Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Stress-induced-phosphoprotein 1

Gene

STIP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Mediates the association of the molecular chaperones HSC70 and HSP90 (HSPCA and HSPCB).

GO - Molecular functioni

  • poly(A) RNA binding Source: UniProtKB

GO - Biological processi

  • response to stress Source: ProtInc
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Stress-induced-phosphoprotein 1
Short name:
STI1
Alternative name(s):
Hsc70/Hsp90-organizing protein
Short name:
Hop
Renal carcinoma antigen NY-REN-11
Transformation-sensitive protein IEF SSP 3521
Gene namesi
Name:STIP1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:11387. STIP1.

Subcellular locationi

GO - Cellular componenti

  • Golgi apparatus Source: ProtInc
  • myelin sheath Source: Ensembl
  • nucleus Source: UniProtKB
  • protein complex Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA36196.

Polymorphism and mutation databases

BioMutaiSTIP1.
DMDMi400042.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 543543Stress-induced-phosphoprotein 1PRO_0000106372Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionineCombined sources1 Publication
Modified residuei8 – 81N6-acetyllysineCombined sources
Modified residuei16 – 161PhosphoserineCombined sources
Cross-linki123 – 123Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1)Combined sources
Cross-linki123 – 123Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei198 – 1981PhosphothreonineCombined sources
Cross-linki210 – 210Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1)Combined sources
Modified residuei301 – 3011N6-acetyllysineCombined sources
Modified residuei312 – 3121N6-acetyllysineCombined sources
Modified residuei325 – 3251N6-acetyllysineCombined sources
Modified residuei332 – 3321PhosphothreonineCombined sources
Modified residuei344 – 3441N6-acetyllysineCombined sources
Modified residuei354 – 3541PhosphotyrosineCombined sources
Modified residuei446 – 4461N6-acetyllysineCombined sources
Modified residuei481 – 4811PhosphoserineCombined sources

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiP31948.
PaxDbiP31948.
PeptideAtlasiP31948.
PRIDEiP31948.
TopDownProteomicsiP31948-1. [P31948-1]

2D gel databases

REPRODUCTION-2DPAGEIPI00013894.
UCD-2DPAGEP31948.

PTM databases

iPTMnetiP31948.
PhosphoSiteiP31948.
SwissPalmiP31948.

Expressioni

Gene expression databases

BgeeiENSG00000168439.
CleanExiHS_STIP1.
ExpressionAtlasiP31948. baseline and differential.
GenevisibleiP31948. HS.

Organism-specific databases

HPAiCAB017448.
HPA039291.
HPA044062.

Interactioni

Subunit structurei

Forms a complex with HSC70 and HSPCA/HSP-86 and HSPCB/HSP-84. Interacts with PACRG. Interacts with METTL21B. Interacts with HSP90/HSP90AA1; the interaction dissociates the PPP5C:HSP90AA1 interaction.3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
ACDQ96AP02EBI-1054052,EBI-717666
CCDC117Q8IWD42EBI-1054052,EBI-3387963
CDC37L1Q7L3B62EBI-1054052,EBI-2841876
EGFRP005332EBI-1054052,EBI-297353

Protein-protein interaction databases

BioGridi116162. 166 interactions.
DIPiDIP-41085N.
IntActiP31948. 97 interactions.
MINTiMINT-132047.
STRINGi9606.ENSP00000305958.

Structurei

Secondary structure

1
543
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi3 – 1614Combined sources
Helixi20 – 3314Combined sources
Helixi38 – 5114Combined sources
Helixi54 – 6714Combined sources
Helixi72 – 8413Combined sources
Helixi88 – 9912Combined sources
Helixi106 – 11712Combined sources
Helixi223 – 23715Combined sources
Helixi241 – 25414Combined sources
Helixi259 – 27214Combined sources
Helixi275 – 29117Combined sources
Helixi296 – 31217Combined sources
Helixi316 – 32914Combined sources
Helixi333 – 34816Combined sources
Helixi359 – 37214Combined sources
Helixi377 – 38711Combined sources
Helixi394 – 40411Combined sources
Turni405 – 4084Combined sources
Helixi410 – 42314Combined sources
Helixi428 – 44013Combined sources
Helixi444 – 45714Combined sources
Helixi459 – 4624Combined sources
Helixi463 – 47513Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1ELRX-ray1.90A223-352[»]
1ELWX-ray1.60A/B1-118[»]
2LNINMR-A356-477[»]
3ESKX-ray2.05A223-350[»]
3FWVX-ray2.20A/B223-349[»]
ProteinModelPortaliP31948.
SMRiP31948. Positions 2-118, 223-540.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP31948.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati4 – 3734TPR 1Add
BLAST
Repeati38 – 7134TPR 2Add
BLAST
Repeati72 – 10534TPR 3Add
BLAST
Domaini130 – 16940STI1 1Add
BLAST
Repeati225 – 25834TPR 4Add
BLAST
Repeati259 – 29234TPR 5Add
BLAST
Repeati300 – 33334TPR 6Add
BLAST
Repeati360 – 39334TPR 7Add
BLAST
Repeati394 – 42734TPR 8Add
BLAST
Repeati428 – 46134TPR 9Add
BLAST
Domaini492 – 53140STI1 2Add
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi222 – 23918Bipartite nuclear localization signalSequence analysisAdd
BLAST

Domaini

The TPR 1 repeat interacts with the C-terminal of HSC70. The TPR 4, 5 and 6 repeats (also called TPR2A domain) and TPR 7, 8 and 9 repeats (also called TPR2B domain) interact with HSP90.

Sequence similaritiesi

Contains 2 STI1 domains.Curated
Contains 9 TPR repeats.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, TPR repeat

Phylogenomic databases

eggNOGiKOG0548. Eukaryota.
ENOG410XTCJ. LUCA.
GeneTreeiENSGT00840000129761.
HOGENOMiHOG000186562.
HOVERGENiHBG057820.
InParanoidiP31948.
KOiK09553.
OMAiSKCRELC.
OrthoDBiEOG091G0E5W.
PhylomeDBiP31948.
TreeFamiTF300478.

Family and domain databases

Gene3Di1.25.40.10. 3 hits.
InterProiIPR006636. STI1_HS-bd.
IPR013026. TPR-contain_dom.
IPR011990. TPR-like_helical_dom.
IPR013105. TPR_2.
IPR019734. TPR_repeat.
[Graphical view]
PfamiPF13414. TPR_11. 2 hits.
PF07719. TPR_2. 1 hit.
PF13181. TPR_8. 1 hit.
[Graphical view]
SMARTiSM00727. STI1. 2 hits.
SM00028. TPR. 9 hits.
[Graphical view]
SUPFAMiSSF48452. SSF48452. 3 hits.
PROSITEiPS50005. TPR. 9 hits.
PS50293. TPR_REGION. 2 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P31948-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEQVNELKEK GNKALSVGNI DDALQCYSEA IKLDPHNHVL YSNRSAAYAK
60 70 80 90 100
KGDYQKAYED GCKTVDLKPD WGKGYSRKAA ALEFLNRFEE AKRTYEEGLK
110 120 130 140 150
HEANNPQLKE GLQNMEARLA ERKFMNPFNM PNLYQKLESD PRTRTLLSDP
160 170 180 190 200
TYRELIEQLR NKPSDLGTKL QDPRIMTTLS VLLGVDLGSM DEEEEIATPP
210 220 230 240 250
PPPPPKKETK PEPMEEDLPE NKKQALKEKE LGNDAYKKKD FDTALKHYDK
260 270 280 290 300
AKELDPTNMT YITNQAAVYF EKGDYNKCRE LCEKAIEVGR ENREDYRQIA
310 320 330 340 350
KAYARIGNSY FKEEKYKDAI HFYNKSLAEH RTPDVLKKCQ QAEKILKEQE
360 370 380 390 400
RLAYINPDLA LEEKNKGNEC FQKGDYPQAM KHYTEAIKRN PKDAKLYSNR
410 420 430 440 450
AACYTKLLEF QLALKDCEEC IQLEPTFIKG YTRKAAALEA MKDYTKAMDV
460 470 480 490 500
YQKALDLDSS CKEAADGYQR CMMAQYNRHD SPEDVKRRAM ADPEVQQIMS
510 520 530 540
DPAMRLILEQ MQKDPQALSE HLKNPVIAQK IQKLMDVGLI AIR
Length:543
Mass (Da):62,639
Last modified:July 1, 1993 - v1
Checksum:i8E58ECA13825CB0E
GO
Isoform 2 (identifier: P31948-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-3: MEQ → MESGSPMGEVEISRTIRTNGRGQRGYDWQCKRPIRVAEVRSSLHSWSLRW

Show »
Length:590
Mass (Da):68,080
Checksum:i76F4C7A16BFCBCA0
GO
Isoform 3 (identifier: P31948-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     74-97: Missing.

Show »
Length:519
Mass (Da):59,778
Checksum:i0D7C993B4B4E230E
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti84 – 841F → L in AAH39299 (PubMed:15489334).Curated
Sequence conflicti364 – 3641K → E in BAG59782 (PubMed:14702039).Curated
Sequence conflicti533 – 5331K → R in BAG59782 (PubMed:14702039).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 33MEQ → MESGSPMGEVEISRTIRTNG RGQRGYDWQCKRPIRVAEVR SSLHSWSLRW in isoform 2. 1 PublicationVSP_055034
Alternative sequencei74 – 9724Missing in isoform 3. 1 PublicationVSP_055035Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M86752 mRNA. Translation: AAA58682.1.
BT020010 mRNA. Translation: AAV38813.1.
BT020011 mRNA. Translation: AAV38814.1.
CR536512 mRNA. Translation: CAG38750.1.
AK297319 mRNA. Translation: BAG59782.1.
AP005668 Genomic DNA. No translation available.
CH471076 Genomic DNA. Translation: EAW74196.1.
CH471076 Genomic DNA. Translation: EAW74197.1.
BC002987 mRNA. Translation: AAH02987.1.
BC039299 mRNA. Translation: AAH39299.1.
CCDSiCCDS60827.1. [P31948-2]
CCDS60828.1. [P31948-3]
CCDS8058.1. [P31948-1]
PIRiA38093.
RefSeqiNP_001269581.1. NM_001282652.1. [P31948-2]
NP_001269582.1. NM_001282653.1. [P31948-3]
NP_006810.1. NM_006819.2. [P31948-1]
UniGeneiHs.337295.

Genome annotation databases

EnsembliENST00000305218; ENSP00000305958; ENSG00000168439. [P31948-1]
ENST00000358794; ENSP00000351646; ENSG00000168439. [P31948-2]
ENST00000538945; ENSP00000445957; ENSG00000168439. [P31948-3]
GeneIDi10963.
KEGGihsa:10963.
UCSCiuc010rnb.2. human. [P31948-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M86752 mRNA. Translation: AAA58682.1.
BT020010 mRNA. Translation: AAV38813.1.
BT020011 mRNA. Translation: AAV38814.1.
CR536512 mRNA. Translation: CAG38750.1.
AK297319 mRNA. Translation: BAG59782.1.
AP005668 Genomic DNA. No translation available.
CH471076 Genomic DNA. Translation: EAW74196.1.
CH471076 Genomic DNA. Translation: EAW74197.1.
BC002987 mRNA. Translation: AAH02987.1.
BC039299 mRNA. Translation: AAH39299.1.
CCDSiCCDS60827.1. [P31948-2]
CCDS60828.1. [P31948-3]
CCDS8058.1. [P31948-1]
PIRiA38093.
RefSeqiNP_001269581.1. NM_001282652.1. [P31948-2]
NP_001269582.1. NM_001282653.1. [P31948-3]
NP_006810.1. NM_006819.2. [P31948-1]
UniGeneiHs.337295.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1ELRX-ray1.90A223-352[»]
1ELWX-ray1.60A/B1-118[»]
2LNINMR-A356-477[»]
3ESKX-ray2.05A223-350[»]
3FWVX-ray2.20A/B223-349[»]
ProteinModelPortaliP31948.
SMRiP31948. Positions 2-118, 223-540.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116162. 166 interactions.
DIPiDIP-41085N.
IntActiP31948. 97 interactions.
MINTiMINT-132047.
STRINGi9606.ENSP00000305958.

PTM databases

iPTMnetiP31948.
PhosphoSiteiP31948.
SwissPalmiP31948.

Polymorphism and mutation databases

BioMutaiSTIP1.
DMDMi400042.

2D gel databases

REPRODUCTION-2DPAGEIPI00013894.
UCD-2DPAGEP31948.

Proteomic databases

EPDiP31948.
PaxDbiP31948.
PeptideAtlasiP31948.
PRIDEiP31948.
TopDownProteomicsiP31948-1. [P31948-1]

Protocols and materials databases

DNASUi10963.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000305218; ENSP00000305958; ENSG00000168439. [P31948-1]
ENST00000358794; ENSP00000351646; ENSG00000168439. [P31948-2]
ENST00000538945; ENSP00000445957; ENSG00000168439. [P31948-3]
GeneIDi10963.
KEGGihsa:10963.
UCSCiuc010rnb.2. human. [P31948-1]

Organism-specific databases

CTDi10963.
GeneCardsiSTIP1.
HGNCiHGNC:11387. STIP1.
HPAiCAB017448.
HPA039291.
HPA044062.
MIMi605063. gene.
neXtProtiNX_P31948.
PharmGKBiPA36196.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0548. Eukaryota.
ENOG410XTCJ. LUCA.
GeneTreeiENSGT00840000129761.
HOGENOMiHOG000186562.
HOVERGENiHBG057820.
InParanoidiP31948.
KOiK09553.
OMAiSKCRELC.
OrthoDBiEOG091G0E5W.
PhylomeDBiP31948.
TreeFamiTF300478.

Miscellaneous databases

ChiTaRSiSTIP1. human.
EvolutionaryTraceiP31948.
GeneWikiiHop_(protein).
GenomeRNAii10963.
PROiP31948.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000168439.
CleanExiHS_STIP1.
ExpressionAtlasiP31948. baseline and differential.
GenevisibleiP31948. HS.

Family and domain databases

Gene3Di1.25.40.10. 3 hits.
InterProiIPR006636. STI1_HS-bd.
IPR013026. TPR-contain_dom.
IPR011990. TPR-like_helical_dom.
IPR013105. TPR_2.
IPR019734. TPR_repeat.
[Graphical view]
PfamiPF13414. TPR_11. 2 hits.
PF07719. TPR_2. 1 hit.
PF13181. TPR_8. 1 hit.
[Graphical view]
SMARTiSM00727. STI1. 2 hits.
SM00028. TPR. 9 hits.
[Graphical view]
SUPFAMiSSF48452. SSF48452. 3 hits.
PROSITEiPS50005. TPR. 9 hits.
PS50293. TPR_REGION. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSTIP1_HUMAN
AccessioniPrimary (citable) accession number: P31948
Secondary accession number(s): B4DM70
, F5H0T1, G3XAD8, Q3ZCU9, Q5TZU9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 1, 1993
Last sequence update: July 1, 1993
Last modified: September 7, 2016
This is version 178 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.