Reviewed,
UniProtKB/Swiss-Prot P32239 (GASR_HUMAN)
Last modified
November 25, 2008.
Version 88.
History...
Clusters with 100%,
90%,
50% identity |
Documents (7) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Gastrin/cholecystokinin type B receptor Short name=CCK-B receptor Short name=CCK-BR Alternative name(s): Cholecystokinin-2 receptor Short name=CCK2-R | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 447 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Receptor for gastrin and cholecystokinin. The CKK-B receptors occur throughout the central nervous system where they modulate anxiety, analgesia, arousal, and neuroleptic activity. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Isoform 2 may regulate cancer cell proliferation via a gastrin-independent mechanism. |
| Subcellular location | |
| Tissue specificity | Isoform 1 is expressed in brain, pancreas, stomach, the colon cancer cell line LoVo and the T-lymphoblastoma Jurkat, but not in heart, placenta, liver, lung, skeletal muscle, kidney or the stomach cancer cell line AGS. Expressed at high levels in the small cell lung cancer cell line H510, at lower levels in H345, H69 and GLC28, not expressed in GLC19. Within the stomach, expressed at high levels in the mucosa of the gastric fundus and at low levels in the antrum and duodenum. Isoform 2 is present in pancreatic cancer cells and colorectal cancer cells, but not in normal pancreas or colonic mucosa. Isoform 3 is expressed in brain, pancreas, stomach, the stomach cancer cell line AGS and the colon cancer cell line LoVo. |
| Sequence similarities | Belongs to the G-protein coupled receptor 1 family. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| ABL1 | P00519 | 1 | EBI-1753137,EBI-375543 | |
| FYN | P06241 | 1 | EBI-1753137,EBI-515315 | |
| GRB2 | P62993 | 1 | EBI-1753137,EBI-401755 | |
| NCK1 | P16333 | 1 | EBI-1753137,EBI-389883 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P32239-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P32239-2) Also known as: CCK-C; CCK-BRi4sv; The sequence of this isoform differs from the canonical sequence as follows: 271-271: G → GGAGPREQNLGEAELWRATGPAGVGGTEMKVRVRRKLEMELSWERRSGGDWAGDWGDSPFSLTAHPLCSG | ||||||
| Isoform 3 (identifier: P32239-3) Also known as: DeltaCCK-B; The sequence of this isoform differs from the canonical sequence as follows: 1-66: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||
Molecule processing | |||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 447 | 447 | Gastrin/cholecystokinin type B receptor | PRO_0000069474 | |||||||||||
Regions | |||||||||||||||
| Topological domain | 1 – 57 | 57 | Extracellular Potential | ||||||||||||
| Transmembrane | 58 – 79 | 22 | 1 Potential | ||||||||||||
| Topological domain | 80 – 87 | 8 | Cytoplasmic Potential | ||||||||||||
| Transmembrane | 88 – 109 | 22 | 2 Potential | ||||||||||||
| Topological domain | 110 – 131 | 22 | Extracellular Potential | ||||||||||||
| Transmembrane | 132 – 150 | 19 | 3 Potential | ||||||||||||
| Topological domain | 151 – 170 | 20 | Cytoplasmic Potential | ||||||||||||
| Transmembrane | 171 – 189 | 19 | 4 Potential | ||||||||||||
| Topological domain | 190 – 219 | 30 | Extracellular Potential | ||||||||||||
| Transmembrane | 220 – 242 | 23 | 5 Potential | ||||||||||||
| Topological domain | 243 – 333 | 91 | Cytoplasmic Potential | ||||||||||||
| Transmembrane | 334 – 355 | 22 | 6 Potential | ||||||||||||
| Topological domain | 356 – 373 | 18 | Extracellular Potential | ||||||||||||
| Transmembrane | 374 – 394 | 21 | 7 Potential | ||||||||||||
| Topological domain | 395 – 447 | 53 | Cytoplasmic Potential | ||||||||||||
Amino acid modifications | |||||||||||||||
| Lipidation | 408 | 1 | S-palmitoyl cysteine By similarity | ||||||||||||
| Glycosylation | 7 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||
| Glycosylation | 30 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||
| Glycosylation | 36 | 1 | N-linked (GlcNAc...) Potential | ||||||||||||
| Disulfide bond | 127 ↔ 205 | By similarity | |||||||||||||
Natural variations | |||||||||||||||
| Alternative sequence | 1 – 66 | 66 | Missing in isoform 3. | VSP_033444 | |||||||||||
| Alternative sequence | 271 | 1 | G → GGAGPREQNLGEAELWRATG PAGVGGTEMKVRVRRKLEME LSWERRSGGDWAGDWGDSPF SLTAHPLCSG in isoform 2. | VSP_033445 | |||||||||||
| Natural variant | 37 | 1 | L → F: dbSNP rs1805000. | VAR_014684 | |||||||||||
| Natural variant | 125 | 1 | V → I: dbSNP rs1805002. | VAR_014685 | |||||||||||
| Natural variant | 215 | 1 | R → H: dbSNP rs1805004. | VAR_014686 | |||||||||||
| Natural variant | 319 | 1 | R → Q: dbSNP rs1805001. | VAR_014687 | |||||||||||
Experimental info | |||||||||||||||
| Sequence conflict | 64 | 1 | I → T in AAF67174. Ref.8 | ||||||||||||
| Sequence conflict | 93 | 1 | L → F in AAC27510. Ref.16 | ||||||||||||
| Sequence conflict | 96 | 1 | L → M in AAC27510. Ref.16 | ||||||||||||
| Sequence conflict | 116 | 1 | L → I in AAC27510. Ref.16 | ||||||||||||
| Sequence conflict | 171 | 1 | A → P in AAA91831. Ref.11 | ||||||||||||
| Sequence conflict | 227 | 1 | F → S in BAF84753. Ref.12 | ||||||||||||
| Sequence conflict | 249 | 1 | L → V in AAA91831. Ref.11 | ||||||||||||
| Sequence conflict | 288 | 1 | E → K in AAB30766. Ref.5 | ||||||||||||
Secondary structure | |||||||||||||||
Helix Strand Turn | |||||||||||||||
| Helix | 353 – 358 | 6 | |||||||||||||
| Helix | 363 – 368 | 6 | |||||||||||||
| Helix | 372 – 378 | 7 | |||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning of the human brain and gastric cholecystokinin receptor: structure, functional expression and chromosomal localization." Pisegna J.R., de Weerth A., Huppi K., Wank S.A. Biochem. Biophys. Res. Commun. 189:296-303(1992) [PubMed: 1280419] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Brain. |
| [2] | "The human brain cholecystokinin-B/gastrin receptor. Cloning and characterization." Lee Y.-M., Beinborn M., McBride E.W., Lu M., Kolakowski L.F. Jr., Kopin A.S. J. Biol. Chem. 268:8164-8169(1993) [PubMed: 7681836] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Brain. |
| [3] | "Functional characterization of a human brain cholecystokinin-B receptor. A trophic effect of cholecystokinin and gastrin." Ito M., Matsui T., Taniguchi T., Tsukamoto T., Murayama T., Arima N., Nakata H., Chiba T., Chihara K. J. Biol. Chem. 268:18300-18305(1993) [PubMed: 8349705] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY. Tissue: Brain. |
| [4] | "The human gastrin/cholecystokinin type B receptor gene: alternative splice donor site in exon 4 generates two variant mRNAs." Song I., Brown D.R., Wiltshire R.N., Gantz I., Trent J.M., Yamada T. Proc. Natl. Acad. Sci. U.S.A. 90:9085-9089(1993) [PubMed: 8415658] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. Tissue: Placenta. |
| [5] | "Cholecystokinin stimulates Ca2+ mobilization and clonal growth in small cell lung cancer through CCKA and CCKB/gastrin receptors." Herget T., Sethi T., Wu S.V., Walsh J.H., Rozengurt E. Ann. N. Y. Acad. Sci. 713:283-297(1994) [PubMed: 8185170] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY. Tissue: Fetal brain. |
| [6] | "Functional characterization of two cholecystokinin-B/gastrin receptor isoforms: a preferential splice donor site in the human receptor gene." Ito M., Iwata N., Taniguchi T., Murayama T., Chihara K., Matsui T. Cell Growth Differ. 5:1127-1135(1994) [PubMed: 7848914] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], FUNCTION, ALTERNATIVE SPLICING, TISSUE SPECIFICITY. Tissue: Lung fibroblast. |
| [7] | "A truncated isoform of human CCK-B/gastrin receptor generated by alternative usage of a novel exon." Miyake A. Biochem. Biophys. Res. Commun. 208:230-237(1995) [PubMed: 7887934] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), TISSUE SPECIFICITY. Tissue: Stomach. |
| [8] | "Human colorectal cancers express a constitutively active cholecystokinin-B/gastrin receptor that stimulates cell growth." Hellmich M.R., Rui X.-L., Hellmich H.L., Fleming R.Y.D., Evers B.M., Townsend C.M. Jr. J. Biol. Chem. 275:32122-32128(2000) [PubMed: 10913157] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, TISSUE SPECIFICITY. Tissue: Colon cancer. |
| [9] | "Identification of CCK-B/gastrin receptor splice variants in human peripheral blood mononuclear cells." Schmitz F., Schrader H., Otte J.-M., Schmitz H., Stueber E., Herzig K.-H., Schmidt W.E. Regul. Pept. 101:25-33(2001) [PubMed: 11495676] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, ALTERNATIVE SPLICING. Tissue: Peripheral blood. |
| [10] | "Characterization of the CCK-C (cancer) receptor in human pancreatic cancer." Smith J.P., Verderame M.F., McLaughlin P., Martenis M., Ballard E., Zagon I.S. Int. J. Mol. Med. 10:689-694(2002) [PubMed: 12429993] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY. Tissue: Pancreatic cancer. |
| [11] | "Cloning and expression of the human temporal cortex cholecystokinin B receptor." Tate S.N., Gray J., Denyer J., Stolz M., Foord S., Lee M.G. Submitted (MAR-1996) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Tissue: Temporal cortex. |
| [12] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Stomach. |
| [13] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [14] | "cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org)." Kopatz S.A., Aronstam R.S., Sharma S.V. Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [15] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Placenta. |
| [16] | "An 84-kilobase physical map and repeat polymorphisms of the gastrin/cholecystokinin brain receptor region at the junction of chromosome segments 11p15.4 and 15.5." O'Briant K.C., Ali S.Y., Weier H.-U.G., Bepler G. Chromosome Res. 6:415-418(1998) [PubMed: 9872672] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 52-447. |
| [17] | "CCKA and CCKB receptors are expressed in small cell lung cancer lines and mediate Ca2+ mobilization and clonal growth." Sethi T., Herget T., Wu S.V., Walsh J.H., Rozengurt E. Cancer Res. 53:5208-5213(1993) [PubMed: 8221657] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 244-333 (ISOFORMS 1/3), FUNCTION. Tissue: Fetal brain. |
| [18] | "Localization of the human cholecystokinin-B/gastrin receptor gene (CCKBR) to chromosome 11p15.5-->p15.4 by fluorescence in situ hybridization." Zimonjic D.B., Popescu N.C., Matsui T., Ito M., Chihara K. Cytogenet. Cell Genet. 65:184-185(1994) [PubMed: 8222757] [Abstract] Cited for: CHROMOSOMAL LOCATION. |
| [19] | "Intermolecular interactions between cholecystokinin-8 and the third extracellular loop of the cholecystokinin-2 receptor." Giragossian C., Mierke D.F. Biochemistry 41:4560-4566(2002) [PubMed: 11926817] [Abstract] Cited for: STRUCTURE BY NMR OF 352-379. |
| + | Additional computationally mapped references. |

Clusters with