Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Stress-induced-phosphoprotein 1

Gene

STIP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Acts as a co-chaperone for HSP90AA1 (PubMed:27353360). Mediates the association of the molecular chaperones HSPA8/HSC70 and HSP90 (By similarity).1 PublicationBy similarity

GO - Molecular functioni

  • poly(A) RNA binding Source: UniProtKB

GO - Biological processi

  • response to stress Source: ProtInc
Complete GO annotation...

Enzyme and pathway databases

BioCyciZFISH:ENSG00000168439-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Stress-induced-phosphoprotein 1
Short name:
STI1
Alternative name(s):
Hsc70/Hsp90-organizing protein
Short name:
Hop
Renal carcinoma antigen NY-REN-11
Transformation-sensitive protein IEF SSP 3521
Gene namesi
Name:STIP1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:11387. STIP1.

Subcellular locationi

  • Cytoplasm By similarity
  • Nucleus By similarity

GO - Cellular componenti

  • Golgi apparatus Source: ProtInc
  • myelin sheath Source: Ensembl
  • nucleus Source: UniProtKB
  • protein complex Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi10963.
OpenTargetsiENSG00000168439.
PharmGKBiPA36196.

Polymorphism and mutation databases

BioMutaiSTIP1.
DMDMi400042.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001063721 – 543Stress-induced-phosphoprotein 1Add BLAST543

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1 Publication1
Modified residuei8N6-acetyllysineCombined sources1
Modified residuei16PhosphoserineCombined sources1
Cross-linki123Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1)Combined sources
Cross-linki123Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei198PhosphothreonineCombined sources1
Cross-linki210Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1)Combined sources
Modified residuei301N6-acetyllysineCombined sources1
Modified residuei312N6-acetyllysineCombined sources1
Modified residuei325N6-acetyllysineCombined sources1
Modified residuei332PhosphothreonineCombined sources1
Modified residuei344N6-acetyllysineCombined sources1
Modified residuei354PhosphotyrosineCombined sources1
Modified residuei446N6-acetyllysineCombined sources1
Modified residuei481PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiP31948.
PaxDbiP31948.
PeptideAtlasiP31948.
PRIDEiP31948.
TopDownProteomicsiP31948-1. [P31948-1]

2D gel databases

REPRODUCTION-2DPAGEIPI00013894.
UCD-2DPAGEP31948.

PTM databases

iPTMnetiP31948.
PhosphoSitePlusiP31948.
SwissPalmiP31948.

Expressioni

Gene expression databases

BgeeiENSG00000168439.
CleanExiHS_STIP1.
ExpressionAtlasiP31948. baseline and differential.
GenevisibleiP31948. HS.

Organism-specific databases

HPAiCAB017448.
HPA039291.
HPA044062.

Interactioni

Subunit structurei

Forms a complex with HSPA8/HSC70, HSPCA/HSP-86 and HSPCB/HSP-84 (By similarity). Interacts with PACRG (PubMed:14532270). Interacts with METTL21B (PubMed:23349634). Interacts with HSP90/HSP90AA1; the interaction dissociates the PPP5C:HSP90AA1 interaction (PubMed:9195923, PubMed:27353360). Interacts with FLCN, FNIP1 and FNIP2 (PubMed:27353360). Interacts with HSPA8/HSC70 (By similarity).By similarity4 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
ACDQ96AP02EBI-1054052,EBI-717666
CCDC117Q8IWD42EBI-1054052,EBI-3387963
CDC37L1Q7L3B62EBI-1054052,EBI-2841876
EGFRP005332EBI-1054052,EBI-297353

Protein-protein interaction databases

BioGridi116162. 166 interactors.
DIPiDIP-41085N.
IntActiP31948. 100 interactors.
MINTiMINT-132047.
STRINGi9606.ENSP00000305958.

Structurei

Secondary structure

1543
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi3 – 16Combined sources14
Helixi20 – 33Combined sources14
Helixi38 – 51Combined sources14
Helixi54 – 67Combined sources14
Helixi72 – 84Combined sources13
Helixi88 – 99Combined sources12
Helixi106 – 117Combined sources12
Helixi223 – 237Combined sources15
Helixi241 – 254Combined sources14
Helixi259 – 272Combined sources14
Helixi275 – 291Combined sources17
Helixi296 – 312Combined sources17
Helixi316 – 329Combined sources14
Helixi333 – 348Combined sources16
Helixi359 – 372Combined sources14
Helixi377 – 387Combined sources11
Helixi394 – 404Combined sources11
Turni405 – 408Combined sources4
Helixi410 – 423Combined sources14
Helixi428 – 440Combined sources13
Helixi444 – 457Combined sources14
Helixi459 – 462Combined sources4
Helixi463 – 475Combined sources13

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1ELRX-ray1.90A223-352[»]
1ELWX-ray1.60A/B1-118[»]
2LNINMR-A356-477[»]
3ESKX-ray2.05A223-350[»]
3FWVX-ray2.20A/B223-349[»]
ProteinModelPortaliP31948.
SMRiP31948.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP31948.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati4 – 37TPR 1Add BLAST34
Repeati38 – 71TPR 2Add BLAST34
Repeati72 – 105TPR 3Add BLAST34
Domaini130 – 169STI1 1Add BLAST40
Repeati225 – 258TPR 4Add BLAST34
Repeati259 – 292TPR 5Add BLAST34
Repeati300 – 333TPR 6Add BLAST34
Repeati360 – 393TPR 7Add BLAST34
Repeati394 – 427TPR 8Add BLAST34
Repeati428 – 461TPR 9Add BLAST34
Domaini492 – 531STI1 2Add BLAST40

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi222 – 239Bipartite nuclear localization signalSequence analysisAdd BLAST18

Domaini

The TPR 1 repeat interacts with the C-terminal of HSC70. The TPR 4, 5 and 6 repeats (also called TPR2A domain) and TPR 7, 8 and 9 repeats (also called TPR2B domain) interact with HSP90.

Sequence similaritiesi

Contains 2 STI1 domains.Curated
Contains 9 TPR repeats.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, TPR repeat

Phylogenomic databases

eggNOGiKOG0548. Eukaryota.
ENOG410XTCJ. LUCA.
GeneTreeiENSGT00840000129761.
HOGENOMiHOG000186562.
HOVERGENiHBG057820.
InParanoidiP31948.
KOiK09553.
OMAiSKCRELC.
OrthoDBiEOG091G0E5W.
PhylomeDBiP31948.
TreeFamiTF300478.

Family and domain databases

Gene3Di1.25.40.10. 3 hits.
InterProiIPR006636. STI1_HS-bd.
IPR013026. TPR-contain_dom.
IPR011990. TPR-like_helical_dom.
IPR013105. TPR_2.
IPR019734. TPR_repeat.
[Graphical view]
PfamiPF13414. TPR_11. 2 hits.
PF07719. TPR_2. 1 hit.
PF13181. TPR_8. 1 hit.
[Graphical view]
SMARTiSM00727. STI1. 2 hits.
SM00028. TPR. 9 hits.
[Graphical view]
SUPFAMiSSF48452. SSF48452. 3 hits.
PROSITEiPS50005. TPR. 9 hits.
PS50293. TPR_REGION. 2 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P31948-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEQVNELKEK GNKALSVGNI DDALQCYSEA IKLDPHNHVL YSNRSAAYAK
60 70 80 90 100
KGDYQKAYED GCKTVDLKPD WGKGYSRKAA ALEFLNRFEE AKRTYEEGLK
110 120 130 140 150
HEANNPQLKE GLQNMEARLA ERKFMNPFNM PNLYQKLESD PRTRTLLSDP
160 170 180 190 200
TYRELIEQLR NKPSDLGTKL QDPRIMTTLS VLLGVDLGSM DEEEEIATPP
210 220 230 240 250
PPPPPKKETK PEPMEEDLPE NKKQALKEKE LGNDAYKKKD FDTALKHYDK
260 270 280 290 300
AKELDPTNMT YITNQAAVYF EKGDYNKCRE LCEKAIEVGR ENREDYRQIA
310 320 330 340 350
KAYARIGNSY FKEEKYKDAI HFYNKSLAEH RTPDVLKKCQ QAEKILKEQE
360 370 380 390 400
RLAYINPDLA LEEKNKGNEC FQKGDYPQAM KHYTEAIKRN PKDAKLYSNR
410 420 430 440 450
AACYTKLLEF QLALKDCEEC IQLEPTFIKG YTRKAAALEA MKDYTKAMDV
460 470 480 490 500
YQKALDLDSS CKEAADGYQR CMMAQYNRHD SPEDVKRRAM ADPEVQQIMS
510 520 530 540
DPAMRLILEQ MQKDPQALSE HLKNPVIAQK IQKLMDVGLI AIR
Length:543
Mass (Da):62,639
Last modified:July 1, 1993 - v1
Checksum:i8E58ECA13825CB0E
GO
Isoform 2 (identifier: P31948-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-3: MEQ → MESGSPMGEVEISRTIRTNGRGQRGYDWQCKRPIRVAEVRSSLHSWSLRW

Show »
Length:590
Mass (Da):68,080
Checksum:i76F4C7A16BFCBCA0
GO
Isoform 3 (identifier: P31948-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     74-97: Missing.

Show »
Length:519
Mass (Da):59,778
Checksum:i0D7C993B4B4E230E
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti84F → L in AAH39299 (PubMed:15489334).Curated1
Sequence conflicti364K → E in BAG59782 (PubMed:14702039).Curated1
Sequence conflicti533K → R in BAG59782 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0550341 – 3MEQ → MESGSPMGEVEISRTIRTNG RGQRGYDWQCKRPIRVAEVR SSLHSWSLRW in isoform 2. 1 Publication3
Alternative sequenceiVSP_05503574 – 97Missing in isoform 3. 1 PublicationAdd BLAST24

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M86752 mRNA. Translation: AAA58682.1.
BT020010 mRNA. Translation: AAV38813.1.
BT020011 mRNA. Translation: AAV38814.1.
CR536512 mRNA. Translation: CAG38750.1.
AK297319 mRNA. Translation: BAG59782.1.
AP005668 Genomic DNA. No translation available.
CH471076 Genomic DNA. Translation: EAW74196.1.
CH471076 Genomic DNA. Translation: EAW74197.1.
BC002987 mRNA. Translation: AAH02987.1.
BC039299 mRNA. Translation: AAH39299.1.
CCDSiCCDS60827.1. [P31948-2]
CCDS60828.1. [P31948-3]
CCDS8058.1. [P31948-1]
PIRiA38093.
RefSeqiNP_001269581.1. NM_001282652.1. [P31948-2]
NP_001269582.1. NM_001282653.1. [P31948-3]
NP_006810.1. NM_006819.2. [P31948-1]
UniGeneiHs.337295.

Genome annotation databases

EnsembliENST00000305218; ENSP00000305958; ENSG00000168439. [P31948-1]
ENST00000358794; ENSP00000351646; ENSG00000168439. [P31948-2]
ENST00000538945; ENSP00000445957; ENSG00000168439. [P31948-3]
GeneIDi10963.
KEGGihsa:10963.
UCSCiuc010rnb.2. human. [P31948-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M86752 mRNA. Translation: AAA58682.1.
BT020010 mRNA. Translation: AAV38813.1.
BT020011 mRNA. Translation: AAV38814.1.
CR536512 mRNA. Translation: CAG38750.1.
AK297319 mRNA. Translation: BAG59782.1.
AP005668 Genomic DNA. No translation available.
CH471076 Genomic DNA. Translation: EAW74196.1.
CH471076 Genomic DNA. Translation: EAW74197.1.
BC002987 mRNA. Translation: AAH02987.1.
BC039299 mRNA. Translation: AAH39299.1.
CCDSiCCDS60827.1. [P31948-2]
CCDS60828.1. [P31948-3]
CCDS8058.1. [P31948-1]
PIRiA38093.
RefSeqiNP_001269581.1. NM_001282652.1. [P31948-2]
NP_001269582.1. NM_001282653.1. [P31948-3]
NP_006810.1. NM_006819.2. [P31948-1]
UniGeneiHs.337295.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1ELRX-ray1.90A223-352[»]
1ELWX-ray1.60A/B1-118[»]
2LNINMR-A356-477[»]
3ESKX-ray2.05A223-350[»]
3FWVX-ray2.20A/B223-349[»]
ProteinModelPortaliP31948.
SMRiP31948.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116162. 166 interactors.
DIPiDIP-41085N.
IntActiP31948. 100 interactors.
MINTiMINT-132047.
STRINGi9606.ENSP00000305958.

PTM databases

iPTMnetiP31948.
PhosphoSitePlusiP31948.
SwissPalmiP31948.

Polymorphism and mutation databases

BioMutaiSTIP1.
DMDMi400042.

2D gel databases

REPRODUCTION-2DPAGEIPI00013894.
UCD-2DPAGEP31948.

Proteomic databases

EPDiP31948.
PaxDbiP31948.
PeptideAtlasiP31948.
PRIDEiP31948.
TopDownProteomicsiP31948-1. [P31948-1]

Protocols and materials databases

DNASUi10963.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000305218; ENSP00000305958; ENSG00000168439. [P31948-1]
ENST00000358794; ENSP00000351646; ENSG00000168439. [P31948-2]
ENST00000538945; ENSP00000445957; ENSG00000168439. [P31948-3]
GeneIDi10963.
KEGGihsa:10963.
UCSCiuc010rnb.2. human. [P31948-1]

Organism-specific databases

CTDi10963.
DisGeNETi10963.
GeneCardsiSTIP1.
HGNCiHGNC:11387. STIP1.
HPAiCAB017448.
HPA039291.
HPA044062.
MIMi605063. gene.
neXtProtiNX_P31948.
OpenTargetsiENSG00000168439.
PharmGKBiPA36196.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0548. Eukaryota.
ENOG410XTCJ. LUCA.
GeneTreeiENSGT00840000129761.
HOGENOMiHOG000186562.
HOVERGENiHBG057820.
InParanoidiP31948.
KOiK09553.
OMAiSKCRELC.
OrthoDBiEOG091G0E5W.
PhylomeDBiP31948.
TreeFamiTF300478.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000168439-MONOMER.

Miscellaneous databases

ChiTaRSiSTIP1. human.
EvolutionaryTraceiP31948.
GeneWikiiHop_(protein).
GenomeRNAii10963.
PROiP31948.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000168439.
CleanExiHS_STIP1.
ExpressionAtlasiP31948. baseline and differential.
GenevisibleiP31948. HS.

Family and domain databases

Gene3Di1.25.40.10. 3 hits.
InterProiIPR006636. STI1_HS-bd.
IPR013026. TPR-contain_dom.
IPR011990. TPR-like_helical_dom.
IPR013105. TPR_2.
IPR019734. TPR_repeat.
[Graphical view]
PfamiPF13414. TPR_11. 2 hits.
PF07719. TPR_2. 1 hit.
PF13181. TPR_8. 1 hit.
[Graphical view]
SMARTiSM00727. STI1. 2 hits.
SM00028. TPR. 9 hits.
[Graphical view]
SUPFAMiSSF48452. SSF48452. 3 hits.
PROSITEiPS50005. TPR. 9 hits.
PS50293. TPR_REGION. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSTIP1_HUMAN
AccessioniPrimary (citable) accession number: P31948
Secondary accession number(s): B4DM70
, F5H0T1, G3XAD8, Q3ZCU9, Q5TZU9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 1, 1993
Last sequence update: July 1, 1993
Last modified: November 30, 2016
This is version 181 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.