Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Gastrin/cholecystokinin type B receptor

Gene

CCKBR

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Receptor for gastrin and cholecystokinin. The CKK-B receptors occur throughout the central nervous system where they modulate anxiety, analgesia, arousal, and neuroleptic activity. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Isoform 2 is constitutively activated and may regulate cancer cell proliferation via a gastrin-independent mechanism.

GO - Molecular functioni

  • 1-phosphatidylinositol-3-kinase regulator activity Source: ProtInc
  • cholecystokinin receptor activity Source: ProtInc
  • gastrin receptor activity Source: UniProtKB
  • phosphatidylinositol phospholipase C activity Source: ProtInc
  • type B gastrin/cholecystokinin receptor binding Source: NTNU_SB

GO - Biological processi

  • cell proliferation Source: ProtInc
  • cell surface receptor signaling pathway Source: UniProtKB
  • digestion Source: ProtInc
  • digestive tract development Source: Ensembl
  • feeding behavior Source: ProtInc
  • gastric acid secretion Source: Ensembl
  • gland development Source: Ensembl
  • phospholipase C-activating G-protein coupled receptor signaling pathway Source: ProtInc
  • positive regulation of cell proliferation Source: UniProtKB
  • positive regulation of cytosolic calcium ion concentration Source: UniProtKB
  • sensory perception Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

BioCyciZFISH:ENSG00000110148-MONOMER.
ReactomeiR-HSA-375276. Peptide ligand-binding receptors.
R-HSA-416476. G alpha (q) signalling events.
R-HSA-881907. Gastrin-CREB signalling pathway via PKC and MAPK.
SignaLinkiP32239.
SIGNORiP32239.

Names & Taxonomyi

Protein namesi
Recommended name:
Gastrin/cholecystokinin type B receptor
Short name:
CCK-B receptor
Short name:
CCK-BR
Alternative name(s):
Cholecystokinin-2 receptor
Short name:
CCK2-R
Gene namesi
Name:CCKBR
Synonyms:CCKRB
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:1571. CCKBR.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 57ExtracellularSequence analysisAdd BLAST57
Transmembranei58 – 79Helical; Name=1Sequence analysisAdd BLAST22
Topological domaini80 – 87CytoplasmicSequence analysis8
Transmembranei88 – 109Helical; Name=2Sequence analysisAdd BLAST22
Topological domaini110 – 131ExtracellularSequence analysisAdd BLAST22
Transmembranei132 – 150Helical; Name=3Sequence analysisAdd BLAST19
Topological domaini151 – 170CytoplasmicSequence analysisAdd BLAST20
Transmembranei171 – 189Helical; Name=4Sequence analysisAdd BLAST19
Topological domaini190 – 219ExtracellularSequence analysisAdd BLAST30
Transmembranei220 – 242Helical; Name=5Sequence analysisAdd BLAST23
Topological domaini243 – 333CytoplasmicSequence analysisAdd BLAST91
Transmembranei334 – 355Helical; Name=6Sequence analysisAdd BLAST22
Topological domaini356 – 373ExtracellularSequence analysisAdd BLAST18
Transmembranei374 – 394Helical; Name=7Sequence analysisAdd BLAST21
Topological domaini395 – 447CytoplasmicSequence analysisAdd BLAST53

GO - Cellular componenti

  • integral component of plasma membrane Source: UniProtKB
  • plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi887.
OpenTargetsiENSG00000110148.
PharmGKBiPA26143.

Chemistry databases

ChEMBLiCHEMBL298.
DrugBankiDB00183. Pentagastrin.
GuidetoPHARMACOLOGYi77.

Polymorphism and mutation databases

BioMutaiCCKBR.
DMDMi417029.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000694741 – 447Gastrin/cholecystokinin type B receptorAdd BLAST447

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi7N-linked (GlcNAc...)Sequence analysis1
Glycosylationi30N-linked (GlcNAc...)Sequence analysis1
Glycosylationi36N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi127 ↔ 205PROSITE-ProRule annotation
Lipidationi408S-palmitoyl cysteineBy similarity1

Keywords - PTMi

Disulfide bond, Glycoprotein, Lipoprotein, Palmitate

Proteomic databases

PaxDbiP32239.
PeptideAtlasiP32239.
PRIDEiP32239.

PTM databases

iPTMnetiP32239.
PhosphoSitePlusiP32239.

Expressioni

Tissue specificityi

Isoform 1 is expressed in brain, pancreas, stomach, the colon cancer cell line LoVo and the T-lymphoblastoma Jurkat, but not in heart, placenta, liver, lung, skeletal muscle, kidney or the stomach cancer cell line AGS. Expressed at high levels in the small cell lung cancer cell line NCI-H510, at lower levels in NCI-H345, NCI-H69 and GLC-28 cell lines, not expressed in GLC-19 cell line. Within the stomach, expressed at high levels in the mucosa of the gastric fundus and at low levels in the antrum and duodenum. Isoform 2 is present in pancreatic cancer cells and colorectal cancer cells, but not in normal pancreas or colonic mucosa. Isoform 3 is expressed in brain, pancreas, stomach, the stomach cancer cell line AGS and the colon cancer cell line LoVo.6 Publications

Gene expression databases

BgeeiENSG00000110148.
CleanExiHS_CCKBR.
ExpressionAtlasiP32239. baseline and differential.
GenevisibleiP32239. HS.

Organism-specific databases

HPAiHPA041976.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
CCKP063072EBI-1753137,EBI-6624436
NTMQ9P1213EBI-1753137,EBI-4315078
PTPN11Q061245EBI-1753137,EBI-297779

GO - Molecular functioni

  • type B gastrin/cholecystokinin receptor binding Source: NTNU_SB

Protein-protein interaction databases

BioGridi107329. 11 interactors.
DIPiDIP-229N.
IntActiP32239. 12 interactors.
MINTiMINT-3013054.
STRINGi9606.ENSP00000335544.

Chemistry databases

BindingDBiP32239.

Structurei

Secondary structure

1447
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi353 – 358Combined sources6
Helixi363 – 368Combined sources6
Helixi372 – 378Combined sources7

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1L4TNMR-A352-379[»]
ProteinModelPortaliP32239.
SMRiP32239.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP32239.

Family & Domainsi

Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3656. Eukaryota.
ENOG410XRW9. LUCA.
GeneTreeiENSGT00860000133695.
HOVERGENiHBG036927.
InParanoidiP32239.
KOiK04195.
OMAiQCVHRWP.
OrthoDBiEOG091G084J.
PhylomeDBiP32239.
TreeFamiTF315303.

Family and domain databases

InterProiIPR009126. Cholcskin_rcpt.
IPR000314. Gastrin_rcpt.
IPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
[Graphical view]
PfamiPF00001. 7tm_1. 1 hit.
[Graphical view]
PRINTSiPR01822. CCYSTOKININR.
PR00527. GASTRINR.
PR00237. GPCRRHODOPSN.
PROSITEiPS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P32239-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MELLKLNRSV QGTGPGPGAS LCRPGAPLLN SSSVGNLSCE PPRIRGAGTR
60 70 80 90 100
ELELAIRITL YAVIFLMSVG GNMLIIVVLG LSRRLRTVTN AFLLSLAVSD
110 120 130 140 150
LLLAVACMPF TLLPNLMGTF IFGTVICKAV SYLMGVSVSV STLSLVAIAL
160 170 180 190 200
ERYSAICRPL QARVWQTRSH AARVIVATWL LSGLLMVPYP VYTVVQPVGP
210 220 230 240 250
RVLQCVHRWP SARVRQTWSV LLLLLLFFIP GVVMAVAYGL ISRELYLGLR
260 270 280 290 300
FDGDSDSDSQ SRVRNQGGLP GAVHQNGRCR PETGAVGEDS DGCYVQLPRS
310 320 330 340 350
RPALELTALT APGPGSGSRP TQAKLLAKKR VVRMLLVIVV LFFLCWLPVY
360 370 380 390 400
SANTWRAFDG PGAHRALSGA PISFIHLLSY ASACVNPLVY CFMHRRFRQA
410 420 430 440
CLETCARCCP RPPRARPRAL PDEDPPTPSI ASLSRLSYTT ISTLGPG
Length:447
Mass (Da):48,419
Last modified:October 1, 1993 - v1
Checksum:iBAEEFAD4C1F85915
GO
Isoform 2 (identifier: P32239-2) [UniParc]FASTAAdd to basket
Also known as: CCK-C, CCK-BRi4sv

The sequence of this isoform differs from the canonical sequence as follows:
     271-271: G → GGAGPREQNLGEAELWRATGPAGVGGTEMKVRVRRKLEMELSWERRSGGDWAGDWGDSPFSLTAHPLCSG

Show »
Length:516
Mass (Da):55,869
Checksum:i9B27DDCAE3A67CC7
GO
Isoform 3 (identifier: P32239-3) [UniParc]FASTAAdd to basket
Also known as: DeltaCCK-B

The sequence of this isoform differs from the canonical sequence as follows:
     1-66: Missing.

Show »
Length:381
Mass (Da):41,504
Checksum:i2DF92F7D8A27773B
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti64I → T in AAF67174 (PubMed:10913157).Curated1
Sequence conflicti93L → F in AAC27510 (PubMed:9872672).Curated1
Sequence conflicti96L → M in AAC27510 (PubMed:9872672).Curated1
Sequence conflicti116L → I in AAC27510 (PubMed:9872672).Curated1
Sequence conflicti171A → P in AAA91831 (Ref. 11) Curated1
Sequence conflicti227F → S in BAF84753 (PubMed:14702039).Curated1
Sequence conflicti249L → V in AAA91831 (Ref. 11) Curated1
Sequence conflicti288E → K in AAB30766 (PubMed:8185170).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01468437L → F.Corresponds to variant rs1805000dbSNPEnsembl.1
Natural variantiVAR_04938877V → G.Corresponds to variant rs35816985dbSNPEnsembl.1
Natural variantiVAR_014685125V → I.Corresponds to variant rs1805002dbSNPEnsembl.1
Natural variantiVAR_014686215R → H.Corresponds to variant rs1805004dbSNPEnsembl.1
Natural variantiVAR_014687319R → Q.Corresponds to variant rs1805001dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0334441 – 66Missing in isoform 3. 1 PublicationAdd BLAST66
Alternative sequenceiVSP_033445271G → GGAGPREQNLGEAELWRATG PAGVGGTEMKVRVRRKLEME LSWERRSGGDWAGDWGDSPF SLTAHPLCSG in isoform 2. 3 Publications1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L04473 mRNA. Translation: AAA35660.1.
L08112 mRNA. Translation: AAA35657.1.
D13305 mRNA. Translation: BAA02564.1.
L10822 Genomic DNA. Translation: AAC37528.1.
S70057 mRNA. Translation: AAB30766.2.
D21219 Genomic DNA. Translation: BAA04759.2.
AF239668 mRNA. Translation: AAF67174.1.
AY029770 mRNA. Translation: AAK38351.1.
AF441129 mRNA. Translation: AAN32829.1.
L07746 mRNA. Translation: AAA91831.1.
AK292064 mRNA. Translation: BAF84753.1.
AY322551 mRNA. Translation: AAP84364.1.
BT006789 mRNA. Translation: AAP35435.1.
BC000740 mRNA. Translation: AAH00740.1.
AH006311 Genomic DNA. Translation: AAC27510.1.
CCDSiCCDS7761.1. [P32239-1]
PIRiA47430.
I65231.
RefSeqiNP_001304958.1. NM_001318029.1.
NP_795344.1. NM_176875.3. [P32239-1]
XP_005253267.1. XM_005253210.1. [P32239-2]
XP_016874005.1. XM_017018516.1. [P32239-3]
UniGeneiHs.203.

Genome annotation databases

EnsembliENST00000334619; ENSP00000335544; ENSG00000110148. [P32239-1]
ENST00000525462; ENSP00000435534; ENSG00000110148. [P32239-2]
GeneIDi887.
KEGGihsa:887.
UCSCiuc001mcp.4. human. [P32239-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Wikipedia

Cholecystokinin receptor entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L04473 mRNA. Translation: AAA35660.1.
L08112 mRNA. Translation: AAA35657.1.
D13305 mRNA. Translation: BAA02564.1.
L10822 Genomic DNA. Translation: AAC37528.1.
S70057 mRNA. Translation: AAB30766.2.
D21219 Genomic DNA. Translation: BAA04759.2.
AF239668 mRNA. Translation: AAF67174.1.
AY029770 mRNA. Translation: AAK38351.1.
AF441129 mRNA. Translation: AAN32829.1.
L07746 mRNA. Translation: AAA91831.1.
AK292064 mRNA. Translation: BAF84753.1.
AY322551 mRNA. Translation: AAP84364.1.
BT006789 mRNA. Translation: AAP35435.1.
BC000740 mRNA. Translation: AAH00740.1.
AH006311 Genomic DNA. Translation: AAC27510.1.
CCDSiCCDS7761.1. [P32239-1]
PIRiA47430.
I65231.
RefSeqiNP_001304958.1. NM_001318029.1.
NP_795344.1. NM_176875.3. [P32239-1]
XP_005253267.1. XM_005253210.1. [P32239-2]
XP_016874005.1. XM_017018516.1. [P32239-3]
UniGeneiHs.203.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1L4TNMR-A352-379[»]
ProteinModelPortaliP32239.
SMRiP32239.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107329. 11 interactors.
DIPiDIP-229N.
IntActiP32239. 12 interactors.
MINTiMINT-3013054.
STRINGi9606.ENSP00000335544.

Chemistry databases

BindingDBiP32239.
ChEMBLiCHEMBL298.
DrugBankiDB00183. Pentagastrin.
GuidetoPHARMACOLOGYi77.

Protein family/group databases

GPCRDBiSearch...

PTM databases

iPTMnetiP32239.
PhosphoSitePlusiP32239.

Polymorphism and mutation databases

BioMutaiCCKBR.
DMDMi417029.

Proteomic databases

PaxDbiP32239.
PeptideAtlasiP32239.
PRIDEiP32239.

Protocols and materials databases

DNASUi887.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000334619; ENSP00000335544; ENSG00000110148. [P32239-1]
ENST00000525462; ENSP00000435534; ENSG00000110148. [P32239-2]
GeneIDi887.
KEGGihsa:887.
UCSCiuc001mcp.4. human. [P32239-1]

Organism-specific databases

CTDi887.
DisGeNETi887.
GeneCardsiCCKBR.
HGNCiHGNC:1571. CCKBR.
HPAiHPA041976.
MIMi118445. gene.
neXtProtiNX_P32239.
OpenTargetsiENSG00000110148.
PharmGKBiPA26143.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3656. Eukaryota.
ENOG410XRW9. LUCA.
GeneTreeiENSGT00860000133695.
HOVERGENiHBG036927.
InParanoidiP32239.
KOiK04195.
OMAiQCVHRWP.
OrthoDBiEOG091G084J.
PhylomeDBiP32239.
TreeFamiTF315303.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000110148-MONOMER.
ReactomeiR-HSA-375276. Peptide ligand-binding receptors.
R-HSA-416476. G alpha (q) signalling events.
R-HSA-881907. Gastrin-CREB signalling pathway via PKC and MAPK.
SignaLinkiP32239.
SIGNORiP32239.

Miscellaneous databases

EvolutionaryTraceiP32239.
GeneWikiiCholecystokinin_B_receptor.
GenomeRNAii887.
PROiP32239.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000110148.
CleanExiHS_CCKBR.
ExpressionAtlasiP32239. baseline and differential.
GenevisibleiP32239. HS.

Family and domain databases

InterProiIPR009126. Cholcskin_rcpt.
IPR000314. Gastrin_rcpt.
IPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
[Graphical view]
PfamiPF00001. 7tm_1. 1 hit.
[Graphical view]
PRINTSiPR01822. CCYSTOKININR.
PR00527. GASTRINR.
PR00237. GPCRRHODOPSN.
PROSITEiPS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiGASR_HUMAN
AccessioniPrimary (citable) accession number: P32239
Secondary accession number(s): A8K7P9
, O75824, Q16144, Q92492, Q96LC6, Q9NYK7, Q9UBV1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1993
Last sequence update: October 1, 1993
Last modified: November 30, 2016
This is version 171 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.