P32239 (GASR_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 136.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Gastrin/cholecystokinin type B receptor Short name=CCK-B receptor Short name=CCK-BR Alternative name(s): Cholecystokinin-2 receptor Short name=CCK2-R | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 447 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Receptor for gastrin and cholecystokinin. The CKK-B receptors occur throughout the central nervous system where they modulate anxiety, analgesia, arousal, and neuroleptic activity. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Ref.3 Ref.5 Ref.6 Ref.8 Ref.9 Ref.17 Isoform 2 is constitutively activated and may regulate cancer cell proliferation via a gastrin-independent mechanism. Ref.3 Ref.5 Ref.6 Ref.8 Ref.9 Ref.17 |
| Subcellular location | |
| Tissue specificity | Isoform 1 is expressed in brain, pancreas, stomach, the colon cancer cell line LoVo and the T-lymphoblastoma Jurkat, but not in heart, placenta, liver, lung, skeletal muscle, kidney or the stomach cancer cell line AGS. Expressed at high levels in the small cell lung cancer cell line NCI-H510, at lower levels in NCI-H345, NCI-H69 and GLC-28 cell lines, not expressed in GLC-19 cell line. Within the stomach, expressed at high levels in the mucosa of the gastric fundus and at low levels in the antrum and duodenum. Isoform 2 is present in pancreatic cancer cells and colorectal cancer cells, but not in normal pancreas or colonic mucosa. Isoform 3 is expressed in brain, pancreas, stomach, the stomach cancer cell line AGS and the colon cancer cell line LoVo. Ref.3 Ref.5 Ref.6 Ref.7 Ref.8 Ref.10 |
| Sequence similarities | Belongs to the G-protein coupled receptor 1 family. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P32239-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P32239-2) Also known as: CCK-C; CCK-BRi4sv; The sequence of this isoform differs from the canonical sequence as follows: 271-271: G → GGAGPREQNLGEAELWRATGPAGVGGTEMKVRVRRKLEMELSWERRSGGDWAGDWGDSPFSLTAHPLCSG | ||||||
| Isoform 3 (identifier: P32239-3) Also known as: DeltaCCK-B; The sequence of this isoform differs from the canonical sequence as follows: 1-66: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||
Molecule processing | |||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 447 | 447 | Gastrin/cholecystokinin type B receptor | PRO_0000069474 | |||||||||||
Regions | |||||||||||||||
| Topological domain | 1 – 57 | 57 | Extracellular Potential | ||||||||||||
| Transmembrane | 58 – 79 | 22 | Helical; Name=1; Potential | ||||||||||||
| Topological domain | 80 – 87 | 8 | Cytoplasmic Potential | ||||||||||||
| Transmembrane | 88 – 109 | 22 | Helical; Name=2; Potential | ||||||||||||
| Topological domain | 110 – 131 | 22 | Extracellular Potential | ||||||||||||
| Transmembrane | 132 – 150 | 19 | Helical; Name=3; Potential | ||||||||||||
| Topological domain | 151 – 170 | 20 | Cytoplasmic Potential | ||||||||||||
| Transmembrane | 171 – 189 | 19 | Helical; Name=4; Potential | ||||||||||||
| Topological domain | 190 – 219 | 30 | Extracellular Potential | ||||||||||||
| Transmembrane | 220 – 242 | 23 | Helical; Name=5; Potential | ||||||||||||
| Topological domain | 243 – 333 | 91 | Cytoplasmic Potential | ||||||||||||
| Transmembrane | 334 – 355 | 22 | Helical; Name=6; Potential | ||||||||||||
| Topological domain | 356 – 373 | 18 | Extracellular Potential | ||||||||||||
| Transmembrane | 374 – 394 | 21 | Helical; Name=7; Potential | ||||||||||||
| Topological domain | 395 – 447 | 53 | Cytoplasmic Potential | ||||||||||||
Amino acid modifications | |||||||||||||||
| Lipidation | 408 | 1 | S-palmitoyl cysteine By similarity | ||||||||||||
| Glycosylation | 7 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||
| Glycosylation | 30 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||
| Glycosylation | 36 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||
| Disulfide bond | 127 ↔ 205 | By similarity | |||||||||||||
Natural variations | |||||||||||||||
| Alternative sequence | 1 – 66 | 66 | Missing in isoform 3. | VSP_033444 | |||||||||||
| Alternative sequence | 271 | 1 | G → GGAGPREQNLGEAELWRATG PAGVGGTEMKVRVRRKLEME LSWERRSGGDWAGDWGDSPF SLTAHPLCSG in isoform 2. | VSP_033445 | |||||||||||
| Natural variant | 37 | 1 | L → F. Corresponds to variant rs1805000 [ dbSNP | Ensembl ]. | VAR_014684 | |||||||||||
| Natural variant | 77 | 1 | V → G. Corresponds to variant rs35816985 [ dbSNP | Ensembl ]. | VAR_049388 | |||||||||||
| Natural variant | 125 | 1 | V → I. Corresponds to variant rs1805002 [ dbSNP | Ensembl ]. | VAR_014685 | |||||||||||
| Natural variant | 215 | 1 | R → H. Corresponds to variant rs1805004 [ dbSNP | Ensembl ]. | VAR_014686 | |||||||||||
| Natural variant | 319 | 1 | R → Q. Corresponds to variant rs1805001 [ dbSNP | Ensembl ]. | VAR_014687 | |||||||||||
Experimental info | |||||||||||||||
| Sequence conflict | 64 | 1 | I → T in AAF67174. Ref.8 | ||||||||||||
| Sequence conflict | 93 | 1 | L → F in AAC27510. Ref.16 | ||||||||||||
| Sequence conflict | 96 | 1 | L → M in AAC27510. Ref.16 | ||||||||||||
| Sequence conflict | 116 | 1 | L → I in AAC27510. Ref.16 | ||||||||||||
| Sequence conflict | 171 | 1 | A → P in AAA91831. Ref.11 | ||||||||||||
| Sequence conflict | 227 | 1 | F → S in BAF84753. Ref.12 | ||||||||||||
| Sequence conflict | 249 | 1 | L → V in AAA91831. Ref.11 | ||||||||||||
| Sequence conflict | 288 | 1 | E → K in AAB30766. Ref.5 | ||||||||||||
Secondary structure | |||||||||||||||
Helix Strand Turn | |||||||||||||||
| Helix | 353 – 358 | 6 | |||||||||||||
| Helix | 363 – 368 | 6 | |||||||||||||
| Helix | 372 – 378 | 7 | |||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning of the human brain and gastric cholecystokinin receptor: structure, functional expression and chromosomal localization." Pisegna J.R., de Weerth A., Huppi K., Wank S.A. Biochem. Biophys. Res. Commun. 189:296-303(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Brain. |
| [2] | "The human brain cholecystokinin-B/gastrin receptor. Cloning and characterization." Lee Y.-M., Beinborn M., McBride E.W., Lu M., Kolakowski L.F. Jr., Kopin A.S. J. Biol. Chem. 268:8164-8169(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Brain. |
| [3] | "Functional characterization of a human brain cholecystokinin-B receptor. A trophic effect of cholecystokinin and gastrin." Ito M., Matsui T., Taniguchi T., Tsukamoto T., Murayama T., Arima N., Nakata H., Chiba T., Chihara K. J. Biol. Chem. 268:18300-18305(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY. Tissue: Brain. |
| [4] | "The human gastrin/cholecystokinin type B receptor gene: alternative splice donor site in exon 4 generates two variant mRNAs." Song I., Brown D.R., Wiltshire R.N., Gantz I., Trent J.M., Yamada T. Proc. Natl. Acad. Sci. U.S.A. 90:9085-9089(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. Tissue: Placenta. |
| [5] | "Cholecystokinin stimulates Ca2+ mobilization and clonal growth in small cell lung cancer through CCKA and CCKB/gastrin receptors." Herget T., Sethi T., Wu S.V., Walsh J.H., Rozengurt E. Ann. N. Y. Acad. Sci. 713:283-297(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY. Tissue: Fetal brain. |
| [6] | "Functional characterization of two cholecystokinin-B/gastrin receptor isoforms: a preferential splice donor site in the human receptor gene." Ito M., Iwata N., Taniguchi T., Murayama T., Chihara K., Matsui T. Cell Growth Differ. 5:1127-1135(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], FUNCTION, ALTERNATIVE SPLICING, TISSUE SPECIFICITY. Tissue: Lung fibroblast. |
| [7] | "A truncated isoform of human CCK-B/gastrin receptor generated by alternative usage of a novel exon." Miyake A. Biochem. Biophys. Res. Commun. 208:230-237(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), TISSUE SPECIFICITY. Tissue: Stomach. |
| [8] | "Human colorectal cancers express a constitutively active cholecystokinin-B/gastrin receptor that stimulates cell growth." Hellmich M.R., Rui X.-L., Hellmich H.L., Fleming R.Y.D., Evers B.M., Townsend C.M. Jr. J. Biol. Chem. 275:32122-32128(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION (ISOFORM 2), TISSUE SPECIFICITY. Tissue: Colon cancer. |
| [9] | "Identification of CCK-B/gastrin receptor splice variants in human peripheral blood mononuclear cells." Schmitz F., Schrader H., Otte J.-M., Schmitz H., Stueber E., Herzig K.-H., Schmidt W.E. Regul. Pept. 101:25-33(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, ALTERNATIVE SPLICING. Tissue: Peripheral blood. |
| [10] | "Characterization of the CCK-C (cancer) receptor in human pancreatic cancer." Smith J.P., Verderame M.F., McLaughlin P., Martenis M., Ballard E., Zagon I.S. Int. J. Mol. Med. 10:689-694(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY. Tissue: Pancreatic cancer. |
| [11] | "Cloning and expression of the human temporal cortex cholecystokinin B receptor." Tate S.N., Gray J., Denyer J., Stolz M., Foord S., Lee M.G. Submitted (MAR-1996) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Tissue: Temporal cortex. |
| [12] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Stomach. |
| [13] | "cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org)." Kopatz S.A., Aronstam R.S., Sharma S.V. Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [14] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [15] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Placenta. |
| [16] | "An 84-kilobase physical map and repeat polymorphisms of the gastrin/cholecystokinin brain receptor region at the junction of chromosome segments 11p15.4 and 15.5." O'Briant K.C., Ali S.Y., Weier H.-U.G., Bepler G. Chromosome Res. 6:415-418(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 52-447. |
| [17] | "CCKA and CCKB receptors are expressed in small cell lung cancer lines and mediate Ca2+ mobilization and clonal growth." Sethi T., Herget T., Wu S.V., Walsh J.H., Rozengurt E. Cancer Res. 53:5208-5213(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 244-333 (ISOFORMS 1/3), FUNCTION. Tissue: Fetal brain. |
| [18] | "Localization of the human cholecystokinin-B/gastrin receptor gene (CCKBR) to chromosome 11p15.5-->p15.4 by fluorescence in situ hybridization." Zimonjic D.B., Popescu N.C., Matsui T., Ito M., Chihara K. Cytogenet. Cell Genet. 65:184-185(1994) [PubMed] [Europe PMC] [Abstract] Cited for: CHROMOSOMAL LOCATION. |
| [19] | "Intermolecular interactions between cholecystokinin-8 and the third extracellular loop of the cholecystokinin-2 receptor." Giragossian C., Mierke D.F. Biochemistry 41:4560-4566(2002) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 352-379. |
| + | Additional computationally mapped references. |
Web resources
| Wikipedia Cholecystokinin receptor entry |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | L04473 mRNA. Translation: AAA35660.1. L08112 mRNA. Translation: AAA35657.1. D13305 mRNA. Translation: BAA02564.1. L10822 Genomic DNA. Translation: AAC37528.1. S70057 mRNA. Translation: AAB30766.2. D21219 Genomic DNA. Translation: BAA04759.2. AF239668 mRNA. Translation: AAF67174.1. AY029770 mRNA. Translation: AAK38351.1. AF441129 mRNA. Translation: AAN32829.1. L07746 mRNA. Translation: AAA91831.1. AK292064 mRNA. Translation: BAF84753.1. AY322551 mRNA. Translation: AAP84364.1. BT006789 mRNA. Translation: AAP35435.1. BC000740 mRNA. Translation: AAH00740.1. AH006311 Genomic DNA. Translation: AAC27510.1. | ||||||||||||
| IPI | IPI00027667. IPI00893039. IPI00893152. | ||||||||||||
| PIR | A47430. I65231. | ||||||||||||
| RefSeq | NP_795344.1. NM_176875.3. | ||||||||||||
| UniGene | Hs.203. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | P32239. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| DIP | DIP-229N. | ||||||||||||
| IntAct | P32239. 5 interactions. | ||||||||||||
| MINT | MINT-3013054. | ||||||||||||
| STRING | 9606.ENSP00000335544. | ||||||||||||
Protein family/group databases | |||||||||||||
| GPCRDB | Search... | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | P32239. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 417029. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | P32239. | ||||||||||||
| PRIDE | P32239. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 887. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000334619; ENSP00000335544; ENSG00000110148. ENST00000525462; ENSP00000435534; ENSG00000110148. | ||||||||||||
| GeneID | 887. | ||||||||||||
| KEGG | hsa:887. | ||||||||||||
| UCSC | uc001mcp.3. human. uc001mcs.3. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 887. | ||||||||||||
| GeneCards | GC11P006280. | ||||||||||||
| HGNC | HGNC:1571. CCKBR. | ||||||||||||
| HPA | HPA041976. | ||||||||||||
| MIM | 118445. gene. | ||||||||||||
| neXtProt | NX_P32239. | ||||||||||||
| PharmGKB | PA26143. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG238659. | ||||||||||||
| HOVERGEN | HBG036927. | ||||||||||||
| InParanoid | P32239. | ||||||||||||
| KO | K04195. | ||||||||||||
| OMA | WRAFDGP. | ||||||||||||
| OrthoDB | EOG43N7D1. | ||||||||||||
| PhylomeDB | P32239. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Reactome | REACT_111102. Signal Transduction. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | P32239. | ||||||||||||
| Bgee | P32239. | ||||||||||||
| CleanEx | HS_CCKBR. | ||||||||||||
| Genevestigator | P32239. | ||||||||||||
| GermOnline | ENSG00000110148. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR009126. Cholcskin_rcpt. IPR000314. Gastrin_rcpt. IPR000276. GPCR_Rhodpsn. IPR017452. GPCR_Rhodpsn_7TM. [Graphical view] | ||||||||||||
| Pfam | PF00001. 7tm_1. 1 hit. [Graphical view] | ||||||||||||
| PRINTS | PR01822. CCYSTOKININR. PR00527. GASTRINR. PR00237. GPCRRHODOPSN. | ||||||||||||
| PROSITE | PS00237. G_PROTEIN_RECEP_F1_1. 1 hit. PS50262. G_PROTEIN_RECEP_F1_2. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| BindingDB | P32239. | ||||||||||||
| ChEMBL | CHEMBL298. | ||||||||||||
| DrugBank | DB00183. Pentagastrin. | ||||||||||||
| EvolutionaryTrace | P32239. | ||||||||||||
| GenomeRNAi | 887. | ||||||||||||
| NextBio | 3666. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | GASR_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P32239 Secondary accession number(s): A8K7P9 Q9UBV1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| 7-transmembrane G-linked receptors List of 7-transmembrane G-linked receptor entries |
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
