Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Low affinity immunoglobulin gamma Fc region receptor II-c

Gene

FCGR2C

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells.

Caution

Has sometimes been attributed to correspond to FcR-IIB.Curated
FCGR2C is both a gene and a pseudogene in the human population, the reference genome corresponding currently to the non-functional allele with a stop codon at position 57. The sequence shown here with a Gln at that position is the one of the functional protein.Curated

GO - Molecular functioni

  • IgG binding Source: UniProtKB-KW
  • transmembrane signaling receptor activity Source: UniProtKB

GO - Biological processi

  • immune response Source: UniProtKB

Keywordsi

Molecular functionIgG-binding protein, Receptor

Names & Taxonomyi

Protein namesi
Recommended name:
Low affinity immunoglobulin gamma Fc region receptor II-c
Short name:
IgG Fc receptor II-c
Alternative name(s):
CDw32
Fc-gamma RII-c
Short name:
Fc-gamma-RIIc
Short name:
FcRII-c
CD_antigen: CD32
Gene namesi
Name:FCGR2C
Synonyms:CD32, FCG2, IGFR2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Unplaced

Organism-specific databases

HGNCiHGNC:15626 FCGR2C
MIMi612169 gene
neXtProtiNX_P31995

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini43 – 223ExtracellularSequence analysisAdd BLAST181
Transmembranei224 – 246HelicalSequence analysisAdd BLAST23
Topological domaini247 – 323CytoplasmicSequence analysisAdd BLAST77

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi2213
9103
MalaCardsiFCGR2C

Chemistry databases

DrugBankiDB00054 Abciximab
DB00051 Adalimumab
DB00092 Alefacept
DB00087 Alemtuzumab
DB00074 Basiliximab
DB00112 Bevacizumab
DB00002 Cetuximab
DB00111 Daclizumab
DB00095 Efalizumab
DB00005 Etanercept
DB00056 Gemtuzumab ozogamicin
DB00078 Ibritumomab tiuxetan
DB00028 Immune Globulin Human
DB00075 Muromonab
DB00108 Natalizumab
DB00110 Palivizumab
DB00073 Rituximab
DB00081 Tositumomab
DB00072 Trastuzumab

Polymorphism and mutation databases

DMDMi399478

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 42Sequence analysisAdd BLAST42
ChainiPRO_000001514843 – 323Low affinity immunoglobulin gamma Fc region receptor II-cAdd BLAST281

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi71 ↔ 113PROSITE-ProRule annotation1 Publication
Glycosylationi106N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi152 ↔ 196PROSITE-ProRule annotation1 Publication
Glycosylationi180N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi187N-linked (GlcNAc...) asparagine1 Publication1
Modified residuei294Phosphotyrosine; by SRC-type Tyr-kinases1 Publication1
Modified residuei310Phosphotyrosine; by SRC-type Tyr-kinases1 Publication1

Post-translational modificationi

Phosphorylated by SRC-type Tyr-kinases such as LYN, BLK, FYN and SYK.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiP31995
PeptideAtlasiP31995
PRIDEiP31995
TopDownProteomicsiP31995-4 [P31995-4]

PTM databases

iPTMnetiP31995
PhosphoSitePlusiP31995

Expressioni

Tissue specificityi

Isoform IIC1 is detected in monocytes, macrophages, polymorphonuclear cells and natural killer cells.

Gene expression databases

CleanExiHS_FCGR2C

Organism-specific databases

HPAiHPA010718
HPA014730

Interactioni

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi114556, 2 interactors
IntActiP31995, 7 interactors

Structurei

Secondary structure

1323
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi51 – 53Combined sources3
Beta strandi59 – 62Combined sources4
Beta strandi66 – 72Combined sources7
Beta strandi83 – 86Combined sources4
Beta strandi89 – 91Combined sources3
Beta strandi96 – 102Combined sources7
Helixi105 – 107Combined sources3
Beta strandi109 – 114Combined sources6
Beta strandi116 – 119Combined sources4
Beta strandi124 – 129Combined sources6
Beta strandi131 – 136Combined sources6
Beta strandi140 – 143Combined sources4
Beta strandi148 – 154Combined sources7
Helixi155 – 157Combined sources3
Beta strandi161 – 167Combined sources7
Beta strandi170 – 177Combined sources8
Beta strandi180 – 185Combined sources6
Helixi188 – 190Combined sources3
Beta strandi192 – 200Combined sources9
Beta strandi203 – 206Combined sources4
Beta strandi210 – 215Combined sources6

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3WJLX-ray2.86C45-217[»]
ProteinModelPortaliP31995
SMRiP31995
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini48 – 127Ig-like C2-type 1Add BLAST80
Domaini131 – 213Ig-like C2-type 2Add BLAST83

Domaini

Contains an intracytoplasmic twice repeated motif referred as immunoreceptor tyrosine-based activator motif (ITAM). These motifs are involved in triggering cell activation upon receptors aggregation.

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410J9AP Eukaryota
ENOG410YXNK LUCA
HOVERGENiHBG051602
InParanoidiP31995
KOiK16824
PhylomeDBiP31995

Family and domain databases

Gene3Di2.60.40.10, 2 hits
InterProiView protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
IPR003598 Ig_sub2
PfamiView protein in Pfam
PF13895 Ig_2, 2 hits
SMARTiView protein in SMART
SM00409 IG, 2 hits
SM00408 IGc2, 2 hits
SUPFAMiSSF48726 SSF48726, 2 hits
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 2 hits

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform IIC1 (identifier: P31995-1) [UniParc]FASTAAdd to basket
Also known as: C1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGILSFLPVL ATESDWADCK SPQPWGHMLL WTAVLFLAPV AGTPAAPPKA
60 70 80 90 100
VLKLEPQWIN VLQEDSVTLT CRGTHSPESD SIQWFHNGNL IPTHTQPSYR
110 120 130 140 150
FKANNNDSGE YTCQTGQTSL SDPVHLTVLS EWLVLQTPHL EFQEGETIVL
160 170 180 190 200
RCHSWKDKPL VKVTFFQNGK SKKFSRSDPN FSIPQANHSH SGDYHCTGNI
210 220 230 240 250
GYTLYSSKPV TITVQAPSSS PMGIIVAVVT GIAVAAIVAA VVALIYCRKK
260 270 280 290 300
RISANSTDPV KAAQFEPPGR QMIAIRKRQP EETNNDYETA DGGYMTLNPR
310 320
APTDDDKNIY LTLPPNDHVN SNN
Length:323
Mass (Da):35,578
Last modified:July 1, 1993 - v1
Checksum:iDC4C1A22A0DE4572
GO
Isoform IIC2 (identifier: P31995-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     267-323: PPGRQMIAIRKRQPEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN → MLSCSHLDVK

Show »
Length:276
Mass (Da):30,241
Checksum:i395960C5B26197F5
GO
Isoform IIC3 (identifier: P31995-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     255-323: NSTDPVKAAQ...PPNDHVNSNN → TWTSNDCHQKETT

Show »
Length:267
Mass (Da):29,370
Checksum:iAD2C3AB385122162
GO
Isoform IIC4 (identifier: P31995-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     216-323: APSSSPMGII...PPNDHVNSNN → GPRLRTAAKQSSLVGAEVP

Show »
Length:234
Mass (Da):25,907
Checksum:iE593027A497A89B3
GO

Sequence cautioni

The sequence CAA35643 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti151R → K in AAC12810 (PubMed:9516136).Curated1
Sequence conflicti164T → I in AAC12809 (PubMed:9516136).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_002644216 – 323APSSS…VNSNN → GPRLRTAAKQSSLVGAEVP in isoform IIC4. 1 PublicationAdd BLAST108
Alternative sequenceiVSP_002645255 – 323NSTDP…VNSNN → TWTSNDCHQKETT in isoform IIC3. 1 PublicationAdd BLAST69
Alternative sequenceiVSP_002646267 – 323PPGRQ…VNSNN → MLSCSHLDVK in isoform IIC2. 1 PublicationAdd BLAST57

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X17652 mRNA Translation: CAA35642.1
X17652 mRNA Translation: CAA35643.1 Different initiation.
U90938 mRNA Translation: AAC12807.1
U90939 mRNA Translation: AAC12808.1
U90940 mRNA Translation: AAC12809.1
U90941 mRNA Translation: AAC12810.1
PIRiS06946
RefSeqiNP_963857.3, NM_201563.5
XP_011507594.1, XM_011509292.2 [P31995-4]
UniGeneiHs.654395
Hs.656750

Genome annotation databases

GeneIDi2213
9103
KEGGihsa:9103

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiFCG2C_HUMAN
AccessioniPrimary (citable) accession number: P31995
Secondary accession number(s): O00523, O00524, O00525
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 1, 1993
Last sequence update: July 1, 1993
Last modified: March 28, 2018
This is version 160 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health