Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P32239

- GASR_HUMAN

UniProt

P32239 - GASR_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Gastrin/cholecystokinin type B receptor

Gene

CCKBR

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Receptor for gastrin and cholecystokinin. The CKK-B receptors occur throughout the central nervous system where they modulate anxiety, analgesia, arousal, and neuroleptic activity. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Isoform 2 is constitutively activated and may regulate cancer cell proliferation via a gastrin-independent mechanism.

GO - Molecular functioni

  1. 1-phosphatidylinositol-3-kinase regulator activity Source: ProtInc
  2. cholecystokinin receptor activity Source: ProtInc
  3. gastrin receptor activity Source: UniProtKB
  4. phosphatidylinositol phospholipase C activity Source: ProtInc
  5. type B gastrin/cholecystokinin receptor binding Source: NTNU_SB

GO - Biological processi

  1. cell proliferation Source: ProtInc
  2. cell surface receptor signaling pathway Source: UniProtKB
  3. cholecystokinin signaling pathway Source: GOC
  4. digestion Source: ProtInc
  5. digestive tract development Source: Ensembl
  6. feeding behavior Source: ProtInc
  7. gastric acid secretion Source: Ensembl
  8. gland development Source: Ensembl
  9. metabolic process Source: GOC
  10. phospholipase C-activating G-protein coupled receptor signaling pathway Source: ProtInc
  11. positive regulation of cell proliferation Source: UniProtKB
  12. positive regulation of cytosolic calcium ion concentration Source: UniProtKB
  13. regulation of phosphatidylinositol 3-kinase activity Source: GOC
  14. sensory perception Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

ReactomeiREACT_120966. Gastrin-CREB signalling pathway via PKC and MAPK.
REACT_14819. Peptide ligand-binding receptors.
REACT_18283. G alpha (q) signalling events.
SignaLinkiP32239.

Names & Taxonomyi

Protein namesi
Recommended name:
Gastrin/cholecystokinin type B receptor
Short name:
CCK-B receptor
Short name:
CCK-BR
Alternative name(s):
Cholecystokinin-2 receptor
Short name:
CCK2-R
Gene namesi
Name:CCKBR
Synonyms:CCKRB
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 11

Organism-specific databases

HGNCiHGNC:1571. CCKBR.

Subcellular locationi

GO - Cellular componenti

  1. integral component of plasma membrane Source: UniProtKB
  2. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA26143.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 447447Gastrin/cholecystokinin type B receptorPRO_0000069474Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi7 – 71N-linked (GlcNAc...)Sequence Analysis
Glycosylationi30 – 301N-linked (GlcNAc...)Sequence Analysis
Glycosylationi36 – 361N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi127 ↔ 205PROSITE-ProRule annotation
Lipidationi408 – 4081S-palmitoyl cysteineBy similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Lipoprotein, Palmitate

Proteomic databases

PaxDbiP32239.
PRIDEiP32239.

PTM databases

PhosphoSiteiP32239.

Expressioni

Tissue specificityi

Isoform 1 is expressed in brain, pancreas, stomach, the colon cancer cell line LoVo and the T-lymphoblastoma Jurkat, but not in heart, placenta, liver, lung, skeletal muscle, kidney or the stomach cancer cell line AGS. Expressed at high levels in the small cell lung cancer cell line NCI-H510, at lower levels in NCI-H345, NCI-H69 and GLC-28 cell lines, not expressed in GLC-19 cell line. Within the stomach, expressed at high levels in the mucosa of the gastric fundus and at low levels in the antrum and duodenum. Isoform 2 is present in pancreatic cancer cells and colorectal cancer cells, but not in normal pancreas or colonic mucosa. Isoform 3 is expressed in brain, pancreas, stomach, the stomach cancer cell line AGS and the colon cancer cell line LoVo.6 Publications

Gene expression databases

BgeeiP32239.
CleanExiHS_CCKBR.
ExpressionAtlasiP32239. baseline and differential.
GenevestigatoriP32239.

Organism-specific databases

HPAiHPA041976.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
PTPN11Q061245EBI-1753137,EBI-297779

Protein-protein interaction databases

BioGridi107329. 3 interactions.
DIPiDIP-229N.
IntActiP32239. 10 interactions.
MINTiMINT-3013054.
STRINGi9606.ENSP00000335544.

Structurei

Secondary structure

1
447
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi353 – 3586
Helixi363 – 3686
Helixi372 – 3787

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1L4TNMR-A352-379[»]
ProteinModelPortaliP32239.
SMRiP32239. Positions 49-400.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP32239.

Topological domain

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 5757ExtracellularSequence AnalysisAdd
BLAST
Topological domaini80 – 878CytoplasmicSequence Analysis
Topological domaini110 – 13122ExtracellularSequence AnalysisAdd
BLAST
Topological domaini151 – 17020CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini190 – 21930ExtracellularSequence AnalysisAdd
BLAST
Topological domaini243 – 33391CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini356 – 37318ExtracellularSequence AnalysisAdd
BLAST
Topological domaini395 – 44753CytoplasmicSequence AnalysisAdd
BLAST

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei58 – 7922Helical; Name=1Sequence AnalysisAdd
BLAST
Transmembranei88 – 10922Helical; Name=2Sequence AnalysisAdd
BLAST
Transmembranei132 – 15019Helical; Name=3Sequence AnalysisAdd
BLAST
Transmembranei171 – 18919Helical; Name=4Sequence AnalysisAdd
BLAST
Transmembranei220 – 24223Helical; Name=5Sequence AnalysisAdd
BLAST
Transmembranei334 – 35522Helical; Name=6Sequence AnalysisAdd
BLAST
Transmembranei374 – 39421Helical; Name=7Sequence AnalysisAdd
BLAST

Family & Domainsi

Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG238659.
GeneTreeiENSGT00730000110635.
HOVERGENiHBG036927.
InParanoidiP32239.
KOiK04195.
OMAiRVRQTWS.
OrthoDBiEOG7QVM36.
PhylomeDBiP32239.
TreeFamiTF315303.

Family and domain databases

Gene3Di1.20.1070.10. 2 hits.
InterProiIPR009126. Cholcskin_rcpt.
IPR000314. Gastrin_rcpt.
IPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
[Graphical view]
PfamiPF00001. 7tm_1. 1 hit.
[Graphical view]
PRINTSiPR01822. CCYSTOKININR.
PR00527. GASTRINR.
PR00237. GPCRRHODOPSN.
PROSITEiPS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P32239-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MELLKLNRSV QGTGPGPGAS LCRPGAPLLN SSSVGNLSCE PPRIRGAGTR
60 70 80 90 100
ELELAIRITL YAVIFLMSVG GNMLIIVVLG LSRRLRTVTN AFLLSLAVSD
110 120 130 140 150
LLLAVACMPF TLLPNLMGTF IFGTVICKAV SYLMGVSVSV STLSLVAIAL
160 170 180 190 200
ERYSAICRPL QARVWQTRSH AARVIVATWL LSGLLMVPYP VYTVVQPVGP
210 220 230 240 250
RVLQCVHRWP SARVRQTWSV LLLLLLFFIP GVVMAVAYGL ISRELYLGLR
260 270 280 290 300
FDGDSDSDSQ SRVRNQGGLP GAVHQNGRCR PETGAVGEDS DGCYVQLPRS
310 320 330 340 350
RPALELTALT APGPGSGSRP TQAKLLAKKR VVRMLLVIVV LFFLCWLPVY
360 370 380 390 400
SANTWRAFDG PGAHRALSGA PISFIHLLSY ASACVNPLVY CFMHRRFRQA
410 420 430 440
CLETCARCCP RPPRARPRAL PDEDPPTPSI ASLSRLSYTT ISTLGPG
Length:447
Mass (Da):48,419
Last modified:October 1, 1993 - v1
Checksum:iBAEEFAD4C1F85915
GO
Isoform 2 (identifier: P32239-2) [UniParc]FASTAAdd to Basket

Also known as: CCK-C, CCK-BRi4sv

The sequence of this isoform differs from the canonical sequence as follows:
     271-271: G → GGAGPREQNLGEAELWRATGPAGVGGTEMKVRVRRKLEMELSWERRSGGDWAGDWGDSPFSLTAHPLCSG

Show »
Length:516
Mass (Da):55,869
Checksum:i9B27DDCAE3A67CC7
GO
Isoform 3 (identifier: P32239-3) [UniParc]FASTAAdd to Basket

Also known as: DeltaCCK-B

The sequence of this isoform differs from the canonical sequence as follows:
     1-66: Missing.

Show »
Length:381
Mass (Da):41,504
Checksum:i2DF92F7D8A27773B
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti64 – 641I → T in AAF67174. (PubMed:10913157)Curated
Sequence conflicti93 – 931L → F in AAC27510. (PubMed:9872672)Curated
Sequence conflicti96 – 961L → M in AAC27510. (PubMed:9872672)Curated
Sequence conflicti116 – 1161L → I in AAC27510. (PubMed:9872672)Curated
Sequence conflicti171 – 1711A → P in AAA91831. 1 PublicationCurated
Sequence conflicti227 – 2271F → S in BAF84753. (PubMed:14702039)Curated
Sequence conflicti249 – 2491L → V in AAA91831. 1 PublicationCurated
Sequence conflicti288 – 2881E → K in AAB30766. (PubMed:8185170)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti37 – 371L → F.
Corresponds to variant rs1805000 [ dbSNP | Ensembl ].
VAR_014684
Natural varianti77 – 771V → G.
Corresponds to variant rs35816985 [ dbSNP | Ensembl ].
VAR_049388
Natural varianti125 – 1251V → I.
Corresponds to variant rs1805002 [ dbSNP | Ensembl ].
VAR_014685
Natural varianti215 – 2151R → H.
Corresponds to variant rs1805004 [ dbSNP | Ensembl ].
VAR_014686
Natural varianti319 – 3191R → Q.
Corresponds to variant rs1805001 [ dbSNP | Ensembl ].
VAR_014687

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6666Missing in isoform 3. 1 PublicationVSP_033444Add
BLAST
Alternative sequencei271 – 2711G → GGAGPREQNLGEAELWRATG PAGVGGTEMKVRVRRKLEME LSWERRSGGDWAGDWGDSPF SLTAHPLCSG in isoform 2. 3 PublicationsVSP_033445

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
L04473 mRNA. Translation: AAA35660.1.
L08112 mRNA. Translation: AAA35657.1.
D13305 mRNA. Translation: BAA02564.1.
L10822 Genomic DNA. Translation: AAC37528.1.
S70057 mRNA. Translation: AAB30766.2.
D21219 Genomic DNA. Translation: BAA04759.2.
AF239668 mRNA. Translation: AAF67174.1.
AY029770 mRNA. Translation: AAK38351.1.
AF441129 mRNA. Translation: AAN32829.1.
L07746 mRNA. Translation: AAA91831.1.
AK292064 mRNA. Translation: BAF84753.1.
AY322551 mRNA. Translation: AAP84364.1.
BT006789 mRNA. Translation: AAP35435.1.
BC000740 mRNA. Translation: AAH00740.1.
AH006311 Genomic DNA. Translation: AAC27510.1.
CCDSiCCDS7761.1. [P32239-1]
PIRiA47430.
I65231.
RefSeqiNP_795344.1. NM_176875.3. [P32239-1]
XP_005253267.1. XM_005253210.1. [P32239-2]
UniGeneiHs.203.

Genome annotation databases

EnsembliENST00000334619; ENSP00000335544; ENSG00000110148. [P32239-1]
ENST00000525462; ENSP00000435534; ENSG00000110148. [P32239-2]
GeneIDi887.
KEGGihsa:887.
UCSCiuc001mcp.3. human. [P32239-1]
uc001mcs.3. human. [P32239-2]

Polymorphism databases

DMDMi417029.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Wikipedia

Cholecystokinin receptor entry

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
L04473 mRNA. Translation: AAA35660.1 .
L08112 mRNA. Translation: AAA35657.1 .
D13305 mRNA. Translation: BAA02564.1 .
L10822 Genomic DNA. Translation: AAC37528.1 .
S70057 mRNA. Translation: AAB30766.2 .
D21219 Genomic DNA. Translation: BAA04759.2 .
AF239668 mRNA. Translation: AAF67174.1 .
AY029770 mRNA. Translation: AAK38351.1 .
AF441129 mRNA. Translation: AAN32829.1 .
L07746 mRNA. Translation: AAA91831.1 .
AK292064 mRNA. Translation: BAF84753.1 .
AY322551 mRNA. Translation: AAP84364.1 .
BT006789 mRNA. Translation: AAP35435.1 .
BC000740 mRNA. Translation: AAH00740.1 .
AH006311 Genomic DNA. Translation: AAC27510.1 .
CCDSi CCDS7761.1. [P32239-1 ]
PIRi A47430.
I65231.
RefSeqi NP_795344.1. NM_176875.3. [P32239-1 ]
XP_005253267.1. XM_005253210.1. [P32239-2 ]
UniGenei Hs.203.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1L4T NMR - A 352-379 [» ]
ProteinModelPortali P32239.
SMRi P32239. Positions 49-400.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 107329. 3 interactions.
DIPi DIP-229N.
IntActi P32239. 10 interactions.
MINTi MINT-3013054.
STRINGi 9606.ENSP00000335544.

Chemistry

BindingDBi P32239.
ChEMBLi CHEMBL298.
DrugBanki DB00183. Pentagastrin.
GuidetoPHARMACOLOGYi 77.

Protein family/group databases

GPCRDBi Search...

PTM databases

PhosphoSitei P32239.

Polymorphism databases

DMDMi 417029.

Proteomic databases

PaxDbi P32239.
PRIDEi P32239.

Protocols and materials databases

DNASUi 887.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000334619 ; ENSP00000335544 ; ENSG00000110148 . [P32239-1 ]
ENST00000525462 ; ENSP00000435534 ; ENSG00000110148 . [P32239-2 ]
GeneIDi 887.
KEGGi hsa:887.
UCSCi uc001mcp.3. human. [P32239-1 ]
uc001mcs.3. human. [P32239-2 ]

Organism-specific databases

CTDi 887.
GeneCardsi GC11P006280.
HGNCi HGNC:1571. CCKBR.
HPAi HPA041976.
MIMi 118445. gene.
neXtProti NX_P32239.
PharmGKBi PA26143.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG238659.
GeneTreei ENSGT00730000110635.
HOVERGENi HBG036927.
InParanoidi P32239.
KOi K04195.
OMAi RVRQTWS.
OrthoDBi EOG7QVM36.
PhylomeDBi P32239.
TreeFami TF315303.

Enzyme and pathway databases

Reactomei REACT_120966. Gastrin-CREB signalling pathway via PKC and MAPK.
REACT_14819. Peptide ligand-binding receptors.
REACT_18283. G alpha (q) signalling events.
SignaLinki P32239.

Miscellaneous databases

EvolutionaryTracei P32239.
GeneWikii Cholecystokinin_B_receptor.
GenomeRNAii 887.
NextBioi 3666.
PROi P32239.
SOURCEi Search...

Gene expression databases

Bgeei P32239.
CleanExi HS_CCKBR.
ExpressionAtlasi P32239. baseline and differential.
Genevestigatori P32239.

Family and domain databases

Gene3Di 1.20.1070.10. 2 hits.
InterProi IPR009126. Cholcskin_rcpt.
IPR000314. Gastrin_rcpt.
IPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
[Graphical view ]
Pfami PF00001. 7tm_1. 1 hit.
[Graphical view ]
PRINTSi PR01822. CCYSTOKININR.
PR00527. GASTRINR.
PR00237. GPCRRHODOPSN.
PROSITEi PS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning of the human brain and gastric cholecystokinin receptor: structure, functional expression and chromosomal localization."
    Pisegna J.R., de Weerth A., Huppi K., Wank S.A.
    Biochem. Biophys. Res. Commun. 189:296-303(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. "The human brain cholecystokinin-B/gastrin receptor. Cloning and characterization."
    Lee Y.-M., Beinborn M., McBride E.W., Lu M., Kolakowski L.F. Jr., Kopin A.S.
    J. Biol. Chem. 268:8164-8169(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Brain.
  3. "Functional characterization of a human brain cholecystokinin-B receptor. A trophic effect of cholecystokinin and gastrin."
    Ito M., Matsui T., Taniguchi T., Tsukamoto T., Murayama T., Arima N., Nakata H., Chiba T., Chihara K.
    J. Biol. Chem. 268:18300-18305(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY.
    Tissue: Brain.
  4. "The human gastrin/cholecystokinin type B receptor gene: alternative splice donor site in exon 4 generates two variant mRNAs."
    Song I., Brown D.R., Wiltshire R.N., Gantz I., Trent J.M., Yamada T.
    Proc. Natl. Acad. Sci. U.S.A. 90:9085-9089(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    Tissue: Placenta.
  5. "Cholecystokinin stimulates Ca2+ mobilization and clonal growth in small cell lung cancer through CCKA and CCKB/gastrin receptors."
    Herget T., Sethi T., Wu S.V., Walsh J.H., Rozengurt E.
    Ann. N. Y. Acad. Sci. 713:283-297(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY.
    Tissue: Fetal brain.
  6. "Functional characterization of two cholecystokinin-B/gastrin receptor isoforms: a preferential splice donor site in the human receptor gene."
    Ito M., Iwata N., Taniguchi T., Murayama T., Chihara K., Matsui T.
    Cell Growth Differ. 5:1127-1135(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], FUNCTION, ALTERNATIVE SPLICING, TISSUE SPECIFICITY.
    Tissue: Lung fibroblast.
  7. "A truncated isoform of human CCK-B/gastrin receptor generated by alternative usage of a novel exon."
    Miyake A.
    Biochem. Biophys. Res. Commun. 208:230-237(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), TISSUE SPECIFICITY.
    Tissue: Stomach.
  8. "Human colorectal cancers express a constitutively active cholecystokinin-B/gastrin receptor that stimulates cell growth."
    Hellmich M.R., Rui X.-L., Hellmich H.L., Fleming R.Y.D., Evers B.M., Townsend C.M. Jr.
    J. Biol. Chem. 275:32122-32128(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION (ISOFORM 2), TISSUE SPECIFICITY.
    Tissue: Colon cancer.
  9. "Identification of CCK-B/gastrin receptor splice variants in human peripheral blood mononuclear cells."
    Schmitz F., Schrader H., Otte J.-M., Schmitz H., Stueber E., Herzig K.-H., Schmidt W.E.
    Regul. Pept. 101:25-33(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, ALTERNATIVE SPLICING.
    Tissue: Peripheral blood.
  10. "Characterization of the CCK-C (cancer) receptor in human pancreatic cancer."
    Smith J.P., Verderame M.F., McLaughlin P., Martenis M., Ballard E., Zagon I.S.
    Int. J. Mol. Med. 10:689-694(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY.
    Tissue: Pancreatic cancer.
  11. "Cloning and expression of the human temporal cortex cholecystokinin B receptor."
    Tate S.N., Gray J., Denyer J., Stolz M., Foord S., Lee M.G.
    Submitted (MAR-1996) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA].
    Tissue: Temporal cortex.
  12. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Stomach.
  13. "cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org)."
    Kopatz S.A., Aronstam R.S., Sharma S.V.
    Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  14. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
    Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
    Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  15. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Placenta.
  16. "An 84-kilobase physical map and repeat polymorphisms of the gastrin/cholecystokinin brain receptor region at the junction of chromosome segments 11p15.4 and 15.5."
    O'Briant K.C., Ali S.Y., Weier H.-U.G., Bepler G.
    Chromosome Res. 6:415-418(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 52-447.
  17. "CCKA and CCKB receptors are expressed in small cell lung cancer lines and mediate Ca2+ mobilization and clonal growth."
    Sethi T., Herget T., Wu S.V., Walsh J.H., Rozengurt E.
    Cancer Res. 53:5208-5213(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 244-333 (ISOFORMS 1/3), FUNCTION.
    Tissue: Fetal brain.
  18. "Localization of the human cholecystokinin-B/gastrin receptor gene (CCKBR) to chromosome 11p15.5-->p15.4 by fluorescence in situ hybridization."
    Zimonjic D.B., Popescu N.C., Matsui T., Ito M., Chihara K.
    Cytogenet. Cell Genet. 65:184-185(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: CHROMOSOMAL LOCATION.
  19. "Intermolecular interactions between cholecystokinin-8 and the third extracellular loop of the cholecystokinin-2 receptor."
    Giragossian C., Mierke D.F.
    Biochemistry 41:4560-4566(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: STRUCTURE BY NMR OF 352-379.

Entry informationi

Entry nameiGASR_HUMAN
AccessioniPrimary (citable) accession number: P32239
Secondary accession number(s): A8K7P9
, O75824, Q16144, Q92492, Q96LC6, Q9NYK7, Q9UBV1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1993
Last sequence update: October 1, 1993
Last modified: October 29, 2014
This is version 152 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3