Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P32239

- GASR_HUMAN

UniProt

P32239 - GASR_HUMAN

Protein

Gastrin/cholecystokinin type B receptor

Gene

CCKBR

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 151 (01 Oct 2014)
      Sequence version 1 (01 Oct 1993)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Receptor for gastrin and cholecystokinin. The CKK-B receptors occur throughout the central nervous system where they modulate anxiety, analgesia, arousal, and neuroleptic activity. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
    Isoform 2 is constitutively activated and may regulate cancer cell proliferation via a gastrin-independent mechanism.

    GO - Molecular functioni

    1. 1-phosphatidylinositol-3-kinase regulator activity Source: ProtInc
    2. cholecystokinin receptor activity Source: ProtInc
    3. gastrin receptor activity Source: UniProtKB
    4. phosphatidylinositol phospholipase C activity Source: ProtInc
    5. protein binding Source: IntAct
    6. type B gastrin/cholecystokinin receptor binding Source: NTNU_SB

    GO - Biological processi

    1. cell proliferation Source: ProtInc
    2. cell surface receptor signaling pathway Source: UniProtKB
    3. cholecystokinin signaling pathway Source: GOC
    4. digestion Source: ProtInc
    5. digestive tract development Source: Ensembl
    6. feeding behavior Source: ProtInc
    7. gastric acid secretion Source: Ensembl
    8. gland development Source: Ensembl
    9. metabolic process Source: GOC
    10. phospholipase C-activating G-protein coupled receptor signaling pathway Source: ProtInc
    11. positive regulation of cell proliferation Source: UniProtKB
    12. positive regulation of cytosolic calcium ion concentration Source: UniProtKB
    13. regulation of phosphatidylinositol 3-kinase activity Source: GOC
    14. sensory perception Source: ProtInc

    Keywords - Molecular functioni

    G-protein coupled receptor, Receptor, Transducer

    Enzyme and pathway databases

    ReactomeiREACT_120966. Gastrin-CREB signalling pathway via PKC and MAPK.
    REACT_14819. Peptide ligand-binding receptors.
    REACT_18283. G alpha (q) signalling events.
    SignaLinkiP32239.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Gastrin/cholecystokinin type B receptor
    Short name:
    CCK-B receptor
    Short name:
    CCK-BR
    Alternative name(s):
    Cholecystokinin-2 receptor
    Short name:
    CCK2-R
    Gene namesi
    Name:CCKBR
    Synonyms:CCKRB
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 11

    Organism-specific databases

    HGNCiHGNC:1571. CCKBR.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of plasma membrane Source: UniProtKB
    2. plasma membrane Source: Reactome

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA26143.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 447447Gastrin/cholecystokinin type B receptorPRO_0000069474Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi7 – 71N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi30 – 301N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi36 – 361N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi127 ↔ 205PROSITE-ProRule annotation
    Lipidationi408 – 4081S-palmitoyl cysteineBy similarity

    Keywords - PTMi

    Disulfide bond, Glycoprotein, Lipoprotein, Palmitate

    Proteomic databases

    PaxDbiP32239.
    PRIDEiP32239.

    PTM databases

    PhosphoSiteiP32239.

    Expressioni

    Tissue specificityi

    Isoform 1 is expressed in brain, pancreas, stomach, the colon cancer cell line LoVo and the T-lymphoblastoma Jurkat, but not in heart, placenta, liver, lung, skeletal muscle, kidney or the stomach cancer cell line AGS. Expressed at high levels in the small cell lung cancer cell line NCI-H510, at lower levels in NCI-H345, NCI-H69 and GLC-28 cell lines, not expressed in GLC-19 cell line. Within the stomach, expressed at high levels in the mucosa of the gastric fundus and at low levels in the antrum and duodenum. Isoform 2 is present in pancreatic cancer cells and colorectal cancer cells, but not in normal pancreas or colonic mucosa. Isoform 3 is expressed in brain, pancreas, stomach, the stomach cancer cell line AGS and the colon cancer cell line LoVo.6 Publications

    Gene expression databases

    ArrayExpressiP32239.
    BgeeiP32239.
    CleanExiHS_CCKBR.
    GenevestigatoriP32239.

    Organism-specific databases

    HPAiHPA041976.

    Interactioni

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    PTPN11Q061245EBI-1753137,EBI-297779

    Protein-protein interaction databases

    BioGridi107329. 3 interactions.
    DIPiDIP-229N.
    IntActiP32239. 10 interactions.
    MINTiMINT-3013054.
    STRINGi9606.ENSP00000335544.

    Structurei

    Secondary structure

    1
    447
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi353 – 3586
    Helixi363 – 3686
    Helixi372 – 3787

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1L4TNMR-A352-379[»]
    ProteinModelPortaliP32239.
    SMRiP32239. Positions 49-400.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiP32239.

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 5757ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini80 – 878CytoplasmicSequence Analysis
    Topological domaini110 – 13122ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini151 – 17020CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini190 – 21930ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini243 – 33391CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini356 – 37318ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini395 – 44753CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei58 – 7922Helical; Name=1Sequence AnalysisAdd
    BLAST
    Transmembranei88 – 10922Helical; Name=2Sequence AnalysisAdd
    BLAST
    Transmembranei132 – 15019Helical; Name=3Sequence AnalysisAdd
    BLAST
    Transmembranei171 – 18919Helical; Name=4Sequence AnalysisAdd
    BLAST
    Transmembranei220 – 24223Helical; Name=5Sequence AnalysisAdd
    BLAST
    Transmembranei334 – 35522Helical; Name=6Sequence AnalysisAdd
    BLAST
    Transmembranei374 – 39421Helical; Name=7Sequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG238659.
    HOVERGENiHBG036927.
    InParanoidiP32239.
    KOiK04195.
    OMAiRVRQTWS.
    OrthoDBiEOG7QVM36.
    PhylomeDBiP32239.
    TreeFamiTF315303.

    Family and domain databases

    Gene3Di1.20.1070.10. 2 hits.
    InterProiIPR009126. Cholcskin_rcpt.
    IPR000314. Gastrin_rcpt.
    IPR000276. GPCR_Rhodpsn.
    IPR017452. GPCR_Rhodpsn_7TM.
    [Graphical view]
    PfamiPF00001. 7tm_1. 1 hit.
    [Graphical view]
    PRINTSiPR01822. CCYSTOKININR.
    PR00527. GASTRINR.
    PR00237. GPCRRHODOPSN.
    PROSITEiPS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
    PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P32239-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MELLKLNRSV QGTGPGPGAS LCRPGAPLLN SSSVGNLSCE PPRIRGAGTR    50
    ELELAIRITL YAVIFLMSVG GNMLIIVVLG LSRRLRTVTN AFLLSLAVSD 100
    LLLAVACMPF TLLPNLMGTF IFGTVICKAV SYLMGVSVSV STLSLVAIAL 150
    ERYSAICRPL QARVWQTRSH AARVIVATWL LSGLLMVPYP VYTVVQPVGP 200
    RVLQCVHRWP SARVRQTWSV LLLLLLFFIP GVVMAVAYGL ISRELYLGLR 250
    FDGDSDSDSQ SRVRNQGGLP GAVHQNGRCR PETGAVGEDS DGCYVQLPRS 300
    RPALELTALT APGPGSGSRP TQAKLLAKKR VVRMLLVIVV LFFLCWLPVY 350
    SANTWRAFDG PGAHRALSGA PISFIHLLSY ASACVNPLVY CFMHRRFRQA 400
    CLETCARCCP RPPRARPRAL PDEDPPTPSI ASLSRLSYTT ISTLGPG 447
    Length:447
    Mass (Da):48,419
    Last modified:October 1, 1993 - v1
    Checksum:iBAEEFAD4C1F85915
    GO
    Isoform 2 (identifier: P32239-2) [UniParc]FASTAAdd to Basket

    Also known as: CCK-C, CCK-BRi4sv

    The sequence of this isoform differs from the canonical sequence as follows:
         271-271: G → GGAGPREQNLGEAELWRATGPAGVGGTEMKVRVRRKLEMELSWERRSGGDWAGDWGDSPFSLTAHPLCSG

    Show »
    Length:516
    Mass (Da):55,869
    Checksum:i9B27DDCAE3A67CC7
    GO
    Isoform 3 (identifier: P32239-3) [UniParc]FASTAAdd to Basket

    Also known as: DeltaCCK-B

    The sequence of this isoform differs from the canonical sequence as follows:
         1-66: Missing.

    Show »
    Length:381
    Mass (Da):41,504
    Checksum:i2DF92F7D8A27773B
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti64 – 641I → T in AAF67174. (PubMed:10913157)Curated
    Sequence conflicti93 – 931L → F in AAC27510. (PubMed:9872672)Curated
    Sequence conflicti96 – 961L → M in AAC27510. (PubMed:9872672)Curated
    Sequence conflicti116 – 1161L → I in AAC27510. (PubMed:9872672)Curated
    Sequence conflicti171 – 1711A → P in AAA91831. 1 PublicationCurated
    Sequence conflicti227 – 2271F → S in BAF84753. (PubMed:14702039)Curated
    Sequence conflicti249 – 2491L → V in AAA91831. 1 PublicationCurated
    Sequence conflicti288 – 2881E → K in AAB30766. (PubMed:8185170)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti37 – 371L → F.
    Corresponds to variant rs1805000 [ dbSNP | Ensembl ].
    VAR_014684
    Natural varianti77 – 771V → G.
    Corresponds to variant rs35816985 [ dbSNP | Ensembl ].
    VAR_049388
    Natural varianti125 – 1251V → I.
    Corresponds to variant rs1805002 [ dbSNP | Ensembl ].
    VAR_014685
    Natural varianti215 – 2151R → H.
    Corresponds to variant rs1805004 [ dbSNP | Ensembl ].
    VAR_014686
    Natural varianti319 – 3191R → Q.
    Corresponds to variant rs1805001 [ dbSNP | Ensembl ].
    VAR_014687

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 6666Missing in isoform 3. 1 PublicationVSP_033444Add
    BLAST
    Alternative sequencei271 – 2711G → GGAGPREQNLGEAELWRATG PAGVGGTEMKVRVRRKLEME LSWERRSGGDWAGDWGDSPF SLTAHPLCSG in isoform 2. 3 PublicationsVSP_033445

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L04473 mRNA. Translation: AAA35660.1.
    L08112 mRNA. Translation: AAA35657.1.
    D13305 mRNA. Translation: BAA02564.1.
    L10822 Genomic DNA. Translation: AAC37528.1.
    S70057 mRNA. Translation: AAB30766.2.
    D21219 Genomic DNA. Translation: BAA04759.2.
    AF239668 mRNA. Translation: AAF67174.1.
    AY029770 mRNA. Translation: AAK38351.1.
    AF441129 mRNA. Translation: AAN32829.1.
    L07746 mRNA. Translation: AAA91831.1.
    AK292064 mRNA. Translation: BAF84753.1.
    AY322551 mRNA. Translation: AAP84364.1.
    BT006789 mRNA. Translation: AAP35435.1.
    BC000740 mRNA. Translation: AAH00740.1.
    AH006311 Genomic DNA. Translation: AAC27510.1.
    CCDSiCCDS7761.1. [P32239-1]
    PIRiA47430.
    I65231.
    RefSeqiNP_795344.1. NM_176875.3. [P32239-1]
    XP_005253267.1. XM_005253210.1. [P32239-2]
    UniGeneiHs.203.

    Genome annotation databases

    EnsembliENST00000334619; ENSP00000335544; ENSG00000110148. [P32239-1]
    ENST00000525462; ENSP00000435534; ENSG00000110148. [P32239-2]
    GeneIDi887.
    KEGGihsa:887.
    UCSCiuc001mcp.3. human. [P32239-1]
    uc001mcs.3. human. [P32239-2]

    Polymorphism databases

    DMDMi417029.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    Wikipedia

    Cholecystokinin receptor entry

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L04473 mRNA. Translation: AAA35660.1 .
    L08112 mRNA. Translation: AAA35657.1 .
    D13305 mRNA. Translation: BAA02564.1 .
    L10822 Genomic DNA. Translation: AAC37528.1 .
    S70057 mRNA. Translation: AAB30766.2 .
    D21219 Genomic DNA. Translation: BAA04759.2 .
    AF239668 mRNA. Translation: AAF67174.1 .
    AY029770 mRNA. Translation: AAK38351.1 .
    AF441129 mRNA. Translation: AAN32829.1 .
    L07746 mRNA. Translation: AAA91831.1 .
    AK292064 mRNA. Translation: BAF84753.1 .
    AY322551 mRNA. Translation: AAP84364.1 .
    BT006789 mRNA. Translation: AAP35435.1 .
    BC000740 mRNA. Translation: AAH00740.1 .
    AH006311 Genomic DNA. Translation: AAC27510.1 .
    CCDSi CCDS7761.1. [P32239-1 ]
    PIRi A47430.
    I65231.
    RefSeqi NP_795344.1. NM_176875.3. [P32239-1 ]
    XP_005253267.1. XM_005253210.1. [P32239-2 ]
    UniGenei Hs.203.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1L4T NMR - A 352-379 [» ]
    ProteinModelPortali P32239.
    SMRi P32239. Positions 49-400.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 107329. 3 interactions.
    DIPi DIP-229N.
    IntActi P32239. 10 interactions.
    MINTi MINT-3013054.
    STRINGi 9606.ENSP00000335544.

    Chemistry

    BindingDBi P32239.
    ChEMBLi CHEMBL298.
    DrugBanki DB00183. Pentagastrin.
    GuidetoPHARMACOLOGYi 77.

    Protein family/group databases

    GPCRDBi Search...

    PTM databases

    PhosphoSitei P32239.

    Polymorphism databases

    DMDMi 417029.

    Proteomic databases

    PaxDbi P32239.
    PRIDEi P32239.

    Protocols and materials databases

    DNASUi 887.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000334619 ; ENSP00000335544 ; ENSG00000110148 . [P32239-1 ]
    ENST00000525462 ; ENSP00000435534 ; ENSG00000110148 . [P32239-2 ]
    GeneIDi 887.
    KEGGi hsa:887.
    UCSCi uc001mcp.3. human. [P32239-1 ]
    uc001mcs.3. human. [P32239-2 ]

    Organism-specific databases

    CTDi 887.
    GeneCardsi GC11P006280.
    HGNCi HGNC:1571. CCKBR.
    HPAi HPA041976.
    MIMi 118445. gene.
    neXtProti NX_P32239.
    PharmGKBi PA26143.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG238659.
    HOVERGENi HBG036927.
    InParanoidi P32239.
    KOi K04195.
    OMAi RVRQTWS.
    OrthoDBi EOG7QVM36.
    PhylomeDBi P32239.
    TreeFami TF315303.

    Enzyme and pathway databases

    Reactomei REACT_120966. Gastrin-CREB signalling pathway via PKC and MAPK.
    REACT_14819. Peptide ligand-binding receptors.
    REACT_18283. G alpha (q) signalling events.
    SignaLinki P32239.

    Miscellaneous databases

    EvolutionaryTracei P32239.
    GeneWikii Cholecystokinin_B_receptor.
    GenomeRNAii 887.
    NextBioi 3666.
    PROi P32239.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P32239.
    Bgeei P32239.
    CleanExi HS_CCKBR.
    Genevestigatori P32239.

    Family and domain databases

    Gene3Di 1.20.1070.10. 2 hits.
    InterProi IPR009126. Cholcskin_rcpt.
    IPR000314. Gastrin_rcpt.
    IPR000276. GPCR_Rhodpsn.
    IPR017452. GPCR_Rhodpsn_7TM.
    [Graphical view ]
    Pfami PF00001. 7tm_1. 1 hit.
    [Graphical view ]
    PRINTSi PR01822. CCYSTOKININR.
    PR00527. GASTRINR.
    PR00237. GPCRRHODOPSN.
    PROSITEi PS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
    PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Molecular cloning of the human brain and gastric cholecystokinin receptor: structure, functional expression and chromosomal localization."
      Pisegna J.R., de Weerth A., Huppi K., Wank S.A.
      Biochem. Biophys. Res. Commun. 189:296-303(1992) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Brain.
    2. "The human brain cholecystokinin-B/gastrin receptor. Cloning and characterization."
      Lee Y.-M., Beinborn M., McBride E.W., Lu M., Kolakowski L.F. Jr., Kopin A.S.
      J. Biol. Chem. 268:8164-8169(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Brain.
    3. "Functional characterization of a human brain cholecystokinin-B receptor. A trophic effect of cholecystokinin and gastrin."
      Ito M., Matsui T., Taniguchi T., Tsukamoto T., Murayama T., Arima N., Nakata H., Chiba T., Chihara K.
      J. Biol. Chem. 268:18300-18305(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY.
      Tissue: Brain.
    4. "The human gastrin/cholecystokinin type B receptor gene: alternative splice donor site in exon 4 generates two variant mRNAs."
      Song I., Brown D.R., Wiltshire R.N., Gantz I., Trent J.M., Yamada T.
      Proc. Natl. Acad. Sci. U.S.A. 90:9085-9089(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
      Tissue: Placenta.
    5. "Cholecystokinin stimulates Ca2+ mobilization and clonal growth in small cell lung cancer through CCKA and CCKB/gastrin receptors."
      Herget T., Sethi T., Wu S.V., Walsh J.H., Rozengurt E.
      Ann. N. Y. Acad. Sci. 713:283-297(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY.
      Tissue: Fetal brain.
    6. "Functional characterization of two cholecystokinin-B/gastrin receptor isoforms: a preferential splice donor site in the human receptor gene."
      Ito M., Iwata N., Taniguchi T., Murayama T., Chihara K., Matsui T.
      Cell Growth Differ. 5:1127-1135(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], FUNCTION, ALTERNATIVE SPLICING, TISSUE SPECIFICITY.
      Tissue: Lung fibroblast.
    7. "A truncated isoform of human CCK-B/gastrin receptor generated by alternative usage of a novel exon."
      Miyake A.
      Biochem. Biophys. Res. Commun. 208:230-237(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), TISSUE SPECIFICITY.
      Tissue: Stomach.
    8. "Human colorectal cancers express a constitutively active cholecystokinin-B/gastrin receptor that stimulates cell growth."
      Hellmich M.R., Rui X.-L., Hellmich H.L., Fleming R.Y.D., Evers B.M., Townsend C.M. Jr.
      J. Biol. Chem. 275:32122-32128(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION (ISOFORM 2), TISSUE SPECIFICITY.
      Tissue: Colon cancer.
    9. "Identification of CCK-B/gastrin receptor splice variants in human peripheral blood mononuclear cells."
      Schmitz F., Schrader H., Otte J.-M., Schmitz H., Stueber E., Herzig K.-H., Schmidt W.E.
      Regul. Pept. 101:25-33(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, ALTERNATIVE SPLICING.
      Tissue: Peripheral blood.
    10. "Characterization of the CCK-C (cancer) receptor in human pancreatic cancer."
      Smith J.P., Verderame M.F., McLaughlin P., Martenis M., Ballard E., Zagon I.S.
      Int. J. Mol. Med. 10:689-694(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY.
      Tissue: Pancreatic cancer.
    11. "Cloning and expression of the human temporal cortex cholecystokinin B receptor."
      Tate S.N., Gray J., Denyer J., Stolz M., Foord S., Lee M.G.
      Submitted (MAR-1996) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA].
      Tissue: Temporal cortex.
    12. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Stomach.
    13. "cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org)."
      Kopatz S.A., Aronstam R.S., Sharma S.V.
      Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    14. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
      Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
      Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    15. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Placenta.
    16. "An 84-kilobase physical map and repeat polymorphisms of the gastrin/cholecystokinin brain receptor region at the junction of chromosome segments 11p15.4 and 15.5."
      O'Briant K.C., Ali S.Y., Weier H.-U.G., Bepler G.
      Chromosome Res. 6:415-418(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 52-447.
    17. "CCKA and CCKB receptors are expressed in small cell lung cancer lines and mediate Ca2+ mobilization and clonal growth."
      Sethi T., Herget T., Wu S.V., Walsh J.H., Rozengurt E.
      Cancer Res. 53:5208-5213(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 244-333 (ISOFORMS 1/3), FUNCTION.
      Tissue: Fetal brain.
    18. "Localization of the human cholecystokinin-B/gastrin receptor gene (CCKBR) to chromosome 11p15.5-->p15.4 by fluorescence in situ hybridization."
      Zimonjic D.B., Popescu N.C., Matsui T., Ito M., Chihara K.
      Cytogenet. Cell Genet. 65:184-185(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: CHROMOSOMAL LOCATION.
    19. "Intermolecular interactions between cholecystokinin-8 and the third extracellular loop of the cholecystokinin-2 receptor."
      Giragossian C., Mierke D.F.
      Biochemistry 41:4560-4566(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: STRUCTURE BY NMR OF 352-379.

    Entry informationi

    Entry nameiGASR_HUMAN
    AccessioniPrimary (citable) accession number: P32239
    Secondary accession number(s): A8K7P9
    , O75824, Q16144, Q92492, Q96LC6, Q9NYK7, Q9UBV1
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 1, 1993
    Last sequence update: October 1, 1993
    Last modified: October 1, 2014
    This is version 151 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. 7-transmembrane G-linked receptors
      List of 7-transmembrane G-linked receptor entries
    2. Human chromosome 11
      Human chromosome 11: entries, gene names and cross-references to MIM
    3. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    4. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    5. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    6. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    7. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3