Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P31431

- SDC4_HUMAN

UniProt

P31431 - SDC4_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Syndecan-4

Gene

SDC4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Cell surface proteoglycan that bears heparan sulfate.

GO - Molecular functioni

  1. thrombospondin receptor activity Source: BHF-UCL

GO - Biological processi

  1. carbohydrate metabolic process Source: Reactome
  2. chondroitin sulfate metabolic process Source: Reactome
  3. extracellular matrix organization Source: Reactome
  4. glycosaminoglycan biosynthetic process Source: Reactome
  5. glycosaminoglycan catabolic process Source: Reactome
  6. glycosaminoglycan metabolic process Source: Reactome
  7. phototransduction, visible light Source: Reactome
  8. positive regulation of focal adhesion assembly Source: Ensembl
  9. positive regulation of protein kinase activity Source: Ensembl
  10. positive regulation of stress fiber assembly Source: Ensembl
  11. retinoid metabolic process Source: Reactome
  12. small molecule metabolic process Source: Reactome
  13. ureteric bud development Source: Ensembl
Complete GO annotation...

Enzyme and pathway databases

ReactomeiREACT_120752. HS-GAG degradation.
REACT_121248. HS-GAG biosynthesis.
REACT_121408. A tetrasaccharide linker sequence is required for GAG synthesis.
REACT_163942. Syndecan interactions.
REACT_24968. Retinoid metabolism and transport.

Protein family/group databases

TCDBi9.A.35.1.1. the peptide translocating syndecan (syndecan) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Syndecan-4
Short name:
SYND4
Alternative name(s):
Amphiglycan
Ryudocan core protein
Gene namesi
Name:SDC4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 20

Organism-specific databases

HGNCiHGNC:10661. SDC4.

Subcellular locationi

Isoform 1 : Membrane; Single-pass type I membrane protein. Secreted
Note: Shedding of the ectodomain produces a soluble form.By similarity

GO - Cellular componenti

  1. cell surface Source: Ensembl
  2. costamere Source: Ensembl
  3. extracellular vesicular exosome Source: UniProt
  4. focal adhesion Source: Ensembl
  5. Golgi lumen Source: Reactome
  6. integral component of plasma membrane Source: UniProtKB
  7. lysosomal lumen Source: Reactome
  8. membrane raft Source: Ensembl
  9. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Membrane, Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA35591.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1818Sequence AnalysisAdd
BLAST
Chaini19 – 198180Syndecan-4PRO_0000033511Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi39 – 391O-linked (Xyl...) (heparan sulfate)By similarity
Glycosylationi61 – 611O-linked (Xyl...) (heparan sulfate)Sequence Analysis
Glycosylationi63 – 631O-linked (Xyl...) (heparan sulfate)Sequence Analysis

Post-translational modificationi

Shedding is enhanced by a number of factors such as heparanase, thrombin or EGF. Also by stress and wound healing. PMA-mediated shedding is inhibited by TIMP3.

Keywords - PTMi

Glycoprotein, Heparan sulfate, Proteoglycan

Proteomic databases

MaxQBiP31431.
PaxDbiP31431.
PRIDEiP31431.

PTM databases

PhosphoSiteiP31431.

Miscellaneous databases

PMAP-CutDBP31431.

Expressioni

Tissue specificityi

Expressed in epithelial and fibroblastic cells.1 Publication

Gene expression databases

BgeeiP31431.
CleanExiHS_SDC4.
ExpressionAtlasiP31431. baseline and differential.
GenevestigatoriP31431.

Organism-specific databases

HPAiCAB013240.
HPA005716.

Interactioni

Subunit structurei

Homodimer. Interacts (via its cytoplasmic domain) with GIPC (via its PDZ domain). Interacts (via its cytoplasmic domain) with NUDT16L1 By similarity. Interacts with CDCP1 and SDCBP.By similarity3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
PRKCAP172522EBI-3913237,EBI-1383528

Protein-protein interaction databases

BioGridi112286. 10 interactions.
DIPiDIP-29945N.
IntActiP31431. 3 interactions.
MINTiMINT-140673.
STRINGi9606.ENSP00000361818.

Structurei

Secondary structure

1
198
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi192 – 1943
Beta strandi196 – 1983

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1EJPNMR-A/B171-198[»]
1EJQNMR-A/B171-198[»]
1OBYX-ray1.85P/Q193-198[»]
1YBOX-ray2.30C/D182-198[»]
ProteinModelPortaliP31431.
SMRiP31431. Positions 171-198.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP31431.

Topological domain

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini19 – 145127ExtracellularSequence AnalysisAdd
BLAST
Topological domaini171 – 19828CytoplasmicSequence AnalysisAdd
BLAST

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei146 – 17025HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Sequence similaritiesi

Belongs to the syndecan proteoglycan family.Curated

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG83582.
GeneTreeiENSGT00530000063116.
HOGENOMiHOG000263414.
HOVERGENiHBG004501.
InParanoidiP31431.
KOiK16338.
OMAiIPKRISP.
OrthoDBiEOG7RV9HS.
PhylomeDBiP31431.
TreeFamiTF320463.

Family and domain databases

InterProiIPR003585. Neurexin-like.
IPR001050. Syndecan.
IPR027789. Syndecan/Neurexin_dom.
[Graphical view]
PANTHERiPTHR10915. PTHR10915. 1 hit.
PfamiPF01034. Syndecan. 1 hit.
[Graphical view]
SMARTiSM00294. 4.1m. 1 hit.
[Graphical view]
PROSITEiPS00964. SYNDECAN. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P31431-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAPARLFALL LFFVGGVAES IRETEVIDPQ DLLEGRYFSG ALPDDEDVVG
60 70 80 90 100
PGQESDDFEL SGSGDLDDLE DSMIGPEVVH PLVPLDNHIP ERAGSGSQVP
110 120 130 140 150
TEPKKLEENE VIPKRISPVE ESEDVSNKVS MSSTVQGSNI FERTEVLAAL
160 170 180 190
IVGGIVGILF AVFLILLLMY RMKKKDEGSY DLGKKPIYKK APTNEFYA
Length:198
Mass (Da):21,642
Last modified:July 15, 1998 - v2
Checksum:i8229AA2733F77A10
GO
Isoform 2 (identifier: P31431-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     149-198: ALIVGGIVGILFAVFLILLLMYRMKKKDEGSYDLGKKPIYKKAPTNEFYA → GCPEH

Note: Soluble form, lacks the transmembrane domain.

Show »
Length:153
Mass (Da):16,545
Checksum:i25AD50751A7D2642
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti12 – 121F → L.2 Publications
Corresponds to variant rs4458268 [ dbSNP | Ensembl ].
VAR_021851

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei149 – 19850ALIVG…NEFYA → GCPEH in isoform 2. 2 PublicationsVSP_044449Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X67016 mRNA. Translation: CAA47406.1.
D13292 mRNA. Translation: BAA02550.1.
D79206 Genomic DNA. Translation: BAA19613.1.
AK312507 mRNA. Translation: BAG35408.1.
CR542045 mRNA. Translation: CAG46842.1.
CR542074 mRNA. Translation: CAG46871.1.
AK222695 mRNA. Translation: BAD96415.1.
AK223243 mRNA. Translation: BAD96963.1.
AL021578 Genomic DNA. Translation: CAA16520.1.
CH471077 Genomic DNA. Translation: EAW75861.1.
CH471077 Genomic DNA. Translation: EAW75862.1.
BC030805 mRNA. Translation: AAH30805.1.
AA151028 mRNA. No translation available.
AA258502 mRNA. No translation available.
CCDSiCCDS13350.1. [P31431-1]
PIRiJC1457.
RefSeqiNP_002990.2. NM_002999.3. [P31431-1]
UniGeneiHs.632267.

Genome annotation databases

EnsembliENST00000372733; ENSP00000361818; ENSG00000124145. [P31431-1]
GeneIDi6385.
KEGGihsa:6385.
UCSCiuc002xnu.3. human. [P31431-1]

Polymorphism databases

DMDMi2851418.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X67016 mRNA. Translation: CAA47406.1 .
D13292 mRNA. Translation: BAA02550.1 .
D79206 Genomic DNA. Translation: BAA19613.1 .
AK312507 mRNA. Translation: BAG35408.1 .
CR542045 mRNA. Translation: CAG46842.1 .
CR542074 mRNA. Translation: CAG46871.1 .
AK222695 mRNA. Translation: BAD96415.1 .
AK223243 mRNA. Translation: BAD96963.1 .
AL021578 Genomic DNA. Translation: CAA16520.1 .
CH471077 Genomic DNA. Translation: EAW75861.1 .
CH471077 Genomic DNA. Translation: EAW75862.1 .
BC030805 mRNA. Translation: AAH30805.1 .
AA151028 mRNA. No translation available.
AA258502 mRNA. No translation available.
CCDSi CCDS13350.1. [P31431-1 ]
PIRi JC1457.
RefSeqi NP_002990.2. NM_002999.3. [P31431-1 ]
UniGenei Hs.632267.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1EJP NMR - A/B 171-198 [» ]
1EJQ NMR - A/B 171-198 [» ]
1OBY X-ray 1.85 P/Q 193-198 [» ]
1YBO X-ray 2.30 C/D 182-198 [» ]
ProteinModelPortali P31431.
SMRi P31431. Positions 171-198.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 112286. 10 interactions.
DIPi DIP-29945N.
IntActi P31431. 3 interactions.
MINTi MINT-140673.
STRINGi 9606.ENSP00000361818.

Protein family/group databases

TCDBi 9.A.35.1.1. the peptide translocating syndecan (syndecan) family.

PTM databases

PhosphoSitei P31431.

Polymorphism databases

DMDMi 2851418.

Proteomic databases

MaxQBi P31431.
PaxDbi P31431.
PRIDEi P31431.

Protocols and materials databases

DNASUi 6385.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000372733 ; ENSP00000361818 ; ENSG00000124145 . [P31431-1 ]
GeneIDi 6385.
KEGGi hsa:6385.
UCSCi uc002xnu.3. human. [P31431-1 ]

Organism-specific databases

CTDi 6385.
GeneCardsi GC20M043953.
HGNCi HGNC:10661. SDC4.
HPAi CAB013240.
HPA005716.
MIMi 600017. gene.
neXtProti NX_P31431.
PharmGKBi PA35591.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG83582.
GeneTreei ENSGT00530000063116.
HOGENOMi HOG000263414.
HOVERGENi HBG004501.
InParanoidi P31431.
KOi K16338.
OMAi IPKRISP.
OrthoDBi EOG7RV9HS.
PhylomeDBi P31431.
TreeFami TF320463.

Enzyme and pathway databases

Reactomei REACT_120752. HS-GAG degradation.
REACT_121248. HS-GAG biosynthesis.
REACT_121408. A tetrasaccharide linker sequence is required for GAG synthesis.
REACT_163942. Syndecan interactions.
REACT_24968. Retinoid metabolism and transport.

Miscellaneous databases

ChiTaRSi SDC4. human.
EvolutionaryTracei P31431.
GeneWikii SDC4.
GenomeRNAii 6385.
NextBioi 24792.
PMAP-CutDB P31431.
PROi P31431.
SOURCEi Search...

Gene expression databases

Bgeei P31431.
CleanExi HS_SDC4.
ExpressionAtlasi P31431. baseline and differential.
Genevestigatori P31431.

Family and domain databases

InterProi IPR003585. Neurexin-like.
IPR001050. Syndecan.
IPR027789. Syndecan/Neurexin_dom.
[Graphical view ]
PANTHERi PTHR10915. PTHR10915. 1 hit.
Pfami PF01034. Syndecan. 1 hit.
[Graphical view ]
SMARTi SM00294. 4.1m. 1 hit.
[Graphical view ]
PROSITEi PS00964. SYNDECAN. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning of amphiglycan, a novel integral membrane heparan sulfate proteoglycan expressed by epithelial and fibroblastic cells."
    David G., van der Schueren B., Marynen P., Cassiman J.-J., van den Berghe H.
    J. Cell Biol. 118:961-969(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, VARIANT LEU-12.
    Tissue: Lung fibroblast.
  2. "Human ryudocan core protein: molecular cloning and characterization of the cDNA, and chromosomal localization of the gene."
    Kojima T., Inazawa J., Takamatsu J., Rosenberg R.D., Saito H.
    Biochem. Biophys. Res. Commun. 190:814-822(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  3. "Structural organization and promoter activity of the human ryudocan gene."
    Takagi A., Kojima T., Tsuzuki S., Katsumi A., Yamazaki T., Sugiura I., Hamaguchi M., Saito H.
    J. Biochem. 119:979-984(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    Tissue: Placenta.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Thalamus.
  5. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
    Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  6. Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
    Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT LEU-12.
    Tissue: Stomach.
  7. "The DNA sequence and comparative analysis of human chromosome 20."
    Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E.
    , Bridgeman A.M., Brown A.J., Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P., Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M., Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R., Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M., Ellington A.G., Frankland J.A., Fraser A., French L., Garner P., Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E., Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J., Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D., Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S., Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D., Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A., Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T., Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I., Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H., Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S., Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E., Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A., Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M., Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A., Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S., Rogers J.
    Nature 414:865-871(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  9. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Lung.
  10. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 75-153 (ISOFORM 2).
  11. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 125-153 (ISOFORM 2).
    Tissue: Uterus.
  12. "Regulated shedding of syndecan-1 and -4 ectodomains by thrombin and growth factor receptor activation."
    Subramanian S.V., Fitzgerald M.L., Bernfield M.
    J. Biol. Chem. 272:14713-14720(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: SHEDDING.
  13. "Widespread production of novel soluble protein isoforms by alternative splicing removal of transmembrane anchoring domains."
    Xing Y., Xu Q., Lee C.
    FEBS Lett. 555:572-578(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: ALTERNATIVE SPLICING (ISOFORM 2), SUBCELLULAR LOCATION.
  14. "Adhesion signaling by a novel mitotic substrate of src kinases."
    Bhatt A.S., Erdjument-Bromage H., Tempst P., Craik C.S., Moasser M.M.
    Oncogene 24:5333-5343(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH CDCP1.
  15. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  16. "Solution structure of the dimeric cytoplasmic domain of syndecan-4."
    Shin J., Lee W., Lee D., Koo B.-K., Han I., Lim Y., Woods A., Couchman J.R., Oh E.-S.
    Biochemistry 40:8471-8478(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: STRUCTURE BY NMR OF 171-198.
  17. "Molecular roots of degenerate specificity in syntenin's PDZ2 domain: reassessment of the PDZ recognition paradigm."
    Kang B.S., Cooper D.R., Devedjiev Y., Derewenda U., Derewenda Z.S.
    Structure 11:845-853(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (1.85 ANGSTROMS) OF 193-198 IN COMPLEX WITH SDCBP.
  18. Cited for: X-RAY CRYSTALLOGRAPHY (2.3 ANGSTROMS) OF 182-198 IN COMPLEX WITH SDCBP.

Entry informationi

Entry nameiSDC4_HUMAN
AccessioniPrimary (citable) accession number: P31431
Secondary accession number(s): O00773
, Q16833, Q53FN9, Q6FGN3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 1, 1993
Last sequence update: July 15, 1998
Last modified: October 29, 2014
This is version 152 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3