural varianti445 – 4451R → L.
    Corresponds to variant rs3733055 [ dbSNP | Ensembl ].
    VAR_020021

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 263263MRPPS…ILIGW → MTRQRVWMRWAVRQPWSFSN IVSWLTSSGCWWRASTCTPC LPSPSSLSGSTSG in isoform 3. 1 PublicationVSP_045143Add
    BLAST
    Alternative sequencei1 – 6161MRPPS…ENETI → MRAGRRPRLGPWAG in isoform 4. 1 PublicationVSP_047271Add
    BLAST
    Alternative sequencei1 – 4141Missing in isoform 5. 1 PublicationVSP_047272Add
    BLAST
    Alternative sequencei1 – 3232MRPPS…GQAAR → MPPPPLLSLRRLGGGWSAVT RLVVAAAGARSRGGRGGSRG AGGGGRGGVARRRRLELRAA RSLLGSS in isoform Long. 1 PublicationVSP_002010Add
    BLAST
    Alternative sequencei134 – 1341Missing in isoform 4. 1 PublicationVSP_047273

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L13288 mRNA. Translation: AAA36805.1.
    U11087
    , U11079, U11080, U11081, U11083, U11084, U11085, U11086 Genomic DNA. Translation: AAB60362.1.
    X75299 mRNA. Translation: CAA53046.1.
    X77777 mRNA. Translation: CAA54814.1.
    AB065669 Genomic DNA. Translation: BAC05895.1.
    EF577396 mRNA. Translation: ABQ52416.1.
    AK314334 mRNA. Translation: BAG36980.1.
    AK293548 mRNA. Translation: BAG57026.1.
    AK294609 mRNA. Translation: BAG57795.1.
    AK056819 mRNA. Translation: BAG51813.1.
    AC092047 Genomic DNA. No translation available.
    CH471055 Genomic DNA. Translation: EAW64649.1.
    CH471055 Genomic DNA. Translation: EAW64650.1.
    BC064424 mRNA. Translation: AAH64424.1.
    L20295 mRNA. Translation: AAA36802.1.
    CCDSiCCDS2698.1. [P32241-1]
    CCDS58827.1. [P32241-4]
    CCDS58828.1. [P32241-5]
    CCDS58829.1. [P32241-3]
    PIRiJC2194.
    JC2195.
    RefSeqiNP_001238811.1. NM_001251882.1. [P32241-5]
    NP_001238812.1. NM_001251883.1. [P32241-3]
    NP_001238813.1. NM_001251884.1. [P32241-4]
    NP_001238814.1. NM_001251885.1.
    NP_004615.2. NM_004624.3. [P32241-1]
    XP_005265495.1. XM_005265438.2. [P32241-5]
    XP_006713386.1. XM_006713323.1. [P32241-3]
    UniGeneiHs.348500.

    Genome annotation databases

    EnsembliENST00000325123; ENSP00000327246; ENSG00000114812. [P32241-1]
    ENST00000433647; ENSP00000394950; ENSG00000114812. [P32241-5]
    ENST00000438259; ENSP00000415371; ENSG00000114812. [P32241-3]
    ENST00000543411; ENSP00000445701; ENSG00000114812. [P32241-4]
    GeneIDi7433.
    KEGGihsa:7433.
    UCSCiuc003clf.2. human. [P32241-1]
    uc011azm.1. human.

    Polymorphism databases

    DMDMi418253.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L13288 mRNA. Translation: AAA36805.1 .
    U11087
    , U11079 , U11080 , U11081 , U11083 , U11084 , U11085 , U11086 Genomic DNA. Translation: AAB60362.1 .
    X75299 mRNA. Translation: CAA53046.1 .
    X77777 mRNA. Translation: CAA54814.1 .
    AB065669 Genomic DNA. Translation: BAC05895.1 .
    EF577396 mRNA. Translation: ABQ52416.1 .
    AK314334 mRNA. Translation: BAG36980.1 .
    AK293548 mRNA. Translation: BAG57026.1 .
    AK294609 mRNA. Translation: BAG57795.1 .
    AK056819 mRNA. Translation: BAG51813.1 .
    AC092047 Genomic DNA. No translation available.
    CH471055 Genomic DNA. Translation: EAW64649.1 .
    CH471055 Genomic DNA. Translation: EAW64650.1 .
    BC064424 mRNA. Translation: AAH64424.1 .
    L20295 mRNA. Translation: AAA36802.1 .
    CCDSi CCDS2698.1. [P32241-1 ]
    CCDS58827.1. [P32241-4 ]
    CCDS58828.1. [P32241-5 ]
    CCDS58829.1. [P32241-3 ]
    PIRi JC2194.
    JC2195.
    RefSeqi NP_001238811.1. NM_001251882.1. [P32241-5 ]
    NP_001238812.1. NM_001251883.1. [P32241-3 ]
    NP_001238813.1. NM_001251884.1. [P32241-4 ]
    NP_001238814.1. NM_001251885.1.
    NP_004615.2. NM_004624.3. [P32241-1 ]
    XP_005265495.1. XM_005265438.2. [P32241-5 ]
    XP_006713386.1. XM_006713323.1. [P32241-3 ]
    UniGenei Hs.348500.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1OF2 X-ray 2.20 C 400-408 [» ]
    1OGT X-ray 1.47 C 400-408 [» ]
    3B3I X-ray 1.86 C 400-408 [» ]
    3B6S X-ray 1.80 C 400-408 [» ]
    3DTX X-ray 2.10 C 400-408 [» ]
    3HCV X-ray 1.95 C 400-408 [» ]
    ProteinModelPortali P32241.
    SMRi P32241. Positions 46-398.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 113274. 7 interactions.
    IntActi P32241. 3 interactions.
    MINTi MINT-1217405.
    STRINGi 9606.ENSP00000327246.

    Chemistry

    BindingDBi P32241.
    ChEMBLi CHEMBL5144.
    GuidetoPHARMACOLOGYi 371.

    Protein family/group databases

    TCDBi 9.A.14.4.9. the g-protein-coupled receptor (gpcr) family.
    GPCRDBi Search...

    PTM databases

    PhosphoSitei P32241.

    Polymorphism databases

    DMDMi 418253.

    Proteomic databases

    PaxDbi P32241.
    PRIDEi P32241.

    Protocols and materials databases

    DNASUi 7433.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000325123 ; ENSP00000327246 ; ENSG00000114812 . [P32241-1 ]
    ENST00000433647 ; ENSP00000394950 ; ENSG00000114812 . [P32241-5 ]
    ENST00000438259 ; ENSP00000415371 ; ENSG00000114812 . [P32241-3 ]
    ENST00000543411 ; ENSP00000445701 ; ENSG00000114812 . [P32241-4 ]
    GeneIDi 7433.
    KEGGi hsa:7433.
    UCSCi uc003clf.2. human. [P32241-1 ]
    uc011azm.1. human.

    Organism-specific databases

    CTDi 7433.
    GeneCardsi GC03P042520.
    HGNCi HGNC:12694. VIPR1.
    HPAi HPA026777.
    MIMi 192321. gene.
    neXtProti NX_P32241.
    PharmGKBi PA37313.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG293423.
    HOGENOMi HOG000008249.
    HOVERGENi HBG008318.
    InParanoidi P32241.
    KOi K04589.
    OMAi EDYGCWD.
    OrthoDBi EOG7TF78W.
    PhylomeDBi P32241.
    TreeFami TF315710.

    Enzyme and pathway databases

    Reactomei REACT_19327. G alpha (s) signalling events.

    Miscellaneous databases

    ChiTaRSi VIPR1. human.
    EvolutionaryTracei P32241.
    GeneWikii VIPR1.
    GenomeRNAii 7433.
    NextBioi 29114.
    PROi P32241.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P32241.
    Bgeei P32241.
    CleanExi HS_VIPR1.
    Genevestigatori P32241.

    Family and domain databases

    Gene3Di 1.20.1070.10. 1 hit.
    InterProi IPR017981. GPCR_2-like.
    IPR001879. GPCR_2_extracellular_dom.
    IPR000832. GPCR_2_secretin-like.
    IPR017983. GPCR_2_secretin-like_CS.
    IPR001571. GPCR_2_VIP_rcpt.
    IPR001771. GPCR_2_VIP_rcpt_1.
    IPR017452. GPCR_Rhodpsn_7TM.
    [Graphical view ]
    Pfami PF00002. 7tm_2. 1 hit.
    PF02793. HRM. 1 hit.
    [Graphical view ]
    PRINTSi PR00249. GPCRSECRETIN.
    PR00491. VASOACTVEIPR.
    PR01154. VIP1RECEPTOR.
    SMARTi SM00008. HormR. 1 hit.
    [Graphical view ]
    PROSITEi PS00649. G_PROTEIN_RECEP_F2_1. 1 hit.
    PS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
    PS50227. G_PROTEIN_RECEP_F2_3. 1 hit.
    PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and functional expression of a human neuroendocrine vasoactive intestinal peptide receptor."
      Sreedharan S.P., Patel D.R., Huang J.-X., Goetzl E.J.
      Biochem. Biophys. Res. Commun. 193:546-553(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM SHORT).
      Tissue: Intestine.
    2. "Human intestinal VIP receptor: cloning and functional expression of two cDNA encoding proteins with different N-terminal domains."
      Couvineau A., Rouyer-Fessard C., Darmoul D., Maoret J.J., Carrero I., Ogier-Denis E., Laburthe M.
      Biochem. Biophys. Res. Commun. 200:769-776(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS SHORT AND LONG), ALTERNATIVE SPLICING.
      Tissue: Intestine.
    3. "Genome-wide discovery and analysis of human seven transmembrane helix receptor genes."
      Suwa M., Sato T., Okouchi I., Arita M., Futami K., Matsumoto S., Tsutsumi S., Aburatani H., Asai K., Akiyama Y.
      Submitted (JUL-2001) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    4. Martin A.L., Kaighin V.A., Aronstam R.S.
      Submitted (APR-2007) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SHORT).
      Tissue: Lung.
    5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS SHORT; 3; 4 AND 5).
      Tissue: Brain, Cerebellum, Lung and Prostate.
    6. "The DNA sequence, annotation and analysis of human chromosome 3."
      Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
      , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
      Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SHORT), VARIANT MET-341.
    9. "Molecular cloning and functional characterization of a human liver vasoactive intestinal peptide receptor."
      Gagnon A.W., Aiyar N., Elshourbagy N.A.
      Cell. Signal. 6:321-333(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 33-457.
      Tissue: Liver.
    10. "Highly conserved aspartate 68, tryptophan 73 and glycine 109 in the N-terminal extracellular domain of the human VIP receptor are essential for its ability to bind VIP."
      Couvineau A., Gaudin P., Maoret J.J., Rouyer-Fessard C., Nicole P., Laburthe M.
      Biochem. Biophys. Res. Commun. 206:246-252(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH VIP.
    11. "Predominant expression of type II vasoactive intestinal peptide receptors by human T lymphoblastoma cells: transduction of both Ca2+ and cyclic AMP signals."
      Xia M., Sreedharan S.P., Goetzl E.J.
      J. Clin. Immunol. 16:21-30(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, TISSUE SPECIFICITY.
    12. "Importance of conserved cysteines in the extracellular loops of human PACAP/VIP1 receptor for ligand binding and stimulation of cAMP production."
      Knudsen S.M., Tams J.W., Wulff B.S., Fahrenkrug J.
      Ann. N. Y. Acad. Sci. 865:259-265(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: DISULFIDE BOND.
    13. Cited for: X-RAY CRYSTALLOGRAPHY (1.47 ANGSTROMS) OF 400-408 IN COMPLEX WITH MHC.
    14. "Citrullination-dependent differential presentation of a self-peptide by HLA-B27 subtypes."
      Beltrami A., Rossmann M., Fiorillo M.T., Paladini F., Sorrentino R., Saenger W., Kumar P., Ziegler A., Uchanska-Ziegler B.
      J. Biol. Chem. 283:27189-27199(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (1.86 ANGSTROMS) OF 400-408 IN COMPLEX WITH MHC.

    Entry informationi

    Entry nameiVIPR1_HUMAN
    AccessioniPrimary (citable) accession number: P32241
    Secondary accession number(s): A5JUT9
    , B3KPV1, B4DEB5, B4DGI4, F5H1F5, G3V0I1, Q15871, Q6P2M6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 1, 1993
    Last sequence update: October 1, 1993
    Last modified: October 1, 2014
    This is version 143 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. 7-transmembrane G-linked receptors
      List of 7-transmembrane G-linked receptor entries
    2. Human chromosome 3
      Human chromosome 3: entries, gene names and cross-references to MIM
    3. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    4. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    5. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    6. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    7. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3