P31007 (DLG1_DROME) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 145.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Disks large 1 tumor suppressor protein | ||||||
| Gene names |
| ||||||
| Organism | Drosophila melanogaster (Fruit fly) [Reference proteome] | ||||||
| Taxonomic identifier | 7227 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Ecdysozoa › Arthropoda › Hexapoda › Insecta › Pterygota › Neoptera › Endopterygota › Diptera › Brachycera › Muscomorpha › Ephydroidea › Drosophilidae › Drosophila › Sophophora › ![]() |
Protein attributes
| Sequence length | 970 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | During embryonic development, some isoforms are essential for proper neuronal differentiation and organization. Required for cell polarity; maintenance of apicobasal polarity. Plays a critical role at septate junctions in cellular growth control during larval development. The presence of a guanylate kinase domain suggests involvement in cellular adhesion as well as signal transduction to control cellular proliferation. Ref.1 Ref.2 Ref.7 |
| Subcellular location | Cytoplasm. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm › cytoskeleton. Cell junction › septate junction. Note: Cytoskeleton- and membrane-associated. Located at the cytoplasmic face of the membrane in the cellular blastoderm and becomes associated with septate junctions which begin to form between epithelial cells at the time of dorsal closure. In adult flies, located at the apical-lateral membrane boundary of epithelial cells. Ref.1 Ref.2 Ref.7 |
| Tissue specificity | During the cellular blastoderm stage, isoform B, isoform F, isoform H, isoform I and isoform L expression is localized to the cell borders. From stage 11 onwards, expression is found predominantly in the developing nervous system: axon bundles in the ventral cord and the brain. Stage 14 and 15 embryos exhibit expression in the developing body wall muscle. Expression in neuropil regions of the CNS and at NMJs persists through to larval development. Other isoforms show expression in embryonic epithelial cells. In larvae, expression is seen as a belt around salivary glands, imaginal disks and proventriculus. Expressed in adult reproductive tissues. In epithelia, coexpressed with scrib throughout development. Ref.1 Ref.2 Ref.7 |
| Developmental stage | Expressed both maternally and zygotically throughout development. Ref.1 |
| Sequence similarities | Belongs to the MAGUK family. Contains 1 guanylate kinase-like domain. Contains 1 L27 domain. Contains 3 PDZ (DHR) domains. Contains 1 SH3 domain. |
| Sequence caution | The sequence AAL39553.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
Alternative products
| This entry describes 9 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform B (identifier: P31007-2) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: Contains the N-terminal domain essential for correct neuronal development. | ||||||
| Isoform A (identifier: P31007-3) The sequence of this isoform differs from the canonical sequence as follows: 1-37: MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERV → MTTRKKKRDGGGSGGGFIKKVSSLFNLDSLHKASSTK 38-205: Missing. 473-473: E → GALNSMGQTV...NRSQSPQPRQ 747-761: FMLCYTQDDANAEGA → NGVVSSTSEIDINNVNNNQSNEPQP | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform E (identifier: P31007-1) Also known as: Dlg-A; D; The sequence of this isoform differs from the canonical sequence as follows: 1-29: MPVKKQEAHRALELLEDYHARLSEPQDRA → MTTRKKKRDGGGSGGGFIKKVSSLFNLDS 30-205: Missing. 473-473: E → GALNSMGQTV...NRSQSPQPRQ 747-761: FMLCYTQDDANAEGA → NGVVSSTSEIDINNVNNNQSNEPQP | ||||||
| Isoform F (identifier: P31007-4) The sequence of this isoform differs from the canonical sequence as follows: 1-7: MPVKKQE → MDSDTDSERE...EEERIADIQK 473-519: EPGSRYASTN...QKGPQGLGFN → AFMLCYTQDD...NDADYRKSSI 520-970: Missing. | ||||||
| Note: Contains the N-terminal domain essential for correct neuronal development. | ||||||
| Isoform G (identifier: P31007-5) The sequence of this isoform differs from the canonical sequence as follows: 1-29: MPVKKQEAHRALELLEDYHARLSEPQDRA → MTTRKKKRDGGGSGGGFIKKVSSLFNLDS 30-205: Missing. 473-473: E → GALNSMGQTV...NRSQSPQPRQ 746-746: P → PNGVVSSTSEIDINNVNNNQSNEPQP | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform H (identifier: P31007-6) The sequence of this isoform differs from the canonical sequence as follows: 93-151: Missing. | ||||||
| Note: Contains the N-terminal domain essential for correct neuronal development. | ||||||
| Isoform I (identifier: P31007-7) Also known as: C; J; The sequence of this isoform differs from the canonical sequence as follows: 93-151: Missing. 206-267: VNGDDSWLYE...ADGRLSINDI → SQIQIQSLTQ...KMLKRAFEST 268-970: Missing. | ||||||
| Note: Contains the N-terminal domain essential for correct neuronal development. | ||||||
| Isoform K (identifier: P31007-9) The sequence of this isoform differs from the canonical sequence as follows: 1-92: MPVKKQEAHR...KDGQAVKIAD → MIDWVSIVRH...GSRYACCCAN 93-151: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform L (identifier: P31007-8) Also known as: S97; The sequence of this isoform differs from the canonical sequence as follows: 93-151: Missing. 205-205: T → TLHKASSTK 761-761: A → GEIIYRVELPDMEQITLIYLENNDADYP | ||||||
| Note: Contains the N-terminal domain essential for correct neuronal development. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 970 | 970 | Disks large 1 tumor suppressor protein | PRO_0000094538 | |||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 4 – 64 | 61 | L27 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 216 – 303 | 88 | PDZ 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 330 – 421 | 92 | PDZ 2 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 506 – 587 | 82 | PDZ 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 620 – 690 | 71 | SH3 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 780 – 955 | 176 | Guanylate kinase-like | ||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 496 | 1 | Phosphoserine Ref.8 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 714 | 1 | Phosphothreonine Ref.8 | ||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 92 | 92 | MPVKK…VKIAD → MIDWVSIVRHSRRRFSNYVG SRSPVRMRRRRRQLTAPPPQ QQQQQHYHQQQQQDQHQSRE RQKKDKEKEKETEKDNESGG GIGSRYACCCAN in isoform K. | VSP_039402 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 37 | 37 | MPVKK…AIERV → MTTRKKKRDGGGSGGGFIKK VSSLFNLDSLHKASSTK in isoform A. | VSP_011403 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 29 | 29 | MPVKK…PQDRA → MTTRKKKRDGGGSGGGFIKK VSSLFNLDS in isoform E and isoform G. | VSP_011402 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 7 | 7 | MPVKKQE → MDSDTDSEREKSSDPNEGLL SSDDKTFHDDDEPAEDSSPA DDEEEPEEEECLLPQKKAQI RCDQDQPPLVVLVQPSAEAI EVRQEIDDTNPVAVAAKASD MDGDSQLEVMEHQMETVTEP DPEPPKCPTSLRDSVRESVE CFYSAQDLLEYGHMLSSTSM VRTPDVESGYFEKSESDASR DEWEGPSSSSSGAARCRLLS GISGLSVSSSSRHSAEGLRM ELSRFRTMIETLERESLEKS QSELQLKAKSKAKPKPKQRS HVQDAAGESGSEQGSERGFW STIFGQAGLAISQDEEERIA DIQK in isoform F. | VSP_011401 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 30 – 205 | 176 | Missing in isoform E and isoform G. | VSP_011404 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 38 – 205 | 168 | Missing in isoform A. | VSP_011405 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 93 – 151 | 59 | Missing in isoform I, isoform H, isoform K and isoform L. | VSP_011406 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 205 | 1 | T → TLHKASSTK in isoform L. | VSP_011407 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 206 – 267 | 62 | VNGDD…SINDI → SQIQIQSLTQTYPNAHQRKR VLVSLHPHQHQHQSQIQHQH HYQLRHNNGIQAKMLKRAFE ST in isoform I. | VSP_011408 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 268 – 970 | 703 | Missing in isoform I. | VSP_011409 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 473 – 519 | 47 | EPGSR…GLGFN → AFMLCYTQDDANAEGGEIIY RVELPDMEQITLIYLENNDA DYRKSSI in isoform F. | VSP_011411 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 473 | 1 | E → GALNSMGQTVVDSPSIPQAA AAVAAAANASASASVIASNN TISNTTVTTVTATATASNSS SKLPPSLGANSSISISNSNS NSNSNNINNINSINNNNSSS SSTTATVAAATPTAASAAAA AASSPPANSFYNNASMPALP VESNQTNNRSQSPQPRQ in isoform A, isoform E and isoform G. | VSP_011410 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 520 – 970 | 451 | Missing in isoform F. | VSP_011412 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 746 | 1 | P → PNGVVSSTSEIDINNVNNNQ SNEPQP in isoform G. | VSP_011413 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 747 – 761 | 15 | FMLCY…NAEGA → NGVVSSTSEIDINNVNNNQS NEPQP in isoform A and isoform E. | VSP_011414 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 761 | 1 | A → GEIIYRVELPDMEQITLIYL ENNDADYP in isoform L. | VSP_011415 | |||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 365 | 1 | M → T in AAA28468. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 365 | 1 | M → T in AAQ01226. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 369 | 1 | A → R in AAA28468. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 369 | 1 | A → R in AAQ01226. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 395 | 1 | E → G in ACV53090. Ref.6 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Isoform E: | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 355 | 1 | S → D in AAA28468. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 624 – 627 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 651 – 656 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 659 – 665 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 679 – 681 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 683 – 691 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 769 – 776 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 783 – 787 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 790 – 800 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 802 – 804 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 822 – 824 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 832 – 840 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 844 – 850 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 853 – 858 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 859 – 868 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 871 – 874 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 879 – 886 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 892 – 896 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 901 – 906 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 915 – 930 | 16 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 931 – 933 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 935 – 938 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 943 – 957 | 15 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 960 – 965 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The discs-large tumor suppressor gene of Drosophila encodes a guanylate kinase homolog localized at septate junctions." Woods D.F., Bryant P.J. Cell 66:451-464(1991) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM E), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE. Strain: Oregon-R. Tissue: Embryo. |
| [2] | "Novel isoforms of Dlg are fundamental for neuronal development in Drosophila." Mendoza C., Olguin P., Lafferte G., Thomas U., Ebitsch S., Gundelfinger E.D., Kukuljan M., Sierralta J. J. Neurosci. 23:2093-2101(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS B; F; H; I AND L), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. Tissue: Embryo. |
| [3] | "The genome sequence of Drosophila melanogaster." Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D. Venter J.C.Science 287:2185-2195(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: Berkeley. |
| [4] | "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review." Misra S., Crosby M.A., Mungall C.J., Matthews B.B., Campbell K.S., Hradecky P., Huang Y., Kaminker J.S., Millburn G.H., Prochnik S.E., Smith C.D., Tupy J.L., Whitfield E.J., Bayraktaroglu L., Berman B.P., Bettencourt B.R., Celniker S.E., de Grey A.D.N.J. Lewis S.E.Genome Biol. 3:RESEARCH0083.1-RESEARCH0083.22(2002) [PubMed] [Europe PMC] [Abstract] Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING. Strain: Berkeley. |
| [5] | "A Drosophila full-length cDNA resource." Stapleton M., Carlson J.W., Brokstein P., Yu C., Champe M., George R.A., Guarin H., Kronmiller B., Pacleb J.M., Park S., Wan K.H., Rubin G.M., Celniker S.E. Genome Biol. 3:RESEARCH0080.1-RESEARCH0080.8(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS F AND I), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 711-970 (ISOFORM G). Strain: Berkeley. Tissue: Embryo and Head. |
| [6] | Carlson J.W., Booth B., Frise E., Park S., Wan K.H., Yu C., Celniker S.E. Submitted (SEP-2009) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM G). Strain: Berkeley. Tissue: Embryo. |
| [7] | "Cooperative regulation of cell polarity and growth by Drosophila tumor suppressors." Bilder D., Li M., Perrimon N. Science 289:113-116(2000) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [8] | "Phosphoproteome analysis of Drosophila melanogaster embryos." Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P. J. Proteome Res. 7:1675-1682(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-496 AND THR-714, MASS SPECTROMETRY. Tissue: Embryo. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | M73529 mRNA. Translation: AAA28468.1. AY332243 mRNA. Translation: AAQ01226.1. AE014298 Genomic DNA. Translation: AAF48037.2. AE014298 Genomic DNA. Translation: AAF48038.2. AE014298 Genomic DNA. Translation: AAF48039.2. AE014298 Genomic DNA. Translation: AAN09630.1. AE014298 Genomic DNA. Translation: AAS65308.1. AE014298 Genomic DNA. Translation: AAS65309.1. AE014298 Genomic DNA. Translation: AAS65310.1. AE014298 Genomic DNA. Translation: AAS65311.1. AE014298 Genomic DNA. Translation: AAS65312.1. AE014298 Genomic DNA. Translation: AAS65313.1. AE014298 Genomic DNA. Translation: ABW09394.1. AE014298 Genomic DNA. Translation: ABW09395.1. AY059433 mRNA. Translation: AAL13339.1. AY069408 mRNA. Translation: AAL39553.1. Different initiation. AY075410 mRNA. Translation: AAL68235.1. BT099726 mRNA. Translation: ACV53090.1. | ||||||||||||
| PIR | A39651. | ||||||||||||
| RefSeq | NP_001096955.1. NM_001103485.3. NP_001096956.1. NM_001103486.3. NP_001162719.1. NM_001169248.2. NP_001245623.1. NM_001258694.2. NP_001259447.1. NM_001272518.1. NP_511120.2. NM_078565.5. NP_727518.1. NM_167280.2. NP_727519.1. NM_167281.2. NP_727520.1. NM_167282.4. NP_996402.1. NM_206679.2. NP_996403.1. NM_206680.2. NP_996404.1. NM_206681.4. NP_996405.1. NM_206682.4. NP_996406.1. NM_206683.4. NP_996407.1. NM_206684.4. | ||||||||||||
| UniGene | Dm.4352. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | P31007. | ||||||||||||
| SMR | P31007. Positions 2-65, 214-970. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | P31007. 16 interactions. | ||||||||||||
| MINT | MINT-287852. | ||||||||||||
| STRING | 7227.FBpp0089352. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | P31007. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| EnsemblMetazoa | FBtr0073488; FBpp0089351; FBgn0001624. | ||||||||||||
| GeneID | 32083. | ||||||||||||
| KEGG | dme:Dmel_CG1725. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 1739. | ||||||||||||
| FlyBase | FBgn0001624. dlg1. | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | COG0194. | ||||||||||||
| GeneTree | ENSGT00560000077048. | ||||||||||||
| InParanoid | P31007. | ||||||||||||
| KO | K12076. | ||||||||||||
| OMA | WNRRITE. | ||||||||||||
| OrthoDB | EOG4X0K7Q. | ||||||||||||
Gene expression databases | |||||||||||||
| Bgee | P31007. | ||||||||||||
| GermOnline | CG1725. Drosophila melanogaster. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR008144. Guanylate_kin. IPR008145. Guanylate_kin/L-typ_Ca_channel. IPR020590. Guanylate_kinase_CS. IPR004172. L27. IPR015143. L27_1. IPR001478. PDZ. IPR001452. SH3_domain. [Graphical view] | ||||||||||||
| Pfam | PF00625. Guanylate_kin. 1 hit. PF09058. L27_1. 1 hit. PF00595. PDZ. 3 hits. PF00018. SH3_1. 1 hit. [Graphical view] | ||||||||||||
| SMART | SM00072. GuKc. 1 hit. SM00569. L27. 1 hit. SM00228. PDZ. 3 hits. SM00326. SH3. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF50156. PDZ. 3 hits. SSF50044. SH3. 1 hit. | ||||||||||||
| PROSITE | PS00856. GUANYLATE_KINASE_1. 1 hit. PS50052. GUANYLATE_KINASE_2. 1 hit. PS51022. L27. 1 hit. PS50106. PDZ. 3 hits. PS50002. SH3. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| ChiTaRS | dlg1. drosophila. | ||||||||||||
| GenomeRNAi | 32083. | ||||||||||||
| NextBio | 776723. | ||||||||||||
Entry information
| Entry name | DLG1_DROME | ||||||||
| Accession | Primary (citable) accession number: P31007 Secondary accession number(s): A4V4A8 Q9VYZ6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Drosophila annotation project | ||||||||
Relevant documents
| Drosophila Drosophila: entries, gene names and cross-references to FlyBase |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
