Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P31431

- SDC4_HUMAN

UniProt

P31431 - SDC4_HUMAN

Protein

Syndecan-4

Gene

SDC4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 151 (01 Oct 2014)
      Sequence version 2 (15 Jul 1998)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Cell surface proteoglycan that bears heparan sulfate.

    GO - Molecular functioni

    1. protein binding Source: IntAct
    2. thrombospondin receptor activity Source: BHF-UCL

    GO - Biological processi

    1. carbohydrate metabolic process Source: Reactome
    2. chondroitin sulfate metabolic process Source: Reactome
    3. extracellular matrix organization Source: Reactome
    4. glycosaminoglycan biosynthetic process Source: Reactome
    5. glycosaminoglycan catabolic process Source: Reactome
    6. glycosaminoglycan metabolic process Source: Reactome
    7. phototransduction, visible light Source: Reactome
    8. positive regulation of focal adhesion assembly Source: Ensembl
    9. positive regulation of protein kinase activity Source: Ensembl
    10. positive regulation of stress fiber assembly Source: Ensembl
    11. retinoid metabolic process Source: Reactome
    12. small molecule metabolic process Source: Reactome
    13. ureteric bud development Source: Ensembl

    Enzyme and pathway databases

    ReactomeiREACT_120752. HS-GAG degradation.
    REACT_121248. HS-GAG biosynthesis.
    REACT_121408. A tetrasaccharide linker sequence is required for GAG synthesis.
    REACT_163942. Syndecan interactions.
    REACT_24968. Retinoid metabolism and transport.

    Protein family/group databases

    TCDBi9.A.35.1.1. the peptide translocating syndecan (syndecan) family.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Syndecan-4
    Short name:
    SYND4
    Alternative name(s):
    Amphiglycan
    Ryudocan core protein
    Gene namesi
    Name:SDC4
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 20

    Organism-specific databases

    HGNCiHGNC:10661. SDC4.

    Subcellular locationi

    Isoform 1 : Membrane; Single-pass type I membrane protein. Secreted
    Note: Shedding of the ectodomain produces a soluble form.By similarity

    GO - Cellular componenti

    1. cell surface Source: Ensembl
    2. costamere Source: Ensembl
    3. extracellular vesicular exosome Source: UniProt
    4. focal adhesion Source: Ensembl
    5. Golgi lumen Source: Reactome
    6. integral component of plasma membrane Source: UniProtKB
    7. lysosomal lumen Source: Reactome
    8. membrane raft Source: Ensembl
    9. plasma membrane Source: Reactome

    Keywords - Cellular componenti

    Membrane, Secreted

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA35591.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 1818Sequence AnalysisAdd
    BLAST
    Chaini19 – 198180Syndecan-4PRO_0000033511Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi39 – 391O-linked (Xyl...) (heparan sulfate)By similarity
    Glycosylationi61 – 611O-linked (Xyl...) (heparan sulfate)Sequence Analysis
    Glycosylationi63 – 631O-linked (Xyl...) (heparan sulfate)Sequence Analysis

    Post-translational modificationi

    Shedding is enhanced by a number of factors such as heparanase, thrombin or EGF. Also by stress and wound healing. PMA-mediated shedding is inhibited by TIMP3.

    Keywords - PTMi

    Glycoprotein, Heparan sulfate, Proteoglycan

    Proteomic databases

    MaxQBiP31431.
    PaxDbiP31431.
    PRIDEiP31431.

    PTM databases

    PhosphoSiteiP31431.

    Miscellaneous databases

    PMAP-CutDBP31431.

    Expressioni

    Tissue specificityi

    Expressed in epithelial and fibroblastic cells.1 Publication

    Gene expression databases

    ArrayExpressiP31431.
    BgeeiP31431.
    CleanExiHS_SDC4.
    GenevestigatoriP31431.

    Organism-specific databases

    HPAiCAB013240.
    HPA005716.

    Interactioni

    Subunit structurei

    Homodimer. Interacts (via its cytoplasmic domain) with GIPC (via its PDZ domain). Interacts (via its cytoplasmic domain) with NUDT16L1 By similarity. Interacts with CDCP1 and SDCBP.By similarity3 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    PRKCAP172522EBI-3913237,EBI-1383528

    Protein-protein interaction databases

    BioGridi112286. 9 interactions.
    DIPiDIP-29945N.
    IntActiP31431. 3 interactions.
    MINTiMINT-140673.
    STRINGi9606.ENSP00000361818.

    Structurei

    Secondary structure

    1
    198
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi192 – 1943
    Beta strandi196 – 1983

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1EJPNMR-A/B171-198[»]
    1EJQNMR-A/B171-198[»]
    1OBYX-ray1.85P/Q193-198[»]
    1YBOX-ray2.30C/D182-198[»]
    ProteinModelPortaliP31431.
    SMRiP31431. Positions 171-198.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiP31431.

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini19 – 145127ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini171 – 19828CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei146 – 17025HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the syndecan proteoglycan family.Curated

    Keywords - Domaini

    Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG83582.
    HOGENOMiHOG000263414.
    HOVERGENiHBG004501.
    InParanoidiP31431.
    KOiK16338.
    OMAiIPKRISP.
    OrthoDBiEOG7RV9HS.
    PhylomeDBiP31431.
    TreeFamiTF320463.

    Family and domain databases

    InterProiIPR003585. Neurexin-like.
    IPR001050. Syndecan.
    IPR027789. Syndecan/Neurexin_dom.
    [Graphical view]
    PANTHERiPTHR10915. PTHR10915. 1 hit.
    PfamiPF01034. Syndecan. 1 hit.
    [Graphical view]
    SMARTiSM00294. 4.1m. 1 hit.
    [Graphical view]
    PROSITEiPS00964. SYNDECAN. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P31431-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAPARLFALL LFFVGGVAES IRETEVIDPQ DLLEGRYFSG ALPDDEDVVG    50
    PGQESDDFEL SGSGDLDDLE DSMIGPEVVH PLVPLDNHIP ERAGSGSQVP 100
    TEPKKLEENE VIPKRISPVE ESEDVSNKVS MSSTVQGSNI FERTEVLAAL 150
    IVGGIVGILF AVFLILLLMY RMKKKDEGSY DLGKKPIYKK APTNEFYA 198
    Length:198
    Mass (Da):21,642
    Last modified:July 15, 1998 - v2
    Checksum:i8229AA2733F77A10
    GO
    Isoform 2 (identifier: P31431-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         149-198: ALIVGGIVGILFAVFLILLLMYRMKKKDEGSYDLGKKPIYKKAPTNEFYA → GCPEH

    Note: Soluble form, lacks the transmembrane domain.

    Show »
    Length:153
    Mass (Da):16,545
    Checksum:i25AD50751A7D2642
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti12 – 121F → L.2 Publications
    Corresponds to variant rs4458268 [ dbSNP | Ensembl ].
    VAR_021851

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei149 – 19850ALIVG…NEFYA → GCPEH in isoform 2. 2 PublicationsVSP_044449Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X67016 mRNA. Translation: CAA47406.1.
    D13292 mRNA. Translation: BAA02550.1.
    D79206 Genomic DNA. Translation: BAA19613.1.
    AK312507 mRNA. Translation: BAG35408.1.
    CR542045 mRNA. Translation: CAG46842.1.
    CR542074 mRNA. Translation: CAG46871.1.
    AK222695 mRNA. Translation: BAD96415.1.
    AK223243 mRNA. Translation: BAD96963.1.
    AL021578 Genomic DNA. Translation: CAA16520.1.
    CH471077 Genomic DNA. Translation: EAW75861.1.
    CH471077 Genomic DNA. Translation: EAW75862.1.
    BC030805 mRNA. Translation: AAH30805.1.
    AA151028 mRNA. No translation available.
    AA258502 mRNA. No translation available.
    CCDSiCCDS13350.1. [P31431-1]
    PIRiJC1457.
    RefSeqiNP_002990.2. NM_002999.3. [P31431-1]
    UniGeneiHs.632267.

    Genome annotation databases

    EnsembliENST00000372733; ENSP00000361818; ENSG00000124145. [P31431-1]
    GeneIDi6385.
    KEGGihsa:6385.
    UCSCiuc002xnu.3. human. [P31431-1]

    Polymorphism databases

    DMDMi2851418.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X67016 mRNA. Translation: CAA47406.1 .
    D13292 mRNA. Translation: BAA02550.1 .
    D79206 Genomic DNA. Translation: BAA19613.1 .
    AK312507 mRNA. Translation: BAG35408.1 .
    CR542045 mRNA. Translation: CAG46842.1 .
    CR542074 mRNA. Translation: CAG46871.1 .
    AK222695 mRNA. Translation: BAD96415.1 .
    AK223243 mRNA. Translation: BAD96963.1 .
    AL021578 Genomic DNA. Translation: CAA16520.1 .
    CH471077 Genomic DNA. Translation: EAW75861.1 .
    CH471077 Genomic DNA. Translation: EAW75862.1 .
    BC030805 mRNA. Translation: AAH30805.1 .
    AA151028 mRNA. No translation available.
    AA258502 mRNA. No translation available.
    CCDSi CCDS13350.1. [P31431-1 ]
    PIRi JC1457.
    RefSeqi NP_002990.2. NM_002999.3. [P31431-1 ]
    UniGenei Hs.632267.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1EJP NMR - A/B 171-198 [» ]
    1EJQ NMR - A/B 171-198 [» ]
    1OBY X-ray 1.85 P/Q 193-198 [» ]
    1YBO X-ray 2.30 C/D 182-198 [» ]
    ProteinModelPortali P31431.
    SMRi P31431. Positions 171-198.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 112286. 9 interactions.
    DIPi DIP-29945N.
    IntActi P31431. 3 interactions.
    MINTi MINT-140673.
    STRINGi 9606.ENSP00000361818.

    Protein family/group databases

    TCDBi 9.A.35.1.1. the peptide translocating syndecan (syndecan) family.

    PTM databases

    PhosphoSitei P31431.

    Polymorphism databases

    DMDMi 2851418.

    Proteomic databases

    MaxQBi P31431.
    PaxDbi P31431.
    PRIDEi P31431.

    Protocols and materials databases

    DNASUi 6385.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000372733 ; ENSP00000361818 ; ENSG00000124145 . [P31431-1 ]
    GeneIDi 6385.
    KEGGi hsa:6385.
    UCSCi uc002xnu.3. human. [P31431-1 ]

    Organism-specific databases

    CTDi 6385.
    GeneCardsi GC20M043953.
    HGNCi HGNC:10661. SDC4.
    HPAi CAB013240.
    HPA005716.
    MIMi 600017. gene.
    neXtProti NX_P31431.
    PharmGKBi PA35591.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG83582.
    HOGENOMi HOG000263414.
    HOVERGENi HBG004501.
    InParanoidi P31431.
    KOi K16338.
    OMAi IPKRISP.
    OrthoDBi EOG7RV9HS.
    PhylomeDBi P31431.
    TreeFami TF320463.

    Enzyme and pathway databases

    Reactomei REACT_120752. HS-GAG degradation.
    REACT_121248. HS-GAG biosynthesis.
    REACT_121408. A tetrasaccharide linker sequence is required for GAG synthesis.
    REACT_163942. Syndecan interactions.
    REACT_24968. Retinoid metabolism and transport.

    Miscellaneous databases

    ChiTaRSi SDC4. human.
    EvolutionaryTracei P31431.
    GeneWikii SDC4.
    GenomeRNAii 6385.
    NextBioi 24792.
    PMAP-CutDB P31431.
    PROi P31431.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P31431.
    Bgeei P31431.
    CleanExi HS_SDC4.
    Genevestigatori P31431.

    Family and domain databases

    InterProi IPR003585. Neurexin-like.
    IPR001050. Syndecan.
    IPR027789. Syndecan/Neurexin_dom.
    [Graphical view ]
    PANTHERi PTHR10915. PTHR10915. 1 hit.
    Pfami PF01034. Syndecan. 1 hit.
    [Graphical view ]
    SMARTi SM00294. 4.1m. 1 hit.
    [Graphical view ]
    PROSITEi PS00964. SYNDECAN. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Molecular cloning of amphiglycan, a novel integral membrane heparan sulfate proteoglycan expressed by epithelial and fibroblastic cells."
      David G., van der Schueren B., Marynen P., Cassiman J.-J., van den Berghe H.
      J. Cell Biol. 118:961-969(1992) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, VARIANT LEU-12.
      Tissue: Lung fibroblast.
    2. "Human ryudocan core protein: molecular cloning and characterization of the cDNA, and chromosomal localization of the gene."
      Kojima T., Inazawa J., Takamatsu J., Rosenberg R.D., Saito H.
      Biochem. Biophys. Res. Commun. 190:814-822(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    3. "Structural organization and promoter activity of the human ryudocan gene."
      Takagi A., Kojima T., Tsuzuki S., Katsumi A., Yamazaki T., Sugiura I., Hamaguchi M., Saito H.
      J. Biochem. 119:979-984(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
      Tissue: Placenta.
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Thalamus.
    5. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
      Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
      Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    6. Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
      Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT LEU-12.
      Tissue: Stomach.
    7. "The DNA sequence and comparative analysis of human chromosome 20."
      Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E.
      , Bridgeman A.M., Brown A.J., Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P., Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M., Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R., Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M., Ellington A.G., Frankland J.A., Fraser A., French L., Garner P., Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E., Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J., Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D., Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S., Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D., Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A., Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T., Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I., Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H., Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S., Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E., Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A., Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M., Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A., Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S., Rogers J.
      Nature 414:865-871(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    9. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Lung.
    10. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 75-153 (ISOFORM 2).
    11. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 125-153 (ISOFORM 2).
      Tissue: Uterus.
    12. "Regulated shedding of syndecan-1 and -4 ectodomains by thrombin and growth factor receptor activation."
      Subramanian S.V., Fitzgerald M.L., Bernfield M.
      J. Biol. Chem. 272:14713-14720(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: SHEDDING.
    13. "Widespread production of novel soluble protein isoforms by alternative splicing removal of transmembrane anchoring domains."
      Xing Y., Xu Q., Lee C.
      FEBS Lett. 555:572-578(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: ALTERNATIVE SPLICING (ISOFORM 2), SUBCELLULAR LOCATION.
    14. "Adhesion signaling by a novel mitotic substrate of src kinases."
      Bhatt A.S., Erdjument-Bromage H., Tempst P., Craik C.S., Moasser M.M.
      Oncogene 24:5333-5343(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH CDCP1.
    15. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    16. "Solution structure of the dimeric cytoplasmic domain of syndecan-4."
      Shin J., Lee W., Lee D., Koo B.-K., Han I., Lim Y., Woods A., Couchman J.R., Oh E.-S.
      Biochemistry 40:8471-8478(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: STRUCTURE BY NMR OF 171-198.
    17. "Molecular roots of degenerate specificity in syntenin's PDZ2 domain: reassessment of the PDZ recognition paradigm."
      Kang B.S., Cooper D.R., Devedjiev Y., Derewenda U., Derewenda Z.S.
      Structure 11:845-853(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (1.85 ANGSTROMS) OF 193-198 IN COMPLEX WITH SDCBP.
    18. Cited for: X-RAY CRYSTALLOGRAPHY (2.3 ANGSTROMS) OF 182-198 IN COMPLEX WITH SDCBP.

    Entry informationi

    Entry nameiSDC4_HUMAN
    AccessioniPrimary (citable) accession number: P31431
    Secondary accession number(s): O00773
    , Q16833, Q53FN9, Q6FGN3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 1, 1993
    Last sequence update: July 15, 1998
    Last modified: October 1, 2014
    This is version 151 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 20
      Human chromosome 20: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3