P32241 (VIPR1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 127.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Vasoactive intestinal polypeptide receptor 1 Short name=VIP-R-1 Alternative name(s): Pituitary adenylate cyclase-activating polypeptide type II receptor Short name=PACAP type II receptor Short name=PACAP-R-2 Short name=PACAP-R2 VPAC1 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 457 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | This is a receptor for VIP. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. The affinity is VIP = PACAP-27 > PACAP-38. Ref.11 |
| Subcellular location | |
| Tissue specificity | In lung, HT-29 colonic epithelial cells, Raji B-lymphoblasts. Lesser extent in brain, heart, kidney, liver and placenta. Not expressed in CD4+ or CD8+ T-cells. Expressed in the T-cell lines HARRIS, HuT 78, Jurkat and SUP-T1, but not in the T-cell lines Peer, MOLT-4, HSB and YT. Ref.11 |
| Sequence similarities | Belongs to the G-protein coupled receptor 2 family. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform Short (identifier: P32241-1) Also known as: hIVR8; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Long (identifier: P32241-2) Also known as: hIVR5; The sequence of this isoform differs from the canonical sequence as follows: 1-32: MRPPSPLPARWLCVLAGALAWALGPAGGQAAR → MPPPPLLSLR...RAARSLLGSS | ||||||
| Isoform 3 (identifier: P32241-3) The sequence of this isoform differs from the canonical sequence as follows: 1-263: MRPPSPLPAR...YFWGYILIGW → MTRQRVWMRW...PSSLSGSTSG |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 30 | 30 | Potential | ||||||||
| Chain | 31 – 457 | 427 | Vasoactive intestinal polypeptide receptor 1 | PRO_0000012855 | |||||||
Regions | |||||||||||
| Topological domain | 31 – 142 | 112 | Extracellular Potential | ||||||||
| Transmembrane | 143 – 167 | 25 | Helical; Name=1; Potential | ||||||||
| Topological domain | 168 – 174 | 7 | Cytoplasmic Potential | ||||||||
| Transmembrane | 175 – 194 | 20 | Helical; Name=2; Potential | ||||||||
| Topological domain | 195 – 216 | 22 | Extracellular Potential | ||||||||
| Transmembrane | 217 – 240 | 24 | Helical; Name=3; Potential | ||||||||
| Topological domain | 241 – 254 | 14 | Cytoplasmic Potential | ||||||||
| Transmembrane | 255 – 276 | 22 | Helical; Name=4; Potential | ||||||||
| Topological domain | 277 – 292 | 16 | Extracellular Potential | ||||||||
| Transmembrane | 293 – 316 | 24 | Helical; Name=5; Potential | ||||||||
| Topological domain | 317 – 341 | 25 | Cytoplasmic Potential | ||||||||
| Transmembrane | 342 – 361 | 20 | Helical; Name=6; Potential | ||||||||
| Topological domain | 362 – 373 | 12 | Extracellular Potential | ||||||||
| Transmembrane | 374 – 393 | 20 | Helical; Name=7; Potential | ||||||||
| Topological domain | 394 – 457 | 64 | Cytoplasmic Potential | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 449 | 1 | Phosphoserine By similarity | ||||||||
| Modified residue | 455 | 1 | Phosphoserine By similarity | ||||||||
| Glycosylation | 58 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 69 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 100 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 290 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 50 ↔ 72 | By similarity | |||||||||
| Disulfide bond | 63 ↔ 105 | By similarity | |||||||||
| Disulfide bond | 86 ↔ 122 | By similarity | |||||||||
| Disulfide bond | 215 ↔ 285 | Ref.12 | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 263 | 263 | MRPPS…ILIGW → MTRQRVWMRWAVRQPWSFSN IVSWLTSSGCWWRASTCTPC LPSPSSLSGSTSG in isoform 3. | VSP_045143 | |||||||
| Alternative sequence | 1 – 32 | 32 | MRPPS…GQAAR → MPPPPLLSLRRLGGGWSAVT RLVVAAAGARSRGGRGGSRG AGGGGRGGVARRRRLELRAA RSLLGSS in isoform Long. | VSP_002010 | |||||||
| Natural variant | 341 | 1 | R → M. Ref.8 Corresponds to variant rs17855906 [ dbSNP | Ensembl ]. | VAR_055041 | |||||||
| Natural variant | 445 | 1 | R → L. Corresponds to variant rs3733055 [ dbSNP | Ensembl ]. | VAR_020021 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 284 | 1 | G → GLLR in CAA54814. Ref.2 | ||||||||
| Sequence conflict | 284 | 1 | G → GLLR in CAA53046. Ref.2 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and functional expression of a human neuroendocrine vasoactive intestinal peptide receptor." Sreedharan S.P., Patel D.R., Huang J.-X., Goetzl E.J. Biochem. Biophys. Res. Commun. 193:546-553(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM SHORT). Tissue: Intestine. |
| [2] | "Human intestinal VIP receptor: cloning and functional expression of two cDNA encoding proteins with different N-terminal domains." Couvineau A., Rouyer-Fessard C., Darmoul D., Maoret J.J., Carrero I., Ogier-Denis E., Laburthe M. Biochem. Biophys. Res. Commun. 200:769-776(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS SHORT AND LONG), ALTERNATIVE SPLICING. Tissue: Intestine. |
| [3] | "Genome-wide discovery and analysis of human seven transmembrane helix receptor genes." Suwa M., Sato T., Okouchi I., Arita M., Futami K., Matsumoto S., Tsutsumi S., Aburatani H., Asai K., Akiyama Y. Submitted (JUL-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [4] | Martin A.L., Kaighin V.A., Aronstam R.S. Submitted (APR-2007) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SHORT). Tissue: Lung. |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS SHORT AND 3). Tissue: Cerebellum and Lung. |
| [6] | "The DNA sequence, annotation and analysis of human chromosome 3." Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J. Gibbs R.A.Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SHORT), VARIANT MET-341. |
| [9] | "Molecular cloning and functional characterization of a human liver vasoactive intestinal peptide receptor." Gagnon A.W., Aiyar N., Elshourbagy N.A. Cell. Signal. 6:321-333(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 33-457. Tissue: Liver. |
| [10] | "Highly conserved aspartate 68, tryptophan 73 and glycine 109 in the N-terminal extracellular domain of the human VIP receptor are essential for its ability to bind VIP." Couvineau A., Gaudin P., Maoret J.J., Rouyer-Fessard C., Nicole P., Laburthe M. Biochem. Biophys. Res. Commun. 206:246-252(1995) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH VIP. |
| [11] | "Predominant expression of type II vasoactive intestinal peptide receptors by human T lymphoblastoma cells: transduction of both Ca2+ and cyclic AMP signals." Xia M., Sreedharan S.P., Goetzl E.J. J. Clin. Immunol. 16:21-30(1996) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY. |
| [12] | "Importance of conserved cysteines in the extracellular loops of human PACAP/VIP1 receptor for ligand binding and stimulation of cAMP production." Knudsen S.M., Tams J.W., Wulff B.S., Fahrenkrug J. Ann. N. Y. Acad. Sci. 865:259-265(1998) [PubMed] [Europe PMC] [Abstract] Cited for: DISULFIDE BOND. |
| [13] | "Dual, HLA-B27 subtype-dependent conformation of a self-peptide." Hulsmeyer M., Fiorillo M.T., Bettosini F., Sorrentino R., Saenger W., Ziegler A., Uchanska-Ziegler B. J. Exp. Med. 199:271-281(2004) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.47 ANGSTROMS) OF 400-408 IN COMPLEX WITH MHC. |
| [14] | "Citrullination-dependent differential presentation of a self-peptide by HLA-B27 subtypes." Beltrami A., Rossmann M., Fiorillo M.T., Paladini F., Sorrentino R., Saenger W., Kumar P., Ziegler A., Uchanska-Ziegler B. J. Biol. Chem. 283:27189-27199(2008) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.86 ANGSTROMS) OF 400-408 IN COMPLEX WITH MHC. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | L13288 mRNA. Translation: AAA36805.1. U11087 U11086 Genomic DNA. Translation: AAB60362.1.X75299 mRNA. Translation: CAA53046.1. X77777 mRNA. Translation: CAA54814.1. AB065669 Genomic DNA. Translation: BAC05895.1. EF577396 mRNA. Translation: ABQ52416.1. AK314334 mRNA. Translation: BAG36980.1. AK293548 mRNA. Translation: BAG57026.1. AC092047 Genomic DNA. No translation available. CH471055 Genomic DNA. Translation: EAW64649.1. BC064424 mRNA. Translation: AAH64424.1. L20295 mRNA. Translation: AAA36802.1. | ||||||||||||||||||||||||
| IPI | IPI00027680. IPI00218266. | ||||||||||||||||||||||||
| PIR | JC2194. JC2195. | ||||||||||||||||||||||||
| RefSeq | NP_001238812.1. NM_001251883.1. NP_004615.2. NM_004624.3. | ||||||||||||||||||||||||
| UniGene | Hs.348500. | ||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||
| ProteinModelPortal | P32241. | ||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||
| IntAct | P32241. 1 interaction. | ||||||||||||||||||||||||
| MINT | MINT-1217405. | ||||||||||||||||||||||||
| STRING | 9606.ENSP00000327246. | ||||||||||||||||||||||||
Protein family/group databases | |||||||||||||||||||||||||
| GPCRDB | Search... | ||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||
| PhosphoSite | P32241. | ||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||
| DMDM | 418253. | ||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||
| PaxDb | P32241. | ||||||||||||||||||||||||
| PRIDE | P32241. | ||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||
| DNASU | 7433. | ||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||
| Ensembl | ENST00000325123; ENSP00000327246; ENSG00000114812. ENST00000438259; ENSP00000415371; ENSG00000114812. | ||||||||||||||||||||||||
| GeneID | 7433. | ||||||||||||||||||||||||
| KEGG | hsa:7433. | ||||||||||||||||||||||||
| UCSC | uc003clf.2. human. | ||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||
| CTD | 7433. | ||||||||||||||||||||||||
| GeneCards | GC03P042520. | ||||||||||||||||||||||||
| HGNC | HGNC:12694. VIPR1. | ||||||||||||||||||||||||
| HPA | HPA026777. | ||||||||||||||||||||||||
| MIM | 192321. gene. | ||||||||||||||||||||||||
| neXtProt | NX_P32241. | ||||||||||||||||||||||||
| PharmGKB | PA37313. | ||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||
| eggNOG | NOG293423. | ||||||||||||||||||||||||
| HOGENOM | HOG000008249. | ||||||||||||||||||||||||
| HOVERGEN | HBG008318. | ||||||||||||||||||||||||
| InParanoid | P32241. | ||||||||||||||||||||||||
| KO | K04589. | ||||||||||||||||||||||||
| OMA | REECIYL. | ||||||||||||||||||||||||
| PhylomeDB | P32241. | ||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||
| Reactome | REACT_111102. Signal Transduction. | ||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||
| ArrayExpress | P32241. | ||||||||||||||||||||||||
| Bgee | P32241. | ||||||||||||||||||||||||
| CleanEx | HS_VIPR1. | ||||||||||||||||||||||||
| Genevestigator | P32241. | ||||||||||||||||||||||||
| GermOnline | ENSG00000114812. Homo sapiens. | ||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||
| InterPro | IPR017981. GPCR_2-like. IPR001879. GPCR_2_extracellular_dom. IPR000832. GPCR_2_secretin-like. IPR017983. GPCR_2_secretin-like_CS. IPR001571. GPCR_2_VIP_rcpt. IPR001771. GPCR_2_VIP_rcpt_1. [Graphical view] | ||||||||||||||||||||||||
| Pfam | PF00002. 7tm_2. 1 hit. PF02793. HRM. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| PRINTS | PR00249. GPCRSECRETIN. PR00491. VASOACTVEIPR. PR01154. VIP1RECEPTOR. | ||||||||||||||||||||||||
| SMART | SM00008. HormR. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| PROSITE | PS00649. G_PROTEIN_RECEP_F2_1. 1 hit. PS00650. G_PROTEIN_RECEP_F2_2. 1 hit. PS50227. G_PROTEIN_RECEP_F2_3. 1 hit. PS50261. G_PROTEIN_RECEP_F2_4. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||
Other | |||||||||||||||||||||||||
| BindingDB | P32241. | ||||||||||||||||||||||||
| ChEMBL | CHEMBL5144. | ||||||||||||||||||||||||
| ChiTaRS | VIPR1. human. | ||||||||||||||||||||||||
| EvolutionaryTrace | P32241. | ||||||||||||||||||||||||
| GenomeRNAi | 7433. | ||||||||||||||||||||||||
| NextBio | 29114. | ||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||
Entry information
| Entry name | VIPR1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P32241 Secondary accession number(s): A5JUT9 Q6P2M6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| 7-transmembrane G-linked receptors List of 7-transmembrane G-linked receptor entries |
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
