Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Low affinity immunoglobulin gamma Fc region receptor II-c

Gene

FCGR2C

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells.

GO - Molecular functioni

  • transmembrane signaling receptor activity Source: UniProtKB

GO - Biological processi

  • immune response Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Ligandi

IgG-binding protein

Enzyme and pathway databases

BioCyciZFISH:ENSG00000072694-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Low affinity immunoglobulin gamma Fc region receptor II-c
Short name:
IgG Fc receptor II-c
Alternative name(s):
CDw32
Fc-gamma RII-c
Short name:
Fc-gamma-RIIc
Short name:
FcRII-c
CD_antigen: CD32
Gene namesi
Name:FCGR2C
Synonyms:CD32, FCG2, IGFR2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Unplaced

Organism-specific databases

HGNCiHGNC:15626. FCGR2C.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini43 – 223ExtracellularSequence analysisAdd BLAST181
Transmembranei224 – 246HelicalSequence analysisAdd BLAST23
Topological domaini247 – 323CytoplasmicSequence analysisAdd BLAST77

GO - Cellular componenti

  • cytoplasm Source: UniProtKB-SubCell
  • integral component of membrane Source: UniProtKB
  • plasma membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi9103.
MalaCardsiFCGR2C.

Chemistry databases

DrugBankiDB00054. Abciximab.
DB00051. Adalimumab.
DB00092. Alefacept.
DB00087. Alemtuzumab.
DB00074. Basiliximab.
DB00112. Bevacizumab.
DB00002. Cetuximab.
DB00111. Daclizumab.
DB00095. Efalizumab.
DB00005. Etanercept.
DB00056. Gemtuzumab ozogamicin.
DB00078. Ibritumomab.
DB00028. Intravenous Immunoglobulin.
DB00075. Muromonab.
DB00108. Natalizumab.
DB00110. Palivizumab.
DB00073. Rituximab.
DB00081. Tositumomab.
DB00072. Trastuzumab.

Polymorphism and mutation databases

DMDMi399478.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 42Sequence analysisAdd BLAST42
ChainiPRO_000001514843 – 323Low affinity immunoglobulin gamma Fc region receptor II-cAdd BLAST281

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi71 ↔ 113PROSITE-ProRule annotation1 Publication
Glycosylationi106N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi152 ↔ 196PROSITE-ProRule annotation1 Publication
Glycosylationi180N-linked (GlcNAc...)Sequence analysis1
Glycosylationi187N-linked (GlcNAc...)1 Publication1
Modified residuei294Phosphotyrosine; by SRC-type Tyr-kinases1 Publication1
Modified residuei310Phosphotyrosine; by SRC-type Tyr-kinases1 Publication1

Post-translational modificationi

Phosphorylated by SRC-type Tyr-kinases such as LYN, BLK, FYN and SYK.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiP31995.
PaxDbiP31995.
PeptideAtlasiP31995.
PRIDEiP31995.
TopDownProteomicsiP31995-4. [P31995-4]

PTM databases

iPTMnetiP31995.
PhosphoSitePlusiP31995.

Expressioni

Tissue specificityi

Isoform IIC1 is detected in monocytes, macrophages, polymorphonuclear cells and natural killer cells.

Gene expression databases

CleanExiHS_FCGR2C.

Organism-specific databases

HPAiHPA010718.
HPA014730.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
CRPP027412EBI-1396036,EBI-1395983
NCK1P163332EBI-1396036,EBI-389883

Protein-protein interaction databases

BioGridi114556. 2 interactors.
IntActiP31995. 7 interactors.
MINTiMINT-7241761.
STRINGi9606.ENSP00000351497.

Structurei

Secondary structure

1323
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi51 – 53Combined sources3
Beta strandi59 – 62Combined sources4
Beta strandi66 – 72Combined sources7
Beta strandi83 – 86Combined sources4
Beta strandi89 – 91Combined sources3
Beta strandi96 – 102Combined sources7
Helixi105 – 107Combined sources3
Beta strandi109 – 114Combined sources6
Beta strandi116 – 119Combined sources4
Beta strandi124 – 129Combined sources6
Beta strandi131 – 136Combined sources6
Beta strandi140 – 143Combined sources4
Beta strandi148 – 154Combined sources7
Helixi155 – 157Combined sources3
Beta strandi161 – 167Combined sources7
Beta strandi170 – 177Combined sources8
Beta strandi180 – 185Combined sources6
Helixi188 – 190Combined sources3
Beta strandi192 – 200Combined sources9
Beta strandi203 – 206Combined sources4
Beta strandi210 – 215Combined sources6

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3WJLX-ray2.86C45-217[»]
ProteinModelPortaliP31995.
SMRiP31995.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini48 – 127Ig-like C2-type 1Add BLAST80
Domaini131 – 213Ig-like C2-type 2Add BLAST83

Domaini

Contains an intracytoplasmic twice repeated motif referred as immunoreceptor tyrosine-based activator motif (ITAM). These motifs are involved in triggering cell activation upon receptors aggregation.

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410J9AP. Eukaryota.
ENOG410YXNK. LUCA.
HOVERGENiHBG051602.
InParanoidiP31995.
KOiK16824.
PhylomeDBiP31995.

Family and domain databases

Gene3Di2.60.40.10. 2 hits.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
[Graphical view]
PfamiPF13895. Ig_2. 2 hits.
[Graphical view]
SMARTiSM00409. IG. 2 hits.
SM00408. IGc2. 2 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 2 hits.
PROSITEiPS50835. IG_LIKE. 2 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform IIC1 (identifier: P31995-1) [UniParc]FASTAAdd to basket
Also known as: C1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGILSFLPVL ATESDWADCK SPQPWGHMLL WTAVLFLAPV AGTPAAPPKA
60 70 80 90 100
VLKLEPQWIN VLQEDSVTLT CRGTHSPESD SIQWFHNGNL IPTHTQPSYR
110 120 130 140 150
FKANNNDSGE YTCQTGQTSL SDPVHLTVLS EWLVLQTPHL EFQEGETIVL
160 170 180 190 200
RCHSWKDKPL VKVTFFQNGK SKKFSRSDPN FSIPQANHSH SGDYHCTGNI
210 220 230 240 250
GYTLYSSKPV TITVQAPSSS PMGIIVAVVT GIAVAAIVAA VVALIYCRKK
260 270 280 290 300
RISANSTDPV KAAQFEPPGR QMIAIRKRQP EETNNDYETA DGGYMTLNPR
310 320
APTDDDKNIY LTLPPNDHVN SNN
Length:323
Mass (Da):35,578
Last modified:July 1, 1993 - v1
Checksum:iDC4C1A22A0DE4572
GO
Isoform IIC2 (identifier: P31995-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     267-323: PPGRQMIAIRKRQPEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN → MLSCSHLDVK

Show »
Length:276
Mass (Da):30,241
Checksum:i395960C5B26197F5
GO
Isoform IIC3 (identifier: P31995-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     255-323: NSTDPVKAAQ...PPNDHVNSNN → TWTSNDCHQKETT

Show »
Length:267
Mass (Da):29,370
Checksum:iAD2C3AB385122162
GO
Isoform IIC4 (identifier: P31995-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     216-323: APSSSPMGII...PPNDHVNSNN → GPRLRTAAKQSSLVGAEVP

Show »
Length:234
Mass (Da):25,907
Checksum:iE593027A497A89B3
GO

Sequence cautioni

The sequence CAA35643 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti151R → K in AAC12810 (PubMed:9516136).Curated1
Sequence conflicti164T → I in AAC12809 (PubMed:9516136).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_002644216 – 323APSSS…VNSNN → GPRLRTAAKQSSLVGAEVP in isoform IIC4. 1 PublicationAdd BLAST108
Alternative sequenceiVSP_002645255 – 323NSTDP…VNSNN → TWTSNDCHQKETT in isoform IIC3. 1 PublicationAdd BLAST69
Alternative sequenceiVSP_002646267 – 323PPGRQ…VNSNN → MLSCSHLDVK in isoform IIC2. 1 PublicationAdd BLAST57

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X17652 mRNA. Translation: CAA35642.1.
X17652 mRNA. Translation: CAA35643.1. Different initiation.
U90938 mRNA. Translation: AAC12807.1.
U90939 mRNA. Translation: AAC12808.1.
U90940 mRNA. Translation: AAC12809.1.
U90941 mRNA. Translation: AAC12810.1.
PIRiS06946.
RefSeqiNP_963857.3. NM_201563.5.
XP_011507594.1. XM_011509292.2. [P31995-4]
UniGeneiHs.654395.
Hs.656750.

Genome annotation databases

GeneIDi2213.
9103.
KEGGihsa:9103.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X17652 mRNA. Translation: CAA35642.1.
X17652 mRNA. Translation: CAA35643.1. Different initiation.
U90938 mRNA. Translation: AAC12807.1.
U90939 mRNA. Translation: AAC12808.1.
U90940 mRNA. Translation: AAC12809.1.
U90941 mRNA. Translation: AAC12810.1.
PIRiS06946.
RefSeqiNP_963857.3. NM_201563.5.
XP_011507594.1. XM_011509292.2. [P31995-4]
UniGeneiHs.654395.
Hs.656750.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3WJLX-ray2.86C45-217[»]
ProteinModelPortaliP31995.
SMRiP31995.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114556. 2 interactors.
IntActiP31995. 7 interactors.
MINTiMINT-7241761.
STRINGi9606.ENSP00000351497.

Chemistry databases

DrugBankiDB00054. Abciximab.
DB00051. Adalimumab.
DB00092. Alefacept.
DB00087. Alemtuzumab.
DB00074. Basiliximab.
DB00112. Bevacizumab.
DB00002. Cetuximab.
DB00111. Daclizumab.
DB00095. Efalizumab.
DB00005. Etanercept.
DB00056. Gemtuzumab ozogamicin.
DB00078. Ibritumomab.
DB00028. Intravenous Immunoglobulin.
DB00075. Muromonab.
DB00108. Natalizumab.
DB00110. Palivizumab.
DB00073. Rituximab.
DB00081. Tositumomab.
DB00072. Trastuzumab.

PTM databases

iPTMnetiP31995.
PhosphoSitePlusiP31995.

Polymorphism and mutation databases

DMDMi399478.

Proteomic databases

MaxQBiP31995.
PaxDbiP31995.
PeptideAtlasiP31995.
PRIDEiP31995.
TopDownProteomicsiP31995-4. [P31995-4]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi2213.
9103.
KEGGihsa:9103.

Organism-specific databases

CTDi2213.
9103.
DisGeNETi9103.
GeneCardsiFCGR2C.
H-InvDBHIX0056771.
HGNCiHGNC:15626. FCGR2C.
HPAiHPA010718.
HPA014730.
MalaCardsiFCGR2C.
MIMi612169. gene.
neXtProtiNX_P31995.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410J9AP. Eukaryota.
ENOG410YXNK. LUCA.
HOVERGENiHBG051602.
InParanoidiP31995.
KOiK16824.
PhylomeDBiP31995.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000072694-MONOMER.

Miscellaneous databases

PROiP31995.
SOURCEiSearch...

Gene expression databases

CleanExiHS_FCGR2C.

Family and domain databases

Gene3Di2.60.40.10. 2 hits.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
[Graphical view]
PfamiPF13895. Ig_2. 2 hits.
[Graphical view]
SMARTiSM00409. IG. 2 hits.
SM00408. IGc2. 2 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 2 hits.
PROSITEiPS50835. IG_LIKE. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiFCG2C_HUMAN
AccessioniPrimary (citable) accession number: P31995
Secondary accession number(s): O00523, O00524, O00525
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 1, 1993
Last sequence update: July 1, 1993
Last modified: November 2, 2016
This is version 150 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

Has sometimes been attributed to correspond to FcR-IIB.Curated

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.