Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Vasoactive intestinal polypeptide receptor 1

Gene

VIPR1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

This is a receptor for VIP. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. The affinity is VIP = PACAP-27 > PACAP-38.1 Publication

GO - Molecular functioni

  • vasoactive intestinal polypeptide receptor activity Source: ProtInc

GO - Biological processi

  • cell surface receptor signaling pathway Source: InterPro
  • chemical synaptic transmission Source: ProtInc
  • digestion Source: ProtInc
  • G-protein coupled receptor signaling pathway Source: ProtInc
  • G-protein coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger Source: ProtInc
  • immune response Source: ProtInc
  • muscle contraction Source: ProtInc
  • positive regulation of cell proliferation Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

BioCyciZFISH:ENSG00000114812-MONOMER.
ReactomeiR-HSA-418555. G alpha (s) signalling events.
SIGNORiP32241.

Protein family/group databases

TCDBi9.A.14.4.9. the g-protein-coupled receptor (gpcr) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Vasoactive intestinal polypeptide receptor 1
Short name:
VIP-R-1
Alternative name(s):
Pituitary adenylate cyclase-activating polypeptide type II receptor
Short name:
PACAP type II receptor
Short name:
PACAP-R-2
Short name:
PACAP-R2
VPAC1
Gene namesi
Name:VIPR1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:12694. VIPR1.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini31 – 142ExtracellularSequence analysisAdd BLAST112
Transmembranei143 – 167Helical; Name=1Sequence analysisAdd BLAST25
Topological domaini168 – 174CytoplasmicSequence analysis7
Transmembranei175 – 194Helical; Name=2Sequence analysisAdd BLAST20
Topological domaini195 – 216ExtracellularSequence analysisAdd BLAST22
Transmembranei217 – 240Helical; Name=3Sequence analysisAdd BLAST24
Topological domaini241 – 254CytoplasmicSequence analysisAdd BLAST14
Transmembranei255 – 276Helical; Name=4Sequence analysisAdd BLAST22
Topological domaini277 – 292ExtracellularSequence analysisAdd BLAST16
Transmembranei293 – 316Helical; Name=5Sequence analysisAdd BLAST24
Topological domaini317 – 341CytoplasmicSequence analysisAdd BLAST25
Transmembranei342 – 361Helical; Name=6Sequence analysisAdd BLAST20
Topological domaini362 – 373ExtracellularSequence analysisAdd BLAST12
Transmembranei374 – 393Helical; Name=7Sequence analysisAdd BLAST20
Topological domaini394 – 457CytoplasmicSequence analysisAdd BLAST64

GO - Cellular componenti

  • integral component of plasma membrane Source: ProtInc
  • plasma membrane Source: Reactome
  • receptor complex Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi7433.
OpenTargetsiENSG00000114812.
PharmGKBiPA37313.

Chemistry databases

ChEMBLiCHEMBL5144.
GuidetoPHARMACOLOGYi371.

Polymorphism and mutation databases

BioMutaiVIPR1.
DMDMi418253.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 30Sequence analysisAdd BLAST30
ChainiPRO_000001285531 – 457Vasoactive intestinal polypeptide receptor 1Add BLAST427

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi50 ↔ 72By similarity
Glycosylationi58N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi63 ↔ 105By similarity
Glycosylationi69N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi86 ↔ 122By similarity
Glycosylationi100N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi215 ↔ 2851 Publication
Glycosylationi290N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiP32241.
PeptideAtlasiP32241.
PRIDEiP32241.

PTM databases

iPTMnetiP32241.
PhosphoSitePlusiP32241.

Expressioni

Tissue specificityi

In lung, HT-29 colonic epithelial cells, Raji B-lymphoblasts. Lesser extent in brain, heart, kidney, liver and placenta. Not expressed in CD4+ or CD8+ T-cells. Expressed in the T-cell lines HARRIS, HuT 78, Jurkat and SUP-T1, but not in the T-cell lines Peer, MOLT-4, HSB and YT.1 Publication

Gene expression databases

BgeeiENSG00000114812.
CleanExiHS_VIPR1.
ExpressionAtlasiP32241. baseline and differential.
GenevisibleiP32241. HS.

Organism-specific databases

HPAiHPA026777.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
VIPP012822EBI-3917984,EBI-6656819

Protein-protein interaction databases

BioGridi113274. 30 interactors.
IntActiP32241. 3 interactors.
MINTiMINT-1217405.
STRINGi9606.ENSP00000327246.

Chemistry databases

BindingDBiP32241.

Structurei

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1OF2X-ray2.20C400-408[»]
1OGTX-ray1.47C400-408[»]
3B3IX-ray1.86C400-408[»]
3B6SX-ray1.80C400-408[»]
3DTXX-ray2.10C400-408[»]
3HCVX-ray1.95C400-408[»]
5DEFX-ray1.60C400-408[»]
5DEGX-ray1.83C400-408[»]
ProteinModelPortaliP32241.
SMRiP32241.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP32241.

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG4564. Eukaryota.
ENOG410XRS2. LUCA.
GeneTreeiENSGT00760000118800.
HOGENOMiHOG000008249.
HOVERGENiHBG008318.
InParanoidiP32241.
KOiK04589.
OMAiVWTIIRI.
OrthoDBiEOG091G0NF8.
PhylomeDBiP32241.
TreeFamiTF315710.

Family and domain databases

InterProiIPR017981. GPCR_2-like.
IPR001879. GPCR_2_extracellular_dom.
IPR000832. GPCR_2_secretin-like.
IPR017983. GPCR_2_secretin-like_CS.
IPR001571. GPCR_2_VIP_rcpt.
IPR001771. GPCR_2_VIP_rcpt_1.
[Graphical view]
PfamiPF00002. 7tm_2. 1 hit.
PF02793. HRM. 1 hit.
[Graphical view]
PRINTSiPR00249. GPCRSECRETIN.
PR00491. VASOACTVEIPR.
PR01154. VIP1RECEPTOR.
SMARTiSM00008. HormR. 1 hit.
[Graphical view]
PROSITEiPS00649. G_PROTEIN_RECEP_F2_1. 1 hit.
PS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
PS50227. G_PROTEIN_RECEP_F2_3. 1 hit.
PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform Short (identifier: P32241-1) [UniParc]FASTAAdd to basket
Also known as: hIVR8

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRPPSPLPAR WLCVLAGALA WALGPAGGQA ARLQEECDYV QMIEVQHKQC
60 70 80 90 100
LEEAQLENET IGCSKMWDNL TCWPATPRGQ VVVLACPLIF KLFSSIQGRN
110 120 130 140 150
VSRSCTDEGW THLEPGPYPI ACGLDDKAAS LDEQQTMFYG SVKTGYTIGY
160 170 180 190 200
GLSLATLLVA TAILSLFRKL HCTRNYIHMH LFISFILRAA AVFIKDLALF
210 220 230 240 250
DSGESDQCSE GSVGCKAAMV FFQYCVMANF FWLLVEGLYL YTLLAVSFFS
260 270 280 290 300
ERKYFWGYIL IGWGVPSTFT MVWTIARIHF EDYGCWDTIN SSLWWIIKGP
310 320 330 340 350
ILTSILVNFI LFICIIRILL QKLRPPDIRK SDSSPYSRLA RSTLLLIPLF
360 370 380 390 400
GVHYIMFAFF PDNFKPEVKM VFELVVGSFQ GFVVAILYCF LNGEVQAELR
410 420 430 440 450
RKWRRWHLQG VLGWNPKYRH PSGGSNGATC STQVSMLTRV SPGARRSSSF

QAEVSLV
Length:457
Mass (Da):51,547
Last modified:October 1, 1993 - v1
Checksum:iDAA40CF5BEC47D7D
GO
Isoform Long (identifier: P32241-2) [UniParc]FASTAAdd to basket
Also known as: hIVR5

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MRPPSPLPARWLCVLAGALAWALGPAGGQAAR → MPPPPLLSLR...RAARSLLGSS

Show »
Length:492
Mass (Da):55,009
Checksum:iD6E529795785C3AA
GO
Isoform 3 (identifier: P32241-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-263: MRPPSPLPAR...YFWGYILIGW → MTRQRVWMRW...PSSLSGSTSG

Show »
Length:247
Mass (Da):28,164
Checksum:i271C125CB317C516
GO
Isoform 4 (identifier: P32241-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: MRPPSPLPARWLCVLAGALAWALGPAGGQAARLQEECDYVQMIEVQHKQCLEEAQLENETI → MRAGRRPRLGPWAG
     134-134: Missing.

Show »
Length:409
Mass (Da):46,268
Checksum:iC66EA5C02820AB12
GO
Isoform 5 (identifier: P32241-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: Missing.

Show »
Length:416
Mass (Da):47,201
Checksum:i4236FD602880CB8C
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti80Q → R in BAG57795 (PubMed:14702039).Curated1
Sequence conflicti284G → GLLR in CAA54814 (PubMed:8179610).Curated1
Sequence conflicti284G → GLLR in CAA53046 (PubMed:8179610).Curated1
Sequence conflicti320L → F in BAG51813 (PubMed:14702039).Curated1
Sequence conflicti369K → R in BAG57795 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_055041341R → M.1 PublicationCorresponds to variant rs17855906dbSNPEnsembl.1
Natural variantiVAR_020021445R → L.Corresponds to variant rs3733055dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0451431 – 263MRPPS…ILIGW → MTRQRVWMRWAVRQPWSFSN IVSWLTSSGCWWRASTCTPC LPSPSSLSGSTSG in isoform 3. 1 PublicationAdd BLAST263
Alternative sequenceiVSP_0472711 – 61MRPPS…ENETI → MRAGRRPRLGPWAG in isoform 4. 1 PublicationAdd BLAST61
Alternative sequenceiVSP_0472721 – 41Missing in isoform 5. 1 PublicationAdd BLAST41
Alternative sequenceiVSP_0020101 – 32MRPPS…GQAAR → MPPPPLLSLRRLGGGWSAVT RLVVAAAGARSRGGRGGSRG AGGGGRGGVARRRRLELRAA RSLLGSS in isoform Long. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_047273134Missing in isoform 4. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L13288 mRNA. Translation: AAA36805.1.
U11087
, U11079, U11080, U11081, U11083, U11084, U11085, U11086 Genomic DNA. Translation: AAB60362.1.
X75299 mRNA. Translation: CAA53046.1.
X77777 mRNA. Translation: CAA54814.1.
AB065669 Genomic DNA. Translation: BAC05895.1.
EF577396 mRNA. Translation: ABQ52416.1.
AK314334 mRNA. Translation: BAG36980.1.
AK293548 mRNA. Translation: BAG57026.1.
AK294609 mRNA. Translation: BAG57795.1.
AK056819 mRNA. Translation: BAG51813.1.
AC092047 Genomic DNA. No translation available.
CH471055 Genomic DNA. Translation: EAW64649.1.
CH471055 Genomic DNA. Translation: EAW64650.1.
BC064424 mRNA. Translation: AAH64424.1.
L20295 mRNA. Translation: AAA36802.1.
CCDSiCCDS2698.1. [P32241-1]
CCDS58827.1. [P32241-4]
CCDS58828.1. [P32241-5]
CCDS58829.1. [P32241-3]
PIRiJC2194.
JC2195.
RefSeqiNP_001238811.1. NM_001251882.1. [P32241-5]
NP_001238812.1. NM_001251883.1. [P32241-3]
NP_001238813.1. NM_001251884.1. [P32241-4]
NP_001238814.1. NM_001251885.1.
NP_004615.2. NM_004624.3. [P32241-1]
XP_005265495.1. XM_005265438.3. [P32241-5]
XP_011532381.1. XM_011534079.1. [P32241-5]
UniGeneiHs.348500.

Genome annotation databases

EnsembliENST00000325123; ENSP00000327246; ENSG00000114812. [P32241-1]
ENST00000433647; ENSP00000394950; ENSG00000114812. [P32241-5]
ENST00000438259; ENSP00000415371; ENSG00000114812. [P32241-3]
ENST00000543411; ENSP00000445701; ENSG00000114812. [P32241-4]
GeneIDi7433.
KEGGihsa:7433.
UCSCiuc003clf.3. human. [P32241-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L13288 mRNA. Translation: AAA36805.1.
U11087
, U11079, U11080, U11081, U11083, U11084, U11085, U11086 Genomic DNA. Translation: AAB60362.1.
X75299 mRNA. Translation: CAA53046.1.
X77777 mRNA. Translation: CAA54814.1.
AB065669 Genomic DNA. Translation: BAC05895.1.
EF577396 mRNA. Translation: ABQ52416.1.
AK314334 mRNA. Translation: BAG36980.1.
AK293548 mRNA. Translation: BAG57026.1.
AK294609 mRNA. Translation: BAG57795.1.
AK056819 mRNA. Translation: BAG51813.1.
AC092047 Genomic DNA. No translation available.
CH471055 Genomic DNA. Translation: EAW64649.1.
CH471055 Genomic DNA. Translation: EAW64650.1.
BC064424 mRNA. Translation: AAH64424.1.
L20295 mRNA. Translation: AAA36802.1.
CCDSiCCDS2698.1. [P32241-1]
CCDS58827.1. [P32241-4]
CCDS58828.1. [P32241-5]
CCDS58829.1. [P32241-3]
PIRiJC2194.
JC2195.
RefSeqiNP_001238811.1. NM_001251882.1. [P32241-5]
NP_001238812.1. NM_001251883.1. [P32241-3]
NP_001238813.1. NM_001251884.1. [P32241-4]
NP_001238814.1. NM_001251885.1.
NP_004615.2. NM_004624.3. [P32241-1]
XP_005265495.1. XM_005265438.3. [P32241-5]
XP_011532381.1. XM_011534079.1. [P32241-5]
UniGeneiHs.348500.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1OF2X-ray2.20C400-408[»]
1OGTX-ray1.47C400-408[»]
3B3IX-ray1.86C400-408[»]
3B6SX-ray1.80C400-408[»]
3DTXX-ray2.10C400-408[»]
3HCVX-ray1.95C400-408[»]
5DEFX-ray1.60C400-408[»]
5DEGX-ray1.83C400-408[»]
ProteinModelPortaliP32241.
SMRiP32241.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113274. 30 interactors.
IntActiP32241. 3 interactors.
MINTiMINT-1217405.
STRINGi9606.ENSP00000327246.

Chemistry databases

BindingDBiP32241.
ChEMBLiCHEMBL5144.
GuidetoPHARMACOLOGYi371.

Protein family/group databases

TCDBi9.A.14.4.9. the g-protein-coupled receptor (gpcr) family.
GPCRDBiSearch...

PTM databases

iPTMnetiP32241.
PhosphoSitePlusiP32241.

Polymorphism and mutation databases

BioMutaiVIPR1.
DMDMi418253.

Proteomic databases

PaxDbiP32241.
PeptideAtlasiP32241.
PRIDEiP32241.

Protocols and materials databases

DNASUi7433.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000325123; ENSP00000327246; ENSG00000114812. [P32241-1]
ENST00000433647; ENSP00000394950; ENSG00000114812. [P32241-5]
ENST00000438259; ENSP00000415371; ENSG00000114812. [P32241-3]
ENST00000543411; ENSP00000445701; ENSG00000114812. [P32241-4]
GeneIDi7433.
KEGGihsa:7433.
UCSCiuc003clf.3. human. [P32241-1]

Organism-specific databases

CTDi7433.
DisGeNETi7433.
GeneCardsiVIPR1.
HGNCiHGNC:12694. VIPR1.
HPAiHPA026777.
MIMi192321. gene.
neXtProtiNX_P32241.
OpenTargetsiENSG00000114812.
PharmGKBiPA37313.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4564. Eukaryota.
ENOG410XRS2. LUCA.
GeneTreeiENSGT00760000118800.
HOGENOMiHOG000008249.
HOVERGENiHBG008318.
InParanoidiP32241.
KOiK04589.
OMAiVWTIIRI.
OrthoDBiEOG091G0NF8.
PhylomeDBiP32241.
TreeFamiTF315710.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000114812-MONOMER.
ReactomeiR-HSA-418555. G alpha (s) signalling events.
SIGNORiP32241.

Miscellaneous databases

ChiTaRSiVIPR1. human.
EvolutionaryTraceiP32241.
GeneWikiiVIPR1.
GenomeRNAii7433.
PROiP32241.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000114812.
CleanExiHS_VIPR1.
ExpressionAtlasiP32241. baseline and differential.
GenevisibleiP32241. HS.

Family and domain databases

InterProiIPR017981. GPCR_2-like.
IPR001879. GPCR_2_extracellular_dom.
IPR000832. GPCR_2_secretin-like.
IPR017983. GPCR_2_secretin-like_CS.
IPR001571. GPCR_2_VIP_rcpt.
IPR001771. GPCR_2_VIP_rcpt_1.
[Graphical view]
PfamiPF00002. 7tm_2. 1 hit.
PF02793. HRM. 1 hit.
[Graphical view]
PRINTSiPR00249. GPCRSECRETIN.
PR00491. VASOACTVEIPR.
PR01154. VIP1RECEPTOR.
SMARTiSM00008. HormR. 1 hit.
[Graphical view]
PROSITEiPS00649. G_PROTEIN_RECEP_F2_1. 1 hit.
PS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
PS50227. G_PROTEIN_RECEP_F2_3. 1 hit.
PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiVIPR1_HUMAN
AccessioniPrimary (citable) accession number: P32241
Secondary accession number(s): A5JUT9
, B3KPV1, B4DEB5, B4DGI4, F5H1F5, G3V0I1, Q15871, Q6P2M6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1993
Last sequence update: October 1, 1993
Last modified: November 2, 2016
This is version 161 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.