Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P32239 (GASR_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified March 19, 2014. Version 145. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (7) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Gastrin/cholecystokinin type B receptor

Short name=CCK-B receptor
Short name=CCK-BR
Alternative name(s):
Cholecystokinin-2 receptor
Short name=CCK2-R
Gene names
Name:CCKBR
Synonyms:CCKRB
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length447 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Receptor for gastrin and cholecystokinin. The CKK-B receptors occur throughout the central nervous system where they modulate anxiety, analgesia, arousal, and neuroleptic activity. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Ref.3 Ref.5 Ref.6 Ref.8 Ref.9 Ref.17

Isoform 2 is constitutively activated and may regulate cancer cell proliferation via a gastrin-independent mechanism. Ref.3 Ref.5 Ref.6 Ref.8 Ref.9 Ref.17

Subcellular location

Cell membrane; Multi-pass membrane protein.

Tissue specificity

Isoform 1 is expressed in brain, pancreas, stomach, the colon cancer cell line LoVo and the T-lymphoblastoma Jurkat, but not in heart, placenta, liver, lung, skeletal muscle, kidney or the stomach cancer cell line AGS. Expressed at high levels in the small cell lung cancer cell line NCI-H510, at lower levels in NCI-H345, NCI-H69 and GLC-28 cell lines, not expressed in GLC-19 cell line. Within the stomach, expressed at high levels in the mucosa of the gastric fundus and at low levels in the antrum and duodenum. Isoform 2 is present in pancreatic cancer cells and colorectal cancer cells, but not in normal pancreas or colonic mucosa. Isoform 3 is expressed in brain, pancreas, stomach, the stomach cancer cell line AGS and the colon cancer cell line LoVo. Ref.3 Ref.5 Ref.6 Ref.7 Ref.8 Ref.10

Sequence similarities

Belongs to the G-protein coupled receptor 1 family.

Ontologies

Keywords
   Cellular componentCell membrane
Membrane
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainTransmembrane
Transmembrane helix
   Molecular functionG-protein coupled receptor
Receptor
Transducer
   PTMDisulfide bond
Glycoprotein
Lipoprotein
Palmitate
   Technical term3D-structure
Complete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processcell proliferation

Traceable author statement PubMed 10400698. Source: ProtInc

digestion

Traceable author statement Ref.2. Source: ProtInc

digestive tract development

Inferred from electronic annotation. Source: Ensembl

feeding behavior

Traceable author statement Ref.2. Source: ProtInc

gastric acid secretion

Inferred from electronic annotation. Source: Ensembl

gland development

Inferred from electronic annotation. Source: Ensembl

phospholipase C-activating G-protein coupled receptor signaling pathway

Traceable author statement PubMed 8455720. Source: ProtInc

positive regulation of cell proliferation

Inferred from direct assay Ref.8. Source: UniProtKB

positive regulation of cytosolic calcium ion concentration

Inferred from direct assay Ref.8. Source: UniProtKB

sensory perception

Traceable author statement Ref.2. Source: ProtInc

   Cellular_componentintegral component of plasma membrane

Inferred by curator Ref.8. Source: UniProtKB

   Molecular_function1-phosphatidylinositol-3-kinase regulator activity

Traceable author statement PubMed 10400698. Source: ProtInc

cholecystokinin receptor activity

Traceable author statement Ref.2. Source: ProtInc

gastrin receptor activity

Inferred from direct assay Ref.8. Source: UniProtKB

phosphatidylinositol phospholipase C activity

Traceable author statement Ref.2. Source: ProtInc

type B gastrin/cholecystokinin receptor binding

Inferred from direct assay Ref.1PubMed 8185642. Source: NTNU_SB

Complete GO annotation...

Binary interactions

With

Entry

#Exp.

IntAct

Notes

PTPN11Q061245EBI-1753137,EBI-297779

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: P32239-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: P32239-2)

Also known as: CCK-C; CCK-BRi4sv;

The sequence of this isoform differs from the canonical sequence as follows:
     271-271: G → GGAGPREQNLGEAELWRATGPAGVGGTEMKVRVRRKLEMELSWERRSGGDWAGDWGDSPFSLTAHPLCSG
Isoform 3 (identifier: P32239-3)

Also known as: DeltaCCK-B;

The sequence of this isoform differs from the canonical sequence as follows:
     1-66: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 447447Gastrin/cholecystokinin type B receptor
PRO_0000069474

Regions

Topological domain1 – 5757Extracellular Potential
Transmembrane58 – 7922Helical; Name=1; Potential
Topological domain80 – 878Cytoplasmic Potential
Transmembrane88 – 10922Helical; Name=2; Potential
Topological domain110 – 13122Extracellular Potential
Transmembrane132 – 15019Helical; Name=3; Potential
Topological domain151 – 17020Cytoplasmic Potential
Transmembrane171 – 18919Helical; Name=4; Potential
Topological domain190 – 21930Extracellular Potential
Transmembrane220 – 24223Helical; Name=5; Potential
Topological domain243 – 33391Cytoplasmic Potential
Transmembrane334 – 35522Helical; Name=6; Potential
Topological domain356 – 37318Extracellular Potential
Transmembrane374 – 39421Helical; Name=7; Potential
Topological domain395 – 44753Cytoplasmic Potential

Amino acid modifications

Lipidation4081S-palmitoyl cysteine By similarity
Glycosylation71N-linked (GlcNAc...) Potential
Glycosylation301N-linked (GlcNAc...) Potential
Glycosylation361N-linked (GlcNAc...) Potential
Disulfide bond127 ↔ 205 By similarity

Natural variations

Alternative sequence1 – 6666Missing in isoform 3.
VSP_033444
Alternative sequence2711G → GGAGPREQNLGEAELWRATG PAGVGGTEMKVRVRRKLEME LSWERRSGGDWAGDWGDSPF SLTAHPLCSG in isoform 2.
VSP_033445
Natural variant371L → F.
Corresponds to variant rs1805000 [ dbSNP | Ensembl ].
VAR_014684
Natural variant771V → G.
Corresponds to variant rs35816985 [ dbSNP | Ensembl ].
VAR_049388
Natural variant1251V → I.
Corresponds to variant rs1805002 [ dbSNP | Ensembl ].
VAR_014685
Natural variant2151R → H.
Corresponds to variant rs1805004 [ dbSNP | Ensembl ].
VAR_014686
Natural variant3191R → Q.
Corresponds to variant rs1805001 [ dbSNP | Ensembl ].
VAR_014687

Experimental info

Sequence conflict641I → T in AAF67174. Ref.8
Sequence conflict931L → F in AAC27510. Ref.16
Sequence conflict961L → M in AAC27510. Ref.16
Sequence conflict1161L → I in AAC27510. Ref.16
Sequence conflict1711A → P in AAA91831. Ref.11
Sequence conflict2271F → S in BAF84753. Ref.12
Sequence conflict2491L → V in AAA91831. Ref.11
Sequence conflict2881E → K in AAB30766. Ref.5

Secondary structure

....... 447
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 1, 1993. Version 1.
Checksum: BAEEFAD4C1F85915

FASTA44748,419
        10         20         30         40         50         60 
MELLKLNRSV QGTGPGPGAS LCRPGAPLLN SSSVGNLSCE PPRIRGAGTR ELELAIRITL 

        70         80         90        100        110        120 
YAVIFLMSVG GNMLIIVVLG LSRRLRTVTN AFLLSLAVSD LLLAVACMPF TLLPNLMGTF 

       130        140        150        160        170        180 
IFGTVICKAV SYLMGVSVSV STLSLVAIAL ERYSAICRPL QARVWQTRSH AARVIVATWL 

       190        200        210        220        230        240 
LSGLLMVPYP VYTVVQPVGP RVLQCVHRWP SARVRQTWSV LLLLLLFFIP GVVMAVAYGL 

       250        260        270        280        290        300 
ISRELYLGLR FDGDSDSDSQ SRVRNQGGLP GAVHQNGRCR PETGAVGEDS DGCYVQLPRS 

       310        320        330        340        350        360 
RPALELTALT APGPGSGSRP TQAKLLAKKR VVRMLLVIVV LFFLCWLPVY SANTWRAFDG 

       370        380        390        400        410        420 
PGAHRALSGA PISFIHLLSY ASACVNPLVY CFMHRRFRQA CLETCARCCP RPPRARPRAL 

       430        440 
PDEDPPTPSI ASLSRLSYTT ISTLGPG 

« Hide

Isoform 2 (CCK-C) (CCK-BRi4sv) [UniParc].

Checksum: 9B27DDCAE3A67CC7
Show »

FASTA51655,869
Isoform 3 (DeltaCCK-B) [UniParc].

Checksum: 2DF92F7D8A27773B
Show »

FASTA38141,504

References

« Hide 'large scale' references
[1]"Molecular cloning of the human brain and gastric cholecystokinin receptor: structure, functional expression and chromosomal localization."
Pisegna J.R., de Weerth A., Huppi K., Wank S.A.
Biochem. Biophys. Res. Commun. 189:296-303(1992) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Brain.
[2]"The human brain cholecystokinin-B/gastrin receptor. Cloning and characterization."
Lee Y.-M., Beinborn M., McBride E.W., Lu M., Kolakowski L.F. Jr., Kopin A.S.
J. Biol. Chem. 268:8164-8169(1993) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Brain.
[3]"Functional characterization of a human brain cholecystokinin-B receptor. A trophic effect of cholecystokinin and gastrin."
Ito M., Matsui T., Taniguchi T., Tsukamoto T., Murayama T., Arima N., Nakata H., Chiba T., Chihara K.
J. Biol. Chem. 268:18300-18305(1993) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY.
Tissue: Brain.
[4]"The human gastrin/cholecystokinin type B receptor gene: alternative splice donor site in exon 4 generates two variant mRNAs."
Song I., Brown D.R., Wiltshire R.N., Gantz I., Trent J.M., Yamada T.
Proc. Natl. Acad. Sci. U.S.A. 90:9085-9089(1993) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
Tissue: Placenta.
[5]"Cholecystokinin stimulates Ca2+ mobilization and clonal growth in small cell lung cancer through CCKA and CCKB/gastrin receptors."
Herget T., Sethi T., Wu S.V., Walsh J.H., Rozengurt E.
Ann. N. Y. Acad. Sci. 713:283-297(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY.
Tissue: Fetal brain.
[6]"Functional characterization of two cholecystokinin-B/gastrin receptor isoforms: a preferential splice donor site in the human receptor gene."
Ito M., Iwata N., Taniguchi T., Murayama T., Chihara K., Matsui T.
Cell Growth Differ. 5:1127-1135(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], FUNCTION, ALTERNATIVE SPLICING, TISSUE SPECIFICITY.
Tissue: Lung fibroblast.
[7]"A truncated isoform of human CCK-B/gastrin receptor generated by alternative usage of a novel exon."
Miyake A.
Biochem. Biophys. Res. Commun. 208:230-237(1995) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), TISSUE SPECIFICITY.
Tissue: Stomach.
[8]"Human colorectal cancers express a constitutively active cholecystokinin-B/gastrin receptor that stimulates cell growth."
Hellmich M.R., Rui X.-L., Hellmich H.L., Fleming R.Y.D., Evers B.M., Townsend C.M. Jr.
J. Biol. Chem. 275:32122-32128(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION (ISOFORM 2), TISSUE SPECIFICITY.
Tissue: Colon cancer.
[9]"Identification of CCK-B/gastrin receptor splice variants in human peripheral blood mononuclear cells."
Schmitz F., Schrader H., Otte J.-M., Schmitz H., Stueber E., Herzig K.-H., Schmidt W.E.
Regul. Pept. 101:25-33(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, ALTERNATIVE SPLICING.
Tissue: Peripheral blood.
[10]"Characterization of the CCK-C (cancer) receptor in human pancreatic cancer."
Smith J.P., Verderame M.F., McLaughlin P., Martenis M., Ballard E., Zagon I.S.
Int. J. Mol. Med. 10:689-694(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY.
Tissue: Pancreatic cancer.
[11]"Cloning and expression of the human temporal cortex cholecystokinin B receptor."
Tate S.N., Gray J., Denyer J., Stolz M., Foord S., Lee M.G.
Submitted (MAR-1996) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA].
Tissue: Temporal cortex.
[12]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Stomach.
[13]"cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org)."
Kopatz S.A., Aronstam R.S., Sharma S.V.
Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain.
[14]"Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[15]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Placenta.
[16]"An 84-kilobase physical map and repeat polymorphisms of the gastrin/cholecystokinin brain receptor region at the junction of chromosome segments 11p15.4 and 15.5."
O'Briant K.C., Ali S.Y., Weier H.-U.G., Bepler G.
Chromosome Res. 6:415-418(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 52-447.
[17]"CCKA and CCKB receptors are expressed in small cell lung cancer lines and mediate Ca2+ mobilization and clonal growth."
Sethi T., Herget T., Wu S.V., Walsh J.H., Rozengurt E.
Cancer Res. 53:5208-5213(1993) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 244-333 (ISOFORMS 1/3), FUNCTION.
Tissue: Fetal brain.
[18]"Localization of the human cholecystokinin-B/gastrin receptor gene (CCKBR) to chromosome 11p15.5-->p15.4 by fluorescence in situ hybridization."
Zimonjic D.B., Popescu N.C., Matsui T., Ito M., Chihara K.
Cytogenet. Cell Genet. 65:184-185(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: CHROMOSOMAL LOCATION.
[19]"Intermolecular interactions between cholecystokinin-8 and the third extracellular loop of the cholecystokinin-2 receptor."
Giragossian C., Mierke D.F.
Biochemistry 41:4560-4566(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: STRUCTURE BY NMR OF 352-379.
+Additional computationally mapped references.

Web resources

Wikipedia

Cholecystokinin receptor entry

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
L04473 mRNA. Translation: AAA35660.1.
L08112 mRNA. Translation: AAA35657.1.
D13305 mRNA. Translation: BAA02564.1.
L10822 Genomic DNA. Translation: AAC37528.1.
S70057 mRNA. Translation: AAB30766.2.
D21219 Genomic DNA. Translation: BAA04759.2.
AF239668 mRNA. Translation: AAF67174.1.
AY029770 mRNA. Translation: AAK38351.1.
AF441129 mRNA. Translation: AAN32829.1.
L07746 mRNA. Translation: AAA91831.1.
AK292064 mRNA. Translation: BAF84753.1.
AY322551 mRNA. Translation: AAP84364.1.
BT006789 mRNA. Translation: AAP35435.1.
BC000740 mRNA. Translation: AAH00740.1.
AH006311 Genomic DNA. Translation: AAC27510.1.
PIRA47430.
I65231.
RefSeqNP_795344.1. NM_176875.3.
XP_005253267.1. XM_005253210.1.
UniGeneHs.203.

3D structure databases

PDBe
RCSB PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
1L4TNMR-A352-379[»]
ProteinModelPortalP32239.
SMRP32239. Positions 49-400.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid107329. 2 interactions.
DIPDIP-229N.
IntActP32239. 10 interactions.
MINTMINT-3013054.
STRING9606.ENSP00000335544.

Chemistry

BindingDBP32239.
ChEMBLCHEMBL298.
DrugBankDB00183. Pentagastrin.
GuidetoPHARMACOLOGY77.

Protein family/group databases

GPCRDBSearch...

PTM databases

PhosphoSiteP32239.

Polymorphism databases

DMDM417029.

Proteomic databases

PaxDbP32239.
PRIDEP32239.

Protocols and materials databases

DNASU887.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000334619; ENSP00000335544; ENSG00000110148. [P32239-1]
ENST00000525462; ENSP00000435534; ENSG00000110148. [P32239-2]
GeneID887.
KEGGhsa:887.
UCSCuc001mcp.3. human. [P32239-1]
uc001mcs.3. human. [P32239-2]

Organism-specific databases

CTD887.
GeneCardsGC11P006280.
HGNCHGNC:1571. CCKBR.
HPAHPA041976.
MIM118445. gene.
neXtProtNX_P32239.
PharmGKBPA26143.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG238659.
HOVERGENHBG036927.
InParanoidP32239.
KOK04195.
OMAWRAFDGP.
OrthoDBEOG7QVM36.
PhylomeDBP32239.
TreeFamTF315303.

Enzyme and pathway databases

ReactomeREACT_111102. Signal Transduction.
SignaLinkP32239.

Gene expression databases

ArrayExpressP32239.
BgeeP32239.
CleanExHS_CCKBR.
GenevestigatorP32239.

Family and domain databases

InterProIPR009126. Cholcskin_rcpt.
IPR000314. Gastrin_rcpt.
IPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
[Graphical view]
PfamPF00001. 7tm_1. 1 hit.
[Graphical view]
PRINTSPR01822. CCYSTOKININR.
PR00527. GASTRINR.
PR00237. GPCRRHODOPSN.
PROSITEPS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

EvolutionaryTraceP32239.
GeneWikiCholecystokinin_B_receptor.
GenomeRNAi887.
NextBio3666.
PROP32239.
SOURCESearch...

Entry information

Entry nameGASR_HUMAN
AccessionPrimary (citable) accession number: P32239
Secondary accession number(s): A8K7P9 expand/collapse secondary AC list , O75824, Q16144, Q92492, Q96LC6, Q9NYK7, Q9UBV1
Entry history
Integrated into UniProtKB/Swiss-Prot: October 1, 1993
Last sequence update: October 1, 1993
Last modified: March 19, 2014
This is version 145 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 11

Human chromosome 11: entries, gene names and cross-references to MIM

7-transmembrane G-linked receptors

List of 7-transmembrane G-linked receptor entries