Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Vasoactive intestinal polypeptide receptor 1

Gene

VIPR1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

This is a receptor for VIP. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. The affinity is VIP = PACAP-27 > PACAP-38.1 Publication

GO - Molecular functioni

  • peptide hormone binding Source: GO_Central
  • vasoactive intestinal polypeptide receptor activity Source: GO_Central

GO - Biological processi

Keywordsi

Molecular functionG-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

ReactomeiR-HSA-418555 G alpha (s) signalling events
R-HSA-420092 Glucagon-type ligand receptors
SIGNORiP32241

Protein family/group databases

TCDBi9.A.14.4.9 the g-protein-coupled receptor (gpcr) family

Names & Taxonomyi

Protein namesi
Recommended name:
Vasoactive intestinal polypeptide receptor 1
Short name:
VIP-R-1
Alternative name(s):
Pituitary adenylate cyclase-activating polypeptide type II receptor
Short name:
PACAP type II receptor
Short name:
PACAP-R-2
Short name:
PACAP-R2
VPAC1
Gene namesi
Name:VIPR1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

EuPathDBiHostDB:ENSG00000114812.12
HGNCiHGNC:12694 VIPR1
MIMi192321 gene
neXtProtiNX_P32241

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini31 – 142ExtracellularSequence analysisAdd BLAST112
Transmembranei143 – 167Helical; Name=1Sequence analysisAdd BLAST25
Topological domaini168 – 174CytoplasmicSequence analysis7
Transmembranei175 – 194Helical; Name=2Sequence analysisAdd BLAST20
Topological domaini195 – 216ExtracellularSequence analysisAdd BLAST22
Transmembranei217 – 240Helical; Name=3Sequence analysisAdd BLAST24
Topological domaini241 – 254CytoplasmicSequence analysisAdd BLAST14
Transmembranei255 – 276Helical; Name=4Sequence analysisAdd BLAST22
Topological domaini277 – 292ExtracellularSequence analysisAdd BLAST16
Transmembranei293 – 316Helical; Name=5Sequence analysisAdd BLAST24
Topological domaini317 – 341CytoplasmicSequence analysisAdd BLAST25
Transmembranei342 – 361Helical; Name=6Sequence analysisAdd BLAST20
Topological domaini362 – 373ExtracellularSequence analysisAdd BLAST12
Transmembranei374 – 393Helical; Name=7Sequence analysisAdd BLAST20
Topological domaini394 – 457CytoplasmicSequence analysisAdd BLAST64

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi7433
OpenTargetsiENSG00000114812
PharmGKBiPA37313

Chemistry databases

ChEMBLiCHEMBL5144
GuidetoPHARMACOLOGYi371

Polymorphism and mutation databases

BioMutaiVIPR1
DMDMi418253

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 30Sequence analysisAdd BLAST30
ChainiPRO_000001285531 – 457Vasoactive intestinal polypeptide receptor 1Add BLAST427

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi50 ↔ 72By similarity
Glycosylationi58N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi63 ↔ 105By similarity
Glycosylationi69N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi86 ↔ 122By similarity
Glycosylationi100N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi215 ↔ 2851 Publication
Glycosylationi290N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiP32241
PeptideAtlasiP32241
PRIDEiP32241

PTM databases

iPTMnetiP32241
PhosphoSitePlusiP32241

Expressioni

Tissue specificityi

In lung, HT-29 colonic epithelial cells, Raji B-lymphoblasts. Lesser extent in brain, heart, kidney, liver and placenta. Not expressed in CD4+ or CD8+ T-cells. Expressed in the T-cell lines HARRIS, HuT 78, Jurkat and SUP-T1, but not in the T-cell lines Peer, MOLT-4, HSB and YT.1 Publication

Gene expression databases

BgeeiENSG00000114812
CleanExiHS_VIPR1
ExpressionAtlasiP32241 baseline and differential
GenevisibleiP32241 HS

Organism-specific databases

HPAiHPA026777

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
VIPP012822EBI-3917984,EBI-6656819

Protein-protein interaction databases

BioGridi11327434 interactors.
IntActiP32241 5 interactors.
MINTiP32241
STRINGi9606.ENSP00000327246

Chemistry databases

BindingDBiP32241

Structurei

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1OF2X-ray2.20C400-408[»]
1OGTX-ray1.47C400-408[»]
3B3IX-ray1.86C400-408[»]
3B6SX-ray1.80C400-408[»]
3DTXX-ray2.10C400-408[»]
3HCVX-ray1.95C400-408[»]
5DEFX-ray1.60C400-408[»]
5DEGX-ray1.83C400-408[»]
5IB1X-ray1.91C400-408[»]
5IB2X-ray1.44C400-408[»]
5IB3X-ray1.91C400-408[»]
5IB4X-ray1.95C400-408[»]
5IB5X-ray2.49C/F400-408[»]
ProteinModelPortaliP32241
SMRiP32241
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP32241

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG4564 Eukaryota
ENOG410XRS2 LUCA
GeneTreeiENSGT00760000118800
HOGENOMiHOG000008249
HOVERGENiHBG008318
InParanoidiP32241
KOiK04589
OMAiFWWIIKT
OrthoDBiEOG091G0NF8
PhylomeDBiP32241
TreeFamiTF315710

Family and domain databases

Gene3Di4.10.1240.101 hit
InterProiView protein in InterPro
IPR017981 GPCR_2-like
IPR036445 GPCR_2_extracell_dom_sf
IPR001879 GPCR_2_extracellular_dom
IPR000832 GPCR_2_secretin-like
IPR017983 GPCR_2_secretin-like_CS
IPR001571 GPCR_2_VIP_rcpt
IPR001771 GPCR_2_VIP_rcpt_1
PfamiView protein in Pfam
PF00002 7tm_2, 1 hit
PF02793 HRM, 1 hit
PRINTSiPR00249 GPCRSECRETIN
PR00491 VASOACTVEIPR
PR01154 VIP1RECEPTOR
SMARTiView protein in SMART
SM00008 HormR, 1 hit
SUPFAMiSSF111418 SSF111418, 1 hit
PROSITEiView protein in PROSITE
PS00649 G_PROTEIN_RECEP_F2_1, 1 hit
PS00650 G_PROTEIN_RECEP_F2_2, 1 hit
PS50227 G_PROTEIN_RECEP_F2_3, 1 hit
PS50261 G_PROTEIN_RECEP_F2_4, 1 hit

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform Short (identifier: P32241-1) [UniParc]FASTAAdd to basket
Also known as: hIVR8

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRPPSPLPAR WLCVLAGALA WALGPAGGQA ARLQEECDYV QMIEVQHKQC
60 70 80 90 100
LEEAQLENET IGCSKMWDNL TCWPATPRGQ VVVLACPLIF KLFSSIQGRN
110 120 130 140 150
VSRSCTDEGW THLEPGPYPI ACGLDDKAAS LDEQQTMFYG SVKTGYTIGY
160 170 180 190 200
GLSLATLLVA TAILSLFRKL HCTRNYIHMH LFISFILRAA AVFIKDLALF
210 220 230 240 250
DSGESDQCSE GSVGCKAAMV FFQYCVMANF FWLLVEGLYL YTLLAVSFFS
260 270 280 290 300
ERKYFWGYIL IGWGVPSTFT MVWTIARIHF EDYGCWDTIN SSLWWIIKGP
310 320 330 340 350
ILTSILVNFI LFICIIRILL QKLRPPDIRK SDSSPYSRLA RSTLLLIPLF
360 370 380 390 400
GVHYIMFAFF PDNFKPEVKM VFELVVGSFQ GFVVAILYCF LNGEVQAELR
410 420 430 440 450
RKWRRWHLQG VLGWNPKYRH PSGGSNGATC STQVSMLTRV SPGARRSSSF

QAEVSLV
Length:457
Mass (Da):51,547
Last modified:October 1, 1993 - v1
Checksum:iDAA40CF5BEC47D7D
GO
Isoform Long (identifier: P32241-2) [UniParc]FASTAAdd to basket
Also known as: hIVR5

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MRPPSPLPARWLCVLAGALAWALGPAGGQAAR → MPPPPLLSLR...RAARSLLGSS

Show »
Length:492
Mass (Da):55,009
Checksum:iD6E529795785C3AA
GO
Isoform 3 (identifier: P32241-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-263: MRPPSPLPAR...YFWGYILIGW → MTRQRVWMRW...PSSLSGSTSG

Show »
Length:247
Mass (Da):28,164
Checksum:i271C125CB317C516
GO
Isoform 4 (identifier: P32241-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: MRPPSPLPARWLCVLAGALAWALGPAGGQAARLQEECDYVQMIEVQHKQCLEEAQLENETI → MRAGRRPRLGPWAG
     134-134: Missing.

Show »
Length:409
Mass (Da):46,268
Checksum:iC66EA5C02820AB12
GO
Isoform 5 (identifier: P32241-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: Missing.

Show »
Length:416
Mass (Da):47,201
Checksum:i4236FD602880CB8C
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti80Q → R in BAG57795 (PubMed:14702039).Curated1
Sequence conflicti284G → GLLR in CAA54814 (PubMed:8179610).Curated1
Sequence conflicti284G → GLLR in CAA53046 (PubMed:8179610).Curated1
Sequence conflicti320L → F in BAG51813 (PubMed:14702039).Curated1
Sequence conflicti369K → R in BAG57795 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_055041341R → M1 PublicationCorresponds to variant dbSNP:rs17855906Ensembl.1
Natural variantiVAR_020021445R → L. Corresponds to variant dbSNP:rs3733055Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0451431 – 263MRPPS…ILIGW → MTRQRVWMRWAVRQPWSFSN IVSWLTSSGCWWRASTCTPC LPSPSSLSGSTSG in isoform 3. 1 PublicationAdd BLAST263
Alternative sequenceiVSP_0472711 – 61MRPPS…ENETI → MRAGRRPRLGPWAG in isoform 4. 1 PublicationAdd BLAST61
Alternative sequenceiVSP_0472721 – 41Missing in isoform 5. 1 PublicationAdd BLAST41
Alternative sequenceiVSP_0020101 – 32MRPPS…GQAAR → MPPPPLLSLRRLGGGWSAVT RLVVAAAGARSRGGRGGSRG AGGGGRGGVARRRRLELRAA RSLLGSS in isoform Long. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_047273134Missing in isoform 4. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L13288 mRNA Translation: AAA36805.1
U11087
, U11079, U11080, U11081, U11083, U11084, U11085, U11086 Genomic DNA Translation: AAB60362.1
X75299 mRNA Translation: CAA53046.1
X77777 mRNA Translation: CAA54814.1
AB065669 Genomic DNA Translation: BAC05895.1
EF577396 mRNA Translation: ABQ52416.1
AK314334 mRNA Translation: BAG36980.1
AK293548 mRNA Translation: BAG57026.1
AK294609 mRNA Translation: BAG57795.1
AK056819 mRNA Translation: BAG51813.1
AC092047 Genomic DNA No translation available.
CH471055 Genomic DNA Translation: EAW64649.1
CH471055 Genomic DNA Translation: EAW64650.1
BC064424 mRNA Translation: AAH64424.1
L20295 mRNA Translation: AAA36802.1
CCDSiCCDS2698.1 [P32241-1]
CCDS58827.1 [P32241-4]
CCDS58828.1 [P32241-5]
CCDS58829.1 [P32241-3]
PIRiJC2194
JC2195
RefSeqiNP_001238811.1, NM_001251882.1 [P32241-5]
NP_001238812.1, NM_001251883.1 [P32241-3]
NP_001238813.1, NM_001251884.1 [P32241-4]
NP_001238814.1, NM_001251885.1
NP_004615.2, NM_004624.3 [P32241-1]
XP_005265495.1, XM_005265438.3 [P32241-5]
XP_011532381.1, XM_011534079.1 [P32241-5]
UniGeneiHs.348500

Genome annotation databases

EnsembliENST00000325123; ENSP00000327246; ENSG00000114812 [P32241-1]
ENST00000433647; ENSP00000394950; ENSG00000114812 [P32241-5]
ENST00000438259; ENSP00000415371; ENSG00000114812 [P32241-3]
ENST00000543411; ENSP00000445701; ENSG00000114812 [P32241-4]
GeneIDi7433
KEGGihsa:7433
UCSCiuc003clf.3 human [P32241-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiVIPR1_HUMAN
AccessioniPrimary (citable) accession number: P32241
Secondary accession number(s): A5JUT9
, B3KPV1, B4DEB5, B4DGI4, F5H1F5, G3V0I1, Q15871, Q6P2M6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1993
Last sequence update: October 1, 1993
Last modified: April 25, 2018
This is version 172 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome