P31995 (FCG2C_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 121.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Low affinity immunoglobulin gamma Fc region receptor II-c Short name=IgG Fc receptor II-c Alternative name(s): CDw32 Fc-gamma RII-c Short name=Fc-gamma-RIIc Short name=FcRII-c CD_antigen=CD32 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 323 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells. |
| Subcellular location | Isoform IIC4: Cytoplasm Probable. Isoform IIC3: Cell membrane; Single-pass type I membrane protein. Isoform IIC2: Cell membrane; Single-pass type I membrane protein. Isoform IIC1: Cell membrane; Single-pass type I membrane protein. |
| Tissue specificity | Isoform IIC1 is detected in monocytes, macrophages, polymorphonuclear cells and natural killer cells. |
| Domain | Contains an intracytoplasmic twice repeated motif referred as immunoreceptor tyrosine-based activator motif (ITAM). These motifs are involved in triggering cell activation upon receptors aggregation. |
| Post-translational modification | Phosphorylated by SRC-type Tyr-kinases such as LYN, BLK, FYN and SYK. Ref.3 |
| Sequence similarities | Contains 2 Ig-like C2-type (immunoglobulin-like) domains. |
| Caution | Has sometimes been attributed to correspond to FcR-IIB. |
| Sequence caution | The sequence CAA35643.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Cytoplasm Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Immunoglobulin domain Repeat Signal Transmembrane Transmembrane helix |
| Ligand | IgG-binding protein |
| Molecular function | Receptor |
| PTM | Disulfide bond Glycoprotein Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | immune response Non-traceable author statement Ref.1. Source: UniProtKB |
| Cellular_component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell integral to membraneNon-traceable author statement Ref.1. Source: UniProtKB plasma membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | transmembrane signaling receptor activity Non-traceable author statement Ref.1. Source: UniProtKB |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| CRP | P02741 | 2 | EBI-1396036,EBI-1395983 | |
| NCK1 | P16333 | 2 | EBI-1396036,EBI-389883 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform IIC1 (identifier: P31995-1) Also known as: C1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform IIC2 (identifier: P31995-2) The sequence of this isoform differs from the canonical sequence as follows: 267-323: PPGRQMIAIRKRQPEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN → MLSCSHLDVK | ||||||
| Isoform IIC3 (identifier: P31995-3) The sequence of this isoform differs from the canonical sequence as follows: 255-323: NSTDPVKAAQ...PPNDHVNSNN → TWTSNDCHQKETT | ||||||
| Isoform IIC4 (identifier: P31995-4) The sequence of this isoform differs from the canonical sequence as follows: 216-323: APSSSPMGII...PPNDHVNSNN → GPRLRTAAKQSSLVGAEVP |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 42 | 42 | Potential | ||||||||
| Chain | 43 – 323 | 281 | Low affinity immunoglobulin gamma Fc region receptor II-c | PRO_0000015148 | |||||||
Regions | |||||||||||
| Topological domain | 43 – 223 | 181 | Extracellular Potential | ||||||||
| Transmembrane | 224 – 246 | 23 | Helical; Potential | ||||||||
| Topological domain | 247 – 323 | 77 | Cytoplasmic Potential | ||||||||
| Domain | 48 – 127 | 80 | Ig-like C2-type 1 | ||||||||
| Domain | 131 – 213 | 83 | Ig-like C2-type 2 | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 294 | 1 | Phosphotyrosine; by SRC-type Tyr-kinases Ref.3 | ||||||||
| Modified residue | 310 | 1 | Phosphotyrosine; by SRC-type Tyr-kinases Ref.3 | ||||||||
| Glycosylation | 106 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 180 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 187 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 71 ↔ 113 | By similarity | |||||||||
| Disulfide bond | 152 ↔ 196 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 216 – 323 | 108 | APSSS…VNSNN → GPRLRTAAKQSSLVGAEVP in isoform IIC4. | VSP_002644 | |||||||
| Alternative sequence | 255 – 323 | 69 | NSTDP…VNSNN → TWTSNDCHQKETT in isoform IIC3. | VSP_002645 | |||||||
| Alternative sequence | 267 – 323 | 57 | PPGRQ…VNSNN → MLSCSHLDVK in isoform IIC2. | VSP_002646 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 151 | 1 | R → K in AAC12810. Ref.2 | ||||||||
| Sequence conflict | 164 | 1 | T → I in AAC12809. Ref.2 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| [1] | "Human IgG Fc receptor (hFcRII; CD32) exists as multiple isoforms in macrophages, lymphocytes and IgG-transporting placental epithelium." Stuart S.G., Simister N.E., Clarkson S.B., Kacinski B.M., Shapiro M., Mellman I. EMBO J. 8:3657-3666(1989) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM IIC1). Tissue: Placenta. |
| [2] | "Expression of functional CD32 molecules on human NK cells is determined by an allelic polymorphism of the FcgammaRIIC gene." Metes D., Ernst L.K., Chambers W.H., Sulica A., Herberman R.B., Morel P.A. Blood 91:2369-2380(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS IIC1; IIC2; IIC3 AND IIC4). Tissue: Natural killer cell. |
| [3] | "In vivo and in vitro specificity of protein tyrosine kinases for immunoglobulin G receptor (FcgammaRII) phosphorylation." Bewarder N., Weinrich V., Budde P., Hartmann D., Flaswinkel H., Reth M., Frey J. Mol. Cell. Biol. 16:4735-4743(1996) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT TYR-294 AND TYR-310. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X17652 mRNA. Translation: CAA35642.1. X17652 mRNA. Translation: CAA35643.1. Different initiation. U90938 mRNA. Translation: AAC12807.1. U90939 mRNA. Translation: AAC12808.1. U90940 mRNA. Translation: AAC12809.1. U90941 mRNA. Translation: AAC12810.1. |
| IPI | IPI00013971. IPI00215903. IPI00215904. IPI00215905. |
| PIR | S06946. |
| UniGene | Hs.656750. |
3D structure databases | |
| ProteinModelPortal | P31995. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P31995. 7 interactions. |
| MINT | MINT-7241761. |
| STRING | 9606.ENSP00000420811. |
PTM databases | |
| PhosphoSite | P31995. |
Polymorphism databases | |
| DMDM | 399478. |
Proteomic databases | |
| PRIDE | P31995. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| UCSC | uc009wum.2. human. |
Organism-specific databases | |
| GeneCards | GC01P161551. |
| H-InvDB | HIX0056771. |
| HGNC | HGNC:15626. FCGR2C. |
| MIM | 612169. gene. |
| neXtProt | NX_P31995. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | HBG051602. |
Gene expression databases | |
| CleanEx | HS_FCGR2C. |
| Genevestigator | P31995. |
| GermOnline | ENSG00000203746. Homo sapiens. |
Family and domain databases | |
| Gene3D | 2.60.40.10. 2 hits. |
| InterPro | IPR007110. Ig-like_dom. IPR013783. Ig-like_fold. IPR003599. Ig_sub. [Graphical view] |
| SMART | SM00409. IG. 2 hits. [Graphical view] |
| PROSITE | PS50835. IG_LIKE. 2 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| DrugBank | DB00054. Abciximab. DB00051. Adalimumab. DB00092. Alefacept. DB00087. Alemtuzumab. DB00074. Basiliximab. DB00112. Bevacizumab. DB00002. Cetuximab. DB00111. Daclizumab. DB00095. Efalizumab. DB00005. Etanercept. DB00056. Gemtuzumab ozogamicin. DB00078. Ibritumomab. DB00028. Immune globulin. DB00075. Muromonab. DB00108. Natalizumab. DB00110. Palivizumab. DB00073. Rituximab. DB00081. Tositumomab. DB00072. Trastuzumab. |
| SOURCE | Search... |
Entry information
| Entry name | FCG2C_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P31995 Secondary accession number(s): O00523, O00524, O00525 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human cell differentiation molecules CD nomenclature of surface proteins of human leucocytes and list of entries |
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
