P31350 (RIR2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 140.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Ribonucleoside-diphosphate reductase subunit M2 EC=1.17.4.1 Alternative name(s): Ribonucleotide reductase small chain Ribonucleotide reductase small subunit | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 389 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides. Inhibits Wnt signaling. |
| Catalytic activity | 2'-deoxyribonucleoside diphosphate + thioredoxin disulfide + H2O = ribonucleoside diphosphate + thioredoxin. |
| Cofactor | Binds 2 iron ions per subunit By similarity. |
| Pathway | |
| Subunit structure | Heterodimer of a large and a small subunit. |
| Subcellular location | |
| Post-translational modification | Phosphorylation on Ser-20 relieves the inhibitory effect on Wnt signaling. |
| Miscellaneous | Two distinct regulatory sites have been defined: the specificity site, which controls substrate specificity, and the activity site which regulates overall catalytic activity. A substrate-binding catalytic site, located on M1, is formed only in the presence of the second subunit M2. |
| Sequence similarities | Belongs to the ribonucleoside diphosphate reductase small chain family. |
| Sequence caution | The sequence DA477511 differs from that shown. Reason: Frameshift at position 87. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| CCNF | P41002 | 12 | EBI-2339245,EBI-1207574 | |
| FZR1 | Q9UM11 | 2 | EBI-2339245,EBI-724997 | |
| RRM1 | P23921 | 3 | EBI-2339245,EBI-717006 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P31350-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P31350-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MGRVGGMAQPMGRAGAPKPMGRAGSARRGRFKGCWSEGSPVHPVPAVLSWLLALLRCASTM | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 389 | 389 | Ribonucleoside-diphosphate reductase subunit M2 | PRO_0000190447 | |||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 176 | 1 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 138 | 1 | Iron 1 By similarity | ||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 169 | 1 | Iron 1 By similarity | ||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 169 | 1 | Iron 2 By similarity | ||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 172 | 1 | Iron 1 By similarity | ||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 232 | 1 | Iron 2 By similarity | ||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 266 | 1 | Iron 2 By similarity | ||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 269 | 1 | Iron 2 By similarity | ||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 20 | 1 | Phosphoserine Ref.6 Ref.7 Ref.8 Ref.9 Ref.10 Ref.11 Ref.12 Ref.14 | ||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 33 | 1 | Phosphothreonine Ref.9 Ref.14 | ||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MGRVGGMAQPMGRAGAPKPM GRAGSARRGRFKGCWSEGSP VHPVPAVLSWLLALLRCAST M in isoform 2. | VSP_044917 | |||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 20 | 1 | S → A: Enhances inhibitory effect on Wnt signaling. | ||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 20 | 1 | S → E: Prevents inhibitory effect on Wnt signaling. | ||||||||||||||||||||||||||||||||||||||||||||
| Isoform 2: | |||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 28 | 1 | R → H in DA477511. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 59 | 1 | S → A in DA477511. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 71 – 73 | 3 | |||||||||||||||||||||||||||||||||||||||||||||
| Turn | 77 – 80 | 4 | |||||||||||||||||||||||||||||||||||||||||||||
| Helix | 88 – 99 | 12 | |||||||||||||||||||||||||||||||||||||||||||||
| Helix | 104 – 106 | 3 | |||||||||||||||||||||||||||||||||||||||||||||
| Helix | 110 – 112 | 3 | |||||||||||||||||||||||||||||||||||||||||||||
| Helix | 113 – 118 | 6 | |||||||||||||||||||||||||||||||||||||||||||||
| Helix | 121 – 147 | 27 | |||||||||||||||||||||||||||||||||||||||||||||
| Helix | 149 – 152 | 4 | |||||||||||||||||||||||||||||||||||||||||||||
| Helix | 156 – 183 | 28 | |||||||||||||||||||||||||||||||||||||||||||||
| Helix | 187 – 194 | 8 | |||||||||||||||||||||||||||||||||||||||||||||
| Helix | 196 – 199 | 4 | |||||||||||||||||||||||||||||||||||||||||||||
| Helix | 201 – 203 | 3 | |||||||||||||||||||||||||||||||||||||||||||||
| Helix | 204 – 215 | 12 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 217 – 219 | 3 | |||||||||||||||||||||||||||||||||||||||||||||
| Helix | 221 – 233 | 13 | |||||||||||||||||||||||||||||||||||||||||||||
| Turn | 234 – 236 | 3 | |||||||||||||||||||||||||||||||||||||||||||||
| Helix | 237 – 248 | 12 | |||||||||||||||||||||||||||||||||||||||||||||
| Helix | 253 – 278 | 26 | |||||||||||||||||||||||||||||||||||||||||||||
| Helix | 286 – 305 | 20 | |||||||||||||||||||||||||||||||||||||||||||||
| Helix | 310 – 313 | 4 | |||||||||||||||||||||||||||||||||||||||||||||
| Helix | 317 – 335 | 19 | |||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Sequence analysis of the large and small subunits of human ribonucleotide reductase." Pavloff N., Rivard D., Masson S., Shen S.-H., Mes-Masson A.-M. DNA Seq. 2:227-234(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Mammary carcinoma. |
| [2] | "Characterization of the human ribonucleotide reductase M2 subunit gene; genomic structure and promoter analyses." Zhou B., Yen Y. Cytogenet. Cell Genet. 95:52-59(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-94 (ISOFORM 2). Tissue: Neonatal skin. |
| [4] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Muscle and Skin. |
| [6] | "A probability-based approach for high-throughput protein phosphorylation analysis and site localization." Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-20, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [7] | "Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra." Yu L.-R., Zhu Z., Chan K.C., Issaq H.J., Dimitrov D.S., Veenstra T.D. J. Proteome Res. 6:4150-4162(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-20, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [8] | "Quantitative phosphoproteome profiling of Wnt3a-mediated signaling network: indicating the involvement of ribonucleoside-diphosphate reductase M2 subunit phosphorylation at residue serine 20 in canonical Wnt signal transduction." Tang L.-Y., Deng N., Wang L.-S., Dai J., Wang Z.-L., Jiang X.-S., Li S.-J., Li L., Sheng Q.-H., Wu D.-Q., Li L., Zeng R. Mol. Cell. Proteomics 6:1952-1967(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-20, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [9] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-20 AND THR-33, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [10] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-20, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [11] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-20, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [12] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-20, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [13] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [14] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-20 AND THR-33, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Web resources
| Wikipedia Ribonucleotide reductase entry |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | X59618 mRNA. Translation: CAA42181.1. S40301 mRNA. Translation: AAA09577.1. AY032750 Genomic DNA. Translation: AAK51163.1. AK313719 mRNA. Translation: BAG36462.1. DA477511 mRNA. No translation available. AC104794 Genomic DNA. Translation: AAX93099.1. AC118058 Genomic DNA. No translation available. BC001886 mRNA. Translation: AAH01886.1. BC030154 mRNA. Translation: AAH30154.1. | ||||||||||||||||||||||||||||||||||||
| IPI | IPI00946732. | ||||||||||||||||||||||||||||||||||||
| PIR | S25854. | ||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001025.1. NM_001034.3. NP_001159403.1. NM_001165931.1. | ||||||||||||||||||||||||||||||||||||
| UniGene | Hs.226390. | ||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | P31350. | ||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||
| DIP | DIP-24232N. | ||||||||||||||||||||||||||||||||||||
| IntAct | P31350. 7 interactions. | ||||||||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000302955. | ||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||
| PhosphoSite | P31350. | ||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||
| DMDM | 400979. | ||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||
| PaxDb | P31350. | ||||||||||||||||||||||||||||||||||||
| PRIDE | P31350. | ||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||
| DNASU | 6241. | ||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000304567; ENSP00000302955; ENSG00000171848. ENST00000360566; ENSP00000353770; ENSG00000171848. | ||||||||||||||||||||||||||||||||||||
| GeneID | 6241. | ||||||||||||||||||||||||||||||||||||
| KEGG | hsa:6241. | ||||||||||||||||||||||||||||||||||||
| UCSC | uc021vdr.1. human. | ||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||
| CTD | 6241. | ||||||||||||||||||||||||||||||||||||
| GeneCards | GC02P010262. | ||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:10452. RRM2. | ||||||||||||||||||||||||||||||||||||
| HPA | HPA056994. | ||||||||||||||||||||||||||||||||||||
| MIM | 180390. gene. | ||||||||||||||||||||||||||||||||||||
| neXtProt | NX_P31350. | ||||||||||||||||||||||||||||||||||||
| PharmGKB | PA299. | ||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||
| eggNOG | COG0208. | ||||||||||||||||||||||||||||||||||||
| HOGENOM | HOG000255975. | ||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG001647. | ||||||||||||||||||||||||||||||||||||
| InParanoid | P31350. | ||||||||||||||||||||||||||||||||||||
| KO | K10808. | ||||||||||||||||||||||||||||||||||||
| OMA | YIADWRL. | ||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG4BCDN7. | ||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||
| Reactome | REACT_111217. Metabolism. REACT_115566. Cell Cycle. | ||||||||||||||||||||||||||||||||||||
| UniPathway | UPA00326. | ||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||
| ArrayExpress | P31350. | ||||||||||||||||||||||||||||||||||||
| Bgee | P31350. | ||||||||||||||||||||||||||||||||||||
| CleanEx | HS_RRM2. | ||||||||||||||||||||||||||||||||||||
| Genevestigator | P31350. | ||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000171848. Homo sapiens. | ||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||
| Gene3D | 1.10.620.20. 1 hit. | ||||||||||||||||||||||||||||||||||||
| InterPro | IPR009078. Ferritin-like_SF. IPR012348. RNR-rel. IPR000358. RNR_small. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| PANTHER | PTHR23409. PTHR23409. 1 hit. | ||||||||||||||||||||||||||||||||||||
| Pfam | PF00268. Ribonuc_red_sm. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF47240. Ferritin/RR_like. 1 hit. | ||||||||||||||||||||||||||||||||||||
| PROSITE | PS00368. RIBORED_SMALL. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||
| BindingDB | P31350. | ||||||||||||||||||||||||||||||||||||
| ChEMBL | CHEMBL1954. | ||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | P31350. | ||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 6241. | ||||||||||||||||||||||||||||||||||||
| NextBio | 24237. | ||||||||||||||||||||||||||||||||||||
| PMAP-CutDB | P31350. | ||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | RIR2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P31350 Secondary accession number(s): B2R9B5, J3KP43, Q5WRU7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
