P31431 (SDC4_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 136.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Syndecan-4 Short name=SYND4 Alternative name(s): Amphiglycan Ryudocan core protein | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 198 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Cell surface proteoglycan that bears heparan sulfate. |
| Subunit structure | Homodimer. Interacts (via its cytoplasmic domain) with GIPC (via its PDZ domain). Interacts (via its cytoplasmic domain) with NUDT16L1 By similarity. Interacts with CDCP1 and SDCBP. Ref.14 |
| Subcellular location | Isoform 1: Membrane; Single-pass type I membrane protein. Secreted Ref.13. Note: Shedding of the ectodomain produces a soluble form By similarity. Ref.13 |
| Tissue specificity | Expressed in epithelial and fibroblastic cells. Ref.1 |
| Post-translational modification | Shedding is enhanced by a number of factors such as heparanase, thrombin or EGF. Also by stress and wound healing. PMA-mediated shedding is inhibited by TIMP3. |
| Sequence similarities | Belongs to the syndecan proteoglycan family. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| PRKCA | P17252 | 2 | EBI-3913237,EBI-1383528 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P31431-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P31431-2) The sequence of this isoform differs from the canonical sequence as follows: 149-198: ALIVGGIVGILFAVFLILLLMYRMKKKDEGSYDLGKKPIYKKAPTNEFYA → GCPEH | ||||||
| Note: Soluble form, lacks the transmembrane domain. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||
Molecule processing | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 18 | 18 | Potential | |||||||||
| Chain | 19 – 198 | 180 | Syndecan-4 | PRO_0000033511 | ||||||||
Regions | ||||||||||||
| Topological domain | 19 – 145 | 127 | Extracellular Potential | |||||||||
| Transmembrane | 146 – 170 | 25 | Helical; Potential | |||||||||
| Topological domain | 171 – 198 | 28 | Cytoplasmic Potential | |||||||||
Amino acid modifications | ||||||||||||
| Glycosylation | 39 | 1 | O-linked (Xyl...) (heparan sulfate) By similarity | |||||||||
| Glycosylation | 61 | 1 | O-linked (Xyl...) (heparan sulfate) Potential | |||||||||
| Glycosylation | 63 | 1 | O-linked (Xyl...) (heparan sulfate) Potential | |||||||||
Natural variations | ||||||||||||
| Alternative sequence | 149 – 198 | 50 | ALIVG…NEFYA → GCPEH in isoform 2. | VSP_044449 | ||||||||
| Natural variant | 12 | 1 | F → L. Ref.1 Ref.6 Corresponds to variant rs4458268 [ dbSNP | Ensembl ]. | VAR_021851 | ||||||||
Secondary structure | ||||||||||||
Helix Strand Turn | ||||||||||||
| Beta strand | 192 – 194 | 3 | ||||||||||
| Beta strand | 196 – 198 | 3 | ||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning of amphiglycan, a novel integral membrane heparan sulfate proteoglycan expressed by epithelial and fibroblastic cells." David G., van der Schueren B., Marynen P., Cassiman J.-J., van den Berghe H. J. Cell Biol. 118:961-969(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, VARIANT LEU-12. Tissue: Lung fibroblast. |
| [2] | "Human ryudocan core protein: molecular cloning and characterization of the cDNA, and chromosomal localization of the gene." Kojima T., Inazawa J., Takamatsu J., Rosenberg R.D., Saito H. Biochem. Biophys. Res. Commun. 190:814-822(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | "Structural organization and promoter activity of the human ryudocan gene." Takagi A., Kojima T., Tsuzuki S., Katsumi A., Yamazaki T., Sugiura I., Hamaguchi M., Saito H. J. Biochem. 119:979-984(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. Tissue: Placenta. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Thalamus. |
| [5] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [6] | Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S. Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT LEU-12. Tissue: Stomach. |
| [7] | "The DNA sequence and comparative analysis of human chromosome 20." Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E. Rogers J.Nature 414:865-871(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Lung. |
| [10] | "The WashU-Merck EST project." Hillier L., Clark N., Dubuque T., Elliston K., Hawkins M., Holman M., Hultman M., Kucaba T., Le M., Lennon G., Marra M., Parsons J., Rifkin L., Rohlfing T., Soares M., Tan F., Trevaskis E., Waterston R. Wilson R.Submitted (MAR-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 75-153 (ISOFORM 2). |
| [11] | "Generation and analysis of 280,000 human expressed sequence tags." Hillier L.D., Lennon G., Becker M., Bonaldo M.F., Chiapelli B., Chissoe S., Dietrich N., DuBuque T., Favello A., Gish W., Hawkins M., Hultman M., Kucaba T., Lacy M., Le M., Le N., Mardis E., Moore B. Marra M.Genome Res. 6:807-828(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 125-153 (ISOFORM 2). Tissue: Uterus. |
| [12] | "Regulated shedding of syndecan-1 and -4 ectodomains by thrombin and growth factor receptor activation." Subramanian S.V., Fitzgerald M.L., Bernfield M. J. Biol. Chem. 272:14713-14720(1997) [PubMed] [Europe PMC] [Abstract] Cited for: SHEDDING. |
| [13] | "Widespread production of novel soluble protein isoforms by alternative splicing removal of transmembrane anchoring domains." Xing Y., Xu Q., Lee C. FEBS Lett. 555:572-578(2003) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING (ISOFORM 2), SUBCELLULAR LOCATION. |
| [14] | "Adhesion signaling by a novel mitotic substrate of src kinases." Bhatt A.S., Erdjument-Bromage H., Tempst P., Craik C.S., Moasser M.M. Oncogene 24:5333-5343(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CDCP1. |
| [15] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [16] | "Solution structure of the dimeric cytoplasmic domain of syndecan-4." Shin J., Lee W., Lee D., Koo B.-K., Han I., Lim Y., Woods A., Couchman J.R., Oh E.-S. Biochemistry 40:8471-8478(2001) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 171-198. |
| [17] | "Molecular roots of degenerate specificity in syntenin's PDZ2 domain: reassessment of the PDZ recognition paradigm." Kang B.S., Cooper D.R., Devedjiev Y., Derewenda U., Derewenda Z.S. Structure 11:845-853(2003) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.85 ANGSTROMS) OF 193-198 IN COMPLEX WITH SDCBP. |
| [18] | "The binding of the PDZ tandem of syntenin to target proteins." Grembecka J., Cierpicki T., Devedjiev Y., Derewenda U., Kang B.S., Bushweller J.H., Derewenda Z.S. Biochemistry 45:3674-3683(2006) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.3 ANGSTROMS) OF 182-198 IN COMPLEX WITH SDCBP. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | X67016 mRNA. Translation: CAA47406.1. D13292 mRNA. Translation: BAA02550.1. D79206 Genomic DNA. Translation: BAA19613.1. AK312507 mRNA. Translation: BAG35408.1. CR542045 mRNA. Translation: CAG46842.1. CR542074 mRNA. Translation: CAG46871.1. AK222695 mRNA. Translation: BAD96415.1. AK223243 mRNA. Translation: BAD96963.1. AL021578 Genomic DNA. Translation: CAA16520.1. CH471077 Genomic DNA. Translation: EAW75861.1. CH471077 Genomic DNA. Translation: EAW75862.1. BC030805 mRNA. Translation: AAH30805.1. AA151028 mRNA. No translation available. AA258502 mRNA. No translation available. | ||||||||||||||||||||||||||||||
| IPI | IPI00011564. | ||||||||||||||||||||||||||||||
| PIR | JC1457. | ||||||||||||||||||||||||||||||
| RefSeq | NP_002990.2. NM_002999.3. | ||||||||||||||||||||||||||||||
| UniGene | Hs.632267. | ||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||
| ProteinModelPortal | P31431. | ||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||
| DIP | DIP-29945N. | ||||||||||||||||||||||||||||||
| IntAct | P31431. 3 interactions. | ||||||||||||||||||||||||||||||
| MINT | MINT-140673. | ||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000361818. | ||||||||||||||||||||||||||||||
Protein family/group databases | |||||||||||||||||||||||||||||||
| TCDB | 9.A.35.1.1. peptide translocating syndecan family. | ||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||
| PhosphoSite | P31431. | ||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||
| DMDM | 2851418. | ||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||
| PaxDb | P31431. | ||||||||||||||||||||||||||||||
| PRIDE | P31431. | ||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||
| DNASU | 6385. | ||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||
| Ensembl | ENST00000372733; ENSP00000361818; ENSG00000124145. | ||||||||||||||||||||||||||||||
| GeneID | 6385. | ||||||||||||||||||||||||||||||
| KEGG | hsa:6385. | ||||||||||||||||||||||||||||||
| UCSC | uc002xnu.3. human. | ||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||
| CTD | 6385. | ||||||||||||||||||||||||||||||
| GeneCards | GC20M043953. | ||||||||||||||||||||||||||||||
| HGNC | HGNC:10661. SDC4. | ||||||||||||||||||||||||||||||
| HPA | CAB013240. HPA005716. | ||||||||||||||||||||||||||||||
| MIM | 600017. gene. | ||||||||||||||||||||||||||||||
| neXtProt | NX_P31431. | ||||||||||||||||||||||||||||||
| PharmGKB | PA35591. | ||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||
| eggNOG | NOG83582. | ||||||||||||||||||||||||||||||
| HOGENOM | HOG000263414. | ||||||||||||||||||||||||||||||
| HOVERGEN | HBG004501. | ||||||||||||||||||||||||||||||
| InParanoid | P31431. | ||||||||||||||||||||||||||||||
| KO | K16338. | ||||||||||||||||||||||||||||||
| OMA | EGRYFSG. | ||||||||||||||||||||||||||||||
| OrthoDB | EOG4MSD0Z. | ||||||||||||||||||||||||||||||
| PhylomeDB | P31431. | ||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | syndecan_pathway. Proteogylcan syndecan-mediated signaling events. syndecan_4_pathway. Syndecan-4-mediated signaling events. | ||||||||||||||||||||||||||||||
| Reactome | REACT_111217. Metabolism. REACT_116125. Disease. | ||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||
| ArrayExpress | P31431. | ||||||||||||||||||||||||||||||
| Bgee | P31431. | ||||||||||||||||||||||||||||||
| CleanEx | HS_SDC4. | ||||||||||||||||||||||||||||||
| Genevestigator | P31431. | ||||||||||||||||||||||||||||||
| GermOnline | ENSG00000124145. Homo sapiens. | ||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||
| InterPro | IPR003585. Neurexin-like. IPR001050. Syndecan. [Graphical view] | ||||||||||||||||||||||||||||||
| PANTHER | PTHR10915. PTHR10915. 1 hit. | ||||||||||||||||||||||||||||||
| Pfam | PF01034. Syndecan. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||
| SMART | SM00294. 4.1m. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||
| PROSITE | PS00964. SYNDECAN. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||
| ChiTaRS | SDC4. human. | ||||||||||||||||||||||||||||||
| EvolutionaryTrace | P31431. | ||||||||||||||||||||||||||||||
| GenomeRNAi | 6385. | ||||||||||||||||||||||||||||||
| NextBio | 24792. | ||||||||||||||||||||||||||||||
| PMAP-CutDB | P31431. | ||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||
Entry information
| Entry name | SDC4_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P31431 Secondary accession number(s): O00773 Q6FGN3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 20 Human chromosome 20: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
