Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Low affinity immunoglobulin gamma Fc region receptor II-c

Gene

FCGR2C

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells.

GO - Molecular functioni

  • transmembrane signaling receptor activity Source: UniProtKB

GO - Biological processi

  • immune response Source: UniProtKB
  • signal transduction Source: GOC
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Ligandi

IgG-binding protein

Names & Taxonomyi

Protein namesi
Recommended name:
Low affinity immunoglobulin gamma Fc region receptor II-c
Short name:
IgG Fc receptor II-c
Alternative name(s):
CDw32
Fc-gamma RII-c
Short name:
Fc-gamma-RIIc
Short name:
FcRII-c
CD_antigen: CD32
Gene namesi
Name:FCGR2C
Synonyms:CD32, FCG2, IGFR2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Unplaced

Organism-specific databases

HGNCiHGNC:15626. FCGR2C.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini43 – 223181ExtracellularSequence analysisAdd
BLAST
Transmembranei224 – 24623HelicalSequence analysisAdd
BLAST
Topological domaini247 – 32377CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

  • cytoplasm Source: UniProtKB-SubCell
  • integral component of membrane Source: UniProtKB
  • plasma membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane

Pathology & Biotechi

Organism-specific databases

MalaCardsiFCGR2C.

Chemistry

DrugBankiDB00054. Abciximab.
DB00051. Adalimumab.
DB00092. Alefacept.
DB00087. Alemtuzumab.
DB00074. Basiliximab.
DB00112. Bevacizumab.
DB00002. Cetuximab.
DB00111. Daclizumab.
DB00095. Efalizumab.
DB00005. Etanercept.
DB00056. Gemtuzumab ozogamicin.
DB00078. Ibritumomab.
DB00028. Intravenous Immunoglobulin.
DB00075. Muromonab.
DB00108. Natalizumab.
DB00110. Palivizumab.
DB00073. Rituximab.
DB00081. Tositumomab.
DB00072. Trastuzumab.

Polymorphism and mutation databases

DMDMi399478.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 4242Sequence analysisAdd
BLAST
Chaini43 – 323281Low affinity immunoglobulin gamma Fc region receptor II-cPRO_0000015148Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi71 ↔ 113PROSITE-ProRule annotation1 Publication
Glycosylationi106 – 1061N-linked (GlcNAc...)Sequence analysis
Disulfide bondi152 ↔ 196PROSITE-ProRule annotation1 Publication
Glycosylationi180 – 1801N-linked (GlcNAc...)Sequence analysis
Glycosylationi187 – 1871N-linked (GlcNAc...)1 Publication
Modified residuei294 – 2941Phosphotyrosine; by SRC-type Tyr-kinases1 Publication
Modified residuei310 – 3101Phosphotyrosine; by SRC-type Tyr-kinases1 Publication

Post-translational modificationi

Phosphorylated by SRC-type Tyr-kinases such as LYN, BLK, FYN and SYK.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiP31995.
PaxDbiP31995.
PRIDEiP31995.
TopDownProteomicsiP31995-4. [P31995-4]

PTM databases

iPTMnetiP31995.
PhosphoSiteiP31995.

Expressioni

Tissue specificityi

Isoform IIC1 is detected in monocytes, macrophages, polymorphonuclear cells and natural killer cells.

Gene expression databases

CleanExiHS_FCGR2C.

Organism-specific databases

HPAiHPA010718.
HPA014730.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
CRPP027412EBI-1396036,EBI-1395983
NCK1P163332EBI-1396036,EBI-389883

Protein-protein interaction databases

BioGridi114556. 2 interactions.
IntActiP31995. 7 interactions.
MINTiMINT-7241761.
STRINGi9606.ENSP00000351497.

Structurei

Secondary structure

1
323
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi51 – 533Combined sources
Beta strandi59 – 624Combined sources
Beta strandi66 – 727Combined sources
Beta strandi83 – 864Combined sources
Beta strandi89 – 913Combined sources
Beta strandi96 – 1027Combined sources
Helixi105 – 1073Combined sources
Beta strandi109 – 1146Combined sources
Beta strandi116 – 1194Combined sources
Beta strandi124 – 1296Combined sources
Beta strandi131 – 1366Combined sources
Beta strandi140 – 1434Combined sources
Beta strandi148 – 1547Combined sources
Helixi155 – 1573Combined sources
Beta strandi161 – 1677Combined sources
Beta strandi170 – 1778Combined sources
Beta strandi180 – 1856Combined sources
Helixi188 – 1903Combined sources
Beta strandi192 – 2009Combined sources
Beta strandi203 – 2064Combined sources
Beta strandi210 – 2156Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3WJLX-ray2.86C45-217[»]
ProteinModelPortaliP31995.
SMRiP31995. Positions 50-213.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini48 – 12780Ig-like C2-type 1Add
BLAST
Domaini131 – 21383Ig-like C2-type 2Add
BLAST

Domaini

Contains an intracytoplasmic twice repeated motif referred as immunoreceptor tyrosine-based activator motif (ITAM). These motifs are involved in triggering cell activation upon receptors aggregation.

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410J9AP. Eukaryota.
ENOG410YXNK. LUCA.
HOVERGENiHBG051602.
InParanoidiP31995.
KOiK16824.
PhylomeDBiP31995.

Family and domain databases

Gene3Di2.60.40.10. 2 hits.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
[Graphical view]
PfamiPF13895. Ig_2. 2 hits.
[Graphical view]
SMARTiSM00409. IG. 2 hits.
SM00408. IGc2. 2 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 2 hits.
PROSITEiPS50835. IG_LIKE. 2 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform IIC1 (identifier: P31995-1) [UniParc]FASTAAdd to basket

Also known as: C1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGILSFLPVL ATESDWADCK SPQPWGHMLL WTAVLFLAPV AGTPAAPPKA
60 70 80 90 100
VLKLEPQWIN VLQEDSVTLT CRGTHSPESD SIQWFHNGNL IPTHTQPSYR
110 120 130 140 150
FKANNNDSGE YTCQTGQTSL SDPVHLTVLS EWLVLQTPHL EFQEGETIVL
160 170 180 190 200
RCHSWKDKPL VKVTFFQNGK SKKFSRSDPN FSIPQANHSH SGDYHCTGNI
210 220 230 240 250
GYTLYSSKPV TITVQAPSSS PMGIIVAVVT GIAVAAIVAA VVALIYCRKK
260 270 280 290 300
RISANSTDPV KAAQFEPPGR QMIAIRKRQP EETNNDYETA DGGYMTLNPR
310 320
APTDDDKNIY LTLPPNDHVN SNN
Length:323
Mass (Da):35,578
Last modified:July 1, 1993 - v1
Checksum:iDC4C1A22A0DE4572
GO
Isoform IIC2 (identifier: P31995-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     267-323: PPGRQMIAIRKRQPEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN → MLSCSHLDVK

Show »
Length:276
Mass (Da):30,241
Checksum:i395960C5B26197F5
GO
Isoform IIC3 (identifier: P31995-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     255-323: NSTDPVKAAQ...PPNDHVNSNN → TWTSNDCHQKETT

Show »
Length:267
Mass (Da):29,370
Checksum:iAD2C3AB385122162
GO
Isoform IIC4 (identifier: P31995-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     216-323: APSSSPMGII...PPNDHVNSNN → GPRLRTAAKQSSLVGAEVP

Show »
Length:234
Mass (Da):25,907
Checksum:iE593027A497A89B3
GO

Sequence cautioni

The sequence CAA35643.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti151 – 1511R → K in AAC12810 (PubMed:9516136).Curated
Sequence conflicti164 – 1641T → I in AAC12809 (PubMed:9516136).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei216 – 323108APSSS…VNSNN → GPRLRTAAKQSSLVGAEVP in isoform IIC4. 1 PublicationVSP_002644Add
BLAST
Alternative sequencei255 – 32369NSTDP…VNSNN → TWTSNDCHQKETT in isoform IIC3. 1 PublicationVSP_002645Add
BLAST
Alternative sequencei267 – 32357PPGRQ…VNSNN → MLSCSHLDVK in isoform IIC2. 1 PublicationVSP_002646Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X17652 mRNA. Translation: CAA35642.1.
X17652 mRNA. Translation: CAA35643.1. Different initiation.
U90938 mRNA. Translation: AAC12807.1.
U90939 mRNA. Translation: AAC12808.1.
U90940 mRNA. Translation: AAC12809.1.
U90941 mRNA. Translation: AAC12810.1.
PIRiS06946.
RefSeqiNP_963857.3. NM_201563.5.
XP_011507594.1. XM_011509292.1. [P31995-4]
UniGeneiHs.654395.
Hs.656750.

Genome annotation databases

GeneIDi2213.
9103.
KEGGihsa:9103.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X17652 mRNA. Translation: CAA35642.1.
X17652 mRNA. Translation: CAA35643.1. Different initiation.
U90938 mRNA. Translation: AAC12807.1.
U90939 mRNA. Translation: AAC12808.1.
U90940 mRNA. Translation: AAC12809.1.
U90941 mRNA. Translation: AAC12810.1.
PIRiS06946.
RefSeqiNP_963857.3. NM_201563.5.
XP_011507594.1. XM_011509292.1. [P31995-4]
UniGeneiHs.654395.
Hs.656750.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3WJLX-ray2.86C45-217[»]
ProteinModelPortaliP31995.
SMRiP31995. Positions 50-213.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114556. 2 interactions.
IntActiP31995. 7 interactions.
MINTiMINT-7241761.
STRINGi9606.ENSP00000351497.

Chemistry

DrugBankiDB00054. Abciximab.
DB00051. Adalimumab.
DB00092. Alefacept.
DB00087. Alemtuzumab.
DB00074. Basiliximab.
DB00112. Bevacizumab.
DB00002. Cetuximab.
DB00111. Daclizumab.
DB00095. Efalizumab.
DB00005. Etanercept.
DB00056. Gemtuzumab ozogamicin.
DB00078. Ibritumomab.
DB00028. Intravenous Immunoglobulin.
DB00075. Muromonab.
DB00108. Natalizumab.
DB00110. Palivizumab.
DB00073. Rituximab.
DB00081. Tositumomab.
DB00072. Trastuzumab.

PTM databases

iPTMnetiP31995.
PhosphoSiteiP31995.

Polymorphism and mutation databases

DMDMi399478.

Proteomic databases

MaxQBiP31995.
PaxDbiP31995.
PRIDEiP31995.
TopDownProteomicsiP31995-4. [P31995-4]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi2213.
9103.
KEGGihsa:9103.

Organism-specific databases

CTDi2213.
9103.
GeneCardsiFCGR2C.
H-InvDBHIX0056771.
HGNCiHGNC:15626. FCGR2C.
HPAiHPA010718.
HPA014730.
MalaCardsiFCGR2C.
MIMi612169. gene.
neXtProtiNX_P31995.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410J9AP. Eukaryota.
ENOG410YXNK. LUCA.
HOVERGENiHBG051602.
InParanoidiP31995.
KOiK16824.
PhylomeDBiP31995.

Miscellaneous databases

PROiP31995.
SOURCEiSearch...

Gene expression databases

CleanExiHS_FCGR2C.

Family and domain databases

Gene3Di2.60.40.10. 2 hits.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
[Graphical view]
PfamiPF13895. Ig_2. 2 hits.
[Graphical view]
SMARTiSM00409. IG. 2 hits.
SM00408. IGc2. 2 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 2 hits.
PROSITEiPS50835. IG_LIKE. 2 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Human IgG Fc receptor (hFcRII; CD32) exists as multiple isoforms in macrophages, lymphocytes and IgG-transporting placental epithelium."
    Stuart S.G., Simister N.E., Clarkson S.B., Kacinski B.M., Shapiro M., Mellman I.
    EMBO J. 8:3657-3666(1989) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM IIC1).
    Tissue: Placenta.
  2. "Expression of functional CD32 molecules on human NK cells is determined by an allelic polymorphism of the FcgammaRIIC gene."
    Metes D., Ernst L.K., Chambers W.H., Sulica A., Herberman R.B., Morel P.A.
    Blood 91:2369-2380(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS IIC1; IIC2; IIC3 AND IIC4).
    Tissue: Natural killer cell.
  3. "In vivo and in vitro specificity of protein tyrosine kinases for immunoglobulin G receptor (FcgammaRII) phosphorylation."
    Bewarder N., Weinrich V., Budde P., Hartmann D., Flaswinkel H., Reth M., Frey J.
    Mol. Cell. Biol. 16:4735-4743(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION AT TYR-294 AND TYR-310.
  4. "Engineered antibody Fc variant with selectively enhanced FcgammaRIIb binding over both FcgammaRIIa(R131) and FcgammaRIIa(H131)."
    Mimoto F., Katada H., Kadono S., Igawa T., Kuramochi T., Muraoka M., Wada Y., Haraya K., Miyazaki T., Hattori K.
    Protein Eng. Des. Sel. 26:589-598(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.86 ANGSTROMS) OF 45-217, DISULFIDE BONDS, GLYCOSYLATION AT ASN-187.

Entry informationi

Entry nameiFCG2C_HUMAN
AccessioniPrimary (citable) accession number: P31995
Secondary accession number(s): O00523, O00524, O00525
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 1, 1993
Last sequence update: July 1, 1993
Last modified: May 11, 2016
This is version 146 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

Has sometimes been attributed to correspond to FcR-IIB.Curated

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.