Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P31007

- DLG1_DROME

UniProt

P31007 - DLG1_DROME

Protein

Disks large 1 tumor suppressor protein

Gene

dlg1

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 160 (01 Oct 2014)
      Sequence version 2 (31 Aug 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    During embryonic development, some isoforms are essential for proper neuronal differentiation and organization. Required for cell polarity; maintenance of apicobasal polarity. Plays a critical role at septate junctions in cellular growth control during larval development. The presence of a guanylate kinase domain suggests involvement in cellular adhesion as well as signal transduction to control cellular proliferation.3 Publications

    GO - Molecular functioni

    1. epidermal growth factor receptor binding Source: FlyBase
    2. guanylate kinase activity Source: FlyBase
    3. protein binding Source: IntAct
    4. signal transducer activity Source: UniProtKB-KW
    5. structural molecule activity Source: FlyBase

    GO - Biological processi

    1. anterior/posterior axis specification, follicular epithelium Source: BHF-UCL
    2. asymmetric protein localization Source: FlyBase
    3. asymmetric protein localization involved in cell fate determination Source: FlyBase
    4. basal protein localization Source: FlyBase
    5. cell adhesion Source: UniProtKB-KW
    6. cell fate commitment involved in pattern specification Source: BHF-UCL
    7. cell fate specification Source: BHF-UCL
    8. cell proliferation Source: FlyBase
    9. cytoskeleton organization Source: FlyBase
    10. dorsal closure Source: FlyBase
    11. establishment of mitotic spindle orientation Source: FlyBase
    12. establishment of spindle orientation Source: FlyBase
    13. establishment or maintenance of epithelial cell apical/basal polarity Source: FlyBase
    14. establishment or maintenance of neuroblast polarity Source: FlyBase
    15. establishment or maintenance of polarity of embryonic epithelium Source: FlyBase
    16. establishment or maintenance of polarity of follicular epithelium Source: FlyBase
    17. establishment or maintenance of polarity of larval imaginal disc epithelium Source: FlyBase
    18. gravitaxis Source: FlyBase
    19. locomotor rhythm Source: FlyBase
    20. male courtship behavior Source: FlyBase
    21. mating behavior Source: FlyBase
    22. morphogenesis of an epithelium Source: FlyBase
    23. morphogenesis of a polarized epithelium Source: FlyBase
    24. morphogenesis of follicular epithelium Source: FlyBase
    25. morphogenesis of larval imaginal disc epithelium Source: FlyBase
    26. negative regulation of cell proliferation Source: FlyBase
    27. negative regulation of transcription from RNA polymerase II promoter Source: BHF-UCL
    28. nervous system development Source: FlyBase
    29. nucleotide phosphorylation Source: GOC
    30. ovarian follicle cell development Source: BHF-UCL
    31. pole plasm protein localization Source: BHF-UCL
    32. positive phototaxis Source: FlyBase
    33. positive regulation of synaptic growth at neuromuscular junction Source: FlyBase
    34. protein localization Source: FlyBase
    35. regulation of border follicle cell delamination Source: FlyBase
    36. regulation of cell cycle Source: FlyBase
    37. regulation of cell proliferation Source: FlyBase
    38. regulation of epidermal growth factor receptor signaling pathway Source: BHF-UCL
    39. regulation of JAK-STAT cascade Source: BHF-UCL
    40. regulation of Notch signaling pathway Source: BHF-UCL
    41. septate junction assembly Source: FlyBase
    42. synaptic growth at neuromuscular junction Source: FlyBase
    43. synaptic transmission Source: FlyBase

    Keywords - Molecular functioni

    Developmental protein, Transducer

    Keywords - Biological processi

    Cell adhesion, Differentiation, Neurogenesis

    Enzyme and pathway databases

    SignaLinkiP31007.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Disks large 1 tumor suppressor protein
    Gene namesi
    Name:dlg1
    Synonyms:l(1)dlg1
    ORF Names:CG1725
    OrganismiDrosophila melanogaster (Fruit fly)
    Taxonomic identifieri7227 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
    ProteomesiUP000000803: Chromosome X

    Organism-specific databases

    FlyBaseiFBgn0001624. dlg1.

    Subcellular locationi

    Cytoplasm. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasmcytoskeleton. Cell junctionseptate junction
    Note: Cytoskeleton- and membrane-associated. Located at the cytoplasmic face of the membrane in the cellular blastoderm and becomes associated with septate junctions which begin to form between epithelial cells at the time of dorsal closure. In adult flies, located at the apical-lateral membrane boundary of epithelial cells.

    GO - Cellular componenti

    1. apical cortex Source: FlyBase
    2. apicolateral plasma membrane Source: FlyBase
    3. basolateral plasma membrane Source: FlyBase
    4. cell cortex Source: FlyBase
    5. cytoskeleton Source: UniProtKB-SubCell
    6. lateral plasma membrane Source: FlyBase
    7. membrane Source: FlyBase
    8. neuromuscular junction Source: FlyBase
    9. perinuclear region of cytoplasm Source: FlyBase
    10. plasma membrane Source: FlyBase
    11. postsynaptic membrane Source: FlyBase
    12. septate junction Source: FlyBase
    13. smooth septate junction Source: FlyBase
    14. synapse Source: FlyBase
    15. terminal bouton Source: FlyBase
    16. type Ib terminal bouton Source: FlyBase

    Keywords - Cellular componenti

    Cell junction, Cell membrane, Cytoplasm, Cytoskeleton, Membrane

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 970970Disks large 1 tumor suppressor proteinPRO_0000094538Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei496 – 4961Phosphoserine1 Publication
    Modified residuei714 – 7141Phosphothreonine1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    PaxDbiP31007.

    Expressioni

    Tissue specificityi

    During the cellular blastoderm stage, isoform B, isoform F, isoform H, isoform I and isoform L expression is localized to the cell borders. From stage 11 onwards, expression is found predominantly in the developing nervous system: axon bundles in the ventral cord and the brain. Stage 14 and 15 embryos exhibit expression in the developing body wall muscle. Expression in neuropil regions of the CNS and at NMJs persists through to larval development. Other isoforms show expression in embryonic epithelial cells. In larvae, expression is seen as a belt around salivary glands, imaginal disks and proventriculus. Expressed in adult reproductive tissues. In epithelia, coexpressed with scrib throughout development.3 Publications

    Developmental stagei

    Expressed both maternally and zygotically throughout development.1 Publication

    Gene expression databases

    BgeeiP31007.

    Interactioni

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    gukhQ4AB304EBI-389374,EBI-8282973
    gukhQ9VE1311EBI-389394,EBI-3414026

    Protein-protein interaction databases

    BioGridi58494. 21 interactions.
    DIPiDIP-31531N.
    IntActiP31007. 19 interactions.
    MINTiMINT-287852.
    STRINGi7227.FBpp0089352.

    Structurei

    Secondary structure

    1
    970
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi624 – 6274
    Beta strandi651 – 6566
    Beta strandi659 – 6657
    Beta strandi679 – 6813
    Helixi683 – 6919
    Beta strandi769 – 7768
    Beta strandi783 – 7875
    Helixi790 – 80011
    Turni802 – 8043
    Turni822 – 8243
    Helixi832 – 8409
    Beta strandi844 – 8507
    Beta strandi853 – 8586
    Helixi859 – 86810
    Beta strandi871 – 8744
    Helixi879 – 8868
    Beta strandi892 – 8965
    Helixi901 – 9066
    Helixi915 – 93016
    Turni931 – 9333
    Beta strandi935 – 9384
    Helixi943 – 95715
    Beta strandi960 – 9656

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    3TVTX-ray1.60A618-970[»]
    ProteinModelPortaliP31007.
    SMRiP31007. Positions 2-65, 214-970.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini4 – 6461L27PROSITE-ProRule annotationAdd
    BLAST
    Domaini216 – 30388PDZ 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini330 – 42192PDZ 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini506 – 58782PDZ 3PROSITE-ProRule annotationAdd
    BLAST
    Domaini620 – 69071SH3PROSITE-ProRule annotationAdd
    BLAST
    Domaini780 – 955176Guanylate kinase-likePROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Belongs to the MAGUK family.Curated
    Contains 1 guanylate kinase-like domain.PROSITE-ProRule annotation
    Contains 1 L27 domain.PROSITE-ProRule annotation
    Contains 3 PDZ (DHR) domains.PROSITE-ProRule annotation
    Contains 1 SH3 domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat, SH3 domain

    Phylogenomic databases

    eggNOGiCOG0194.
    GeneTreeiENSGT00660000095130.
    InParanoidiP31007.
    KOiK12076.
    OMAiPMINDEP.
    OrthoDBiEOG79GT6P.
    PhylomeDBiP31007.

    Family and domain databases

    Gene3Di2.30.42.10. 3 hits.
    3.40.50.300. 2 hits.
    InterProiIPR016313. DLG1.
    IPR008145. GK/Ca_channel_bsu.
    IPR008144. Guanylate_kin-like.
    IPR020590. Guanylate_kinase_CS.
    IPR004172. L27.
    IPR015143. L27_1.
    IPR027417. P-loop_NTPase.
    IPR001478. PDZ.
    IPR001452. SH3_domain.
    [Graphical view]
    PANTHERiPTHR23119. PTHR23119. 1 hit.
    PfamiPF00625. Guanylate_kin. 1 hit.
    PF09058. L27_1. 1 hit.
    PF00595. PDZ. 3 hits.
    PF00018. SH3_1. 1 hit.
    [Graphical view]
    SMARTiSM00072. GuKc. 1 hit.
    SM00569. L27. 1 hit.
    SM00228. PDZ. 3 hits.
    SM00326. SH3. 1 hit.
    [Graphical view]
    SUPFAMiSSF50044. SSF50044. 2 hits.
    SSF50156. SSF50156. 3 hits.
    SSF52540. SSF52540. 1 hit.
    PROSITEiPS00856. GUANYLATE_KINASE_1. 1 hit.
    PS50052. GUANYLATE_KINASE_2. 1 hit.
    PS51022. L27. 1 hit.
    PS50106. PDZ. 3 hits.
    PS50002. SH3. 1 hit.
    [Graphical view]

    Sequences (9)i

    Sequence statusi: Complete.

    This entry describes 9 isoformsi produced by alternative splicing. Align

    Isoform B (identifier: P31007-2) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MPVKKQEAHR ALELLEDYHA RLSEPQDRAL RIAIERVIRI FKSRLFQALL    50
    DIQEFYELTL LDDSKSIQQK TAETLQIATK WEKDGQAVKI ADFIKSSNLN 100
    RNCAYEFNND ASSNQTNQSA LNQNPIANNV SAQAQAEALS RTFKSELEEI 150
    LNQRMRIESD TENAKEPTVE QQQKQQQAQQ RSSRSPQQQN PQQQQGSKSR 200
    SGSQTVNGDD SWLYEDIQLE RGNSGLGFSI AGGTDNPHIG TDTSIYITKL 250
    ISGGAAAADG RLSINDIIVS VNDVSVVDVP HASAVDALKK AGNVVKLHVK 300
    RKRGTATTPA AGSAAGDARD SAASGPKVIE IDLVKGGKGL GFSIAGGIGN 350
    QHIPGDNGIY VTKLMDGGAA QVDGRLSIGD KLIAVRTNGS EKNLENVTHE 400
    LAVATLKSIT DKVTLIIGKT QHLTTSASGG GGGGLSSGQQ LSQSQSQLAT 450
    SQSQSQVHQQ QHATPMVNSQ STEPGSRYAS TNVLAAVPPG TPRAVSTEDI 500
    TREPRTITIQ KGPQGLGFNI VGGEDGQGIY VSFILAGGPA DLGSELKRGD 550
    QLLSVNNVNL THATHEEAAQ ALKTSGGVVT LLAQYRPEEY NRFEARIQEL 600
    KQQAALGAGG SGTLLRTTQK RSLYVRALFD YDPNRDDGLP SRGLPFKHGD 650
    ILHVTNASDD EWWQARRVLG DNEDEQIGIV PSKRRWERKM RARDRSVKFQ 700
    GHAAANNNLD KQSTLDRKKK NFTFSRKFPF MKSRDEKNED GSDQEPFMLC 750
    YTQDDANAEG ASEENVLSYE AVQRLSINYT RPVIILGPLK DRINDDLISE 800
    YPDKFGSCVP HTTRPKREYE VDGRDYHFVS SREQMERDIQ NHLFIEAGQY 850
    NDNLYGTSVA SVREVAEKGK HCILDVSGNA IKRLQVAQLY PVAVFIKPKS 900
    VDSVMEMNRR MTEEQAKKTY ERAIKMEQEF GEYFTGVVQG DTIEEIYSKV 950
    KSMIWSQSGP TIWVPSKESL 970

    Note: Contains the N-terminal domain essential for correct neuronal development.

    Length:970
    Mass (Da):106,673
    Last modified:August 31, 2004 - v2
    Checksum:i544D1E1AD03B0674
    GO
    Isoform A (identifier: P31007-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-37: MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERV → MTTRKKKRDGGGSGGGFIKKVSSLFNLDSLHKASSTK
         38-205: Missing.
         473-473: E → GALNSMGQTV...NRSQSPQPRQ
         747-761: FMLCYTQDDANAEGA → NGVVSSTSEIDINNVNNNQSNEPQP

    Note: No experimental confirmation available.

    Show »
    Length:968
    Mass (Da):103,239
    Checksum:iE641D9BE7669331C
    GO
    Isoform E (identifier: P31007-1) [UniParc]FASTAAdd to Basket

    Also known as: Dlg-A, D

    The sequence of this isoform differs from the canonical sequence as follows:
         1-29: MPVKKQEAHRALELLEDYHARLSEPQDRA → MTTRKKKRDGGGSGGGFIKKVSSLFNLDS
         30-205: Missing.
         473-473: E → GALNSMGQTV...NRSQSPQPRQ
         747-761: FMLCYTQDDANAEGA → NGVVSSTSEIDINNVNNNQSNEPQP

    Show »
    Length:960
    Mass (Da):102,386
    Checksum:i26E9B6026226BDA3
    GO
    Isoform F (identifier: P31007-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-7: MPVKKQE → MDSDTDSERE...EEERIADIQK
         473-519: EPGSRYASTN...QKGPQGLGFN → AFMLCYTQDD...NDADYRKSSI
         520-970: Missing.

    Note: Contains the N-terminal domain essential for correct neuronal development.

    Show »
    Length:816
    Mass (Da):88,662
    Checksum:i35894E1555DE5AAE
    GO
    Isoform G (identifier: P31007-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-29: MPVKKQEAHRALELLEDYHARLSEPQDRA → MTTRKKKRDGGGSGGGFIKKVSSLFNLDS
         30-205: Missing.
         473-473: E → GALNSMGQTV...NRSQSPQPRQ
         746-746: P → PNGVVSSTSEIDINNVNNNQSNEPQP

    Note: No experimental confirmation available.

    Show »
    Length:975
    Mass (Da):104,016
    Checksum:i15D466336AA4194C
    GO
    Isoform H (identifier: P31007-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         93-151: Missing.

    Note: Contains the N-terminal domain essential for correct neuronal development.

    Show »
    Length:911
    Mass (Da):100,171
    Checksum:i47ACCA6E52AD1168
    GO
    Isoform I (identifier: P31007-7) [UniParc]FASTAAdd to Basket

    Also known as: C, J

    The sequence of this isoform differs from the canonical sequence as follows:
         93-151: Missing.
         206-267: VNGDDSWLYE...ADGRLSINDI → SQIQIQSLTQ...KMLKRAFEST
         268-970: Missing.

    Note: Contains the N-terminal domain essential for correct neuronal development.

    Show »
    Length:208
    Mass (Da):24,378
    Checksum:iBB8F4B44E9DE2562
    GO
    Isoform K (identifier: P31007-9) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-92: MPVKKQEAHR...KDGQAVKIAD → MIDWVSIVRH...GSRYACCCAN
         93-151: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:911
    Mass (Da):100,458
    Checksum:i6FE13A27211F2122
    GO
    Isoform L (identifier: P31007-8) [UniParc]FASTAAdd to Basket

    Also known as: S97

    The sequence of this isoform differs from the canonical sequence as follows:
         93-151: Missing.
         205-205: T → TLHKASSTK
         761-761: A → GEIIYRVELPDMEQITLIYLENNDADYP

    Note: Contains the N-terminal domain essential for correct neuronal development.

    Show »
    Length:946
    Mass (Da):104,263
    Checksum:i6BAFDD6BE66191B7
    GO

    Sequence cautioni

    The sequence AAL39553.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti365 – 3651M → T in AAA28468. (PubMed:1651169)Curated
    Sequence conflicti365 – 3651M → T in AAQ01226. (PubMed:12657668)Curated
    Sequence conflicti369 – 3691A → R in AAA28468. (PubMed:1651169)Curated
    Sequence conflicti369 – 3691A → R in AAQ01226. (PubMed:12657668)Curated
    Sequence conflicti395 – 3951E → G in ACV53090. 1 PublicationCurated
    Isoform E (identifier: P31007-1)
    Sequence conflicti355 – 3551S → D in AAA28468. (PubMed:1651169)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 9292MPVKK…VKIAD → MIDWVSIVRHSRRRFSNYVG SRSPVRMRRRRRQLTAPPPQ QQQQQHYHQQQQQDQHQSRE RQKKDKEKEKETEKDNESGG GIGSRYACCCAN in isoform K. CuratedVSP_039402Add
    BLAST
    Alternative sequencei1 – 3737MPVKK…AIERV → MTTRKKKRDGGGSGGGFIKK VSSLFNLDSLHKASSTK in isoform A. CuratedVSP_011403Add
    BLAST
    Alternative sequencei1 – 2929MPVKK…PQDRA → MTTRKKKRDGGGSGGGFIKK VSSLFNLDS in isoform E and isoform G. 3 PublicationsVSP_011402Add
    BLAST
    Alternative sequencei1 – 77MPVKKQE → MDSDTDSEREKSSDPNEGLL SSDDKTFHDDDEPAEDSSPA DDEEEPEEEECLLPQKKAQI RCDQDQPPLVVLVQPSAEAI EVRQEIDDTNPVAVAAKASD MDGDSQLEVMEHQMETVTEP DPEPPKCPTSLRDSVRESVE CFYSAQDLLEYGHMLSSTSM VRTPDVESGYFEKSESDASR DEWEGPSSSSSGAARCRLLS GISGLSVSSSSRHSAEGLRM ELSRFRTMIETLERESLEKS QSELQLKAKSKAKPKPKQRS HVQDAAGESGSEQGSERGFW STIFGQAGLAISQDEEERIA DIQK in isoform F. 2 PublicationsVSP_011401
    Alternative sequencei30 – 205176Missing in isoform E and isoform G. 3 PublicationsVSP_011404Add
    BLAST
    Alternative sequencei38 – 205168Missing in isoform A. CuratedVSP_011405Add
    BLAST
    Alternative sequencei93 – 15159Missing in isoform I, isoform H, isoform K and isoform L. 2 PublicationsVSP_011406Add
    BLAST
    Alternative sequencei205 – 2051T → TLHKASSTK in isoform L. 1 PublicationVSP_011407
    Alternative sequencei206 – 26762VNGDD…SINDI → SQIQIQSLTQTYPNAHQRKR VLVSLHPHQHQHQSQIQHQH HYQLRHNNGIQAKMLKRAFE ST in isoform I. 2 PublicationsVSP_011408Add
    BLAST
    Alternative sequencei268 – 970703Missing in isoform I. 2 PublicationsVSP_011409Add
    BLAST
    Alternative sequencei473 – 51947EPGSR…GLGFN → AFMLCYTQDDANAEGGEIIY RVELPDMEQITLIYLENNDA DYRKSSI in isoform F. 2 PublicationsVSP_011411Add
    BLAST
    Alternative sequencei473 – 4731E → GALNSMGQTVVDSPSIPQAA AAVAAAANASASASVIASNN TISNTTVTTVTATATASNSS SKLPPSLGANSSISISNSNS NSNSNNINNINSINNNNSSS SSTTATVAAATPTAASAAAA AASSPPANSFYNNASMPALP VESNQTNNRSQSPQPRQ in isoform A, isoform E and isoform G. 3 PublicationsVSP_011410
    Alternative sequencei520 – 970451Missing in isoform F. 2 PublicationsVSP_011412Add
    BLAST
    Alternative sequencei746 – 7461P → PNGVVSSTSEIDINNVNNNQ SNEPQP in isoform G. 2 PublicationsVSP_011413
    Alternative sequencei747 – 76115FMLCY…NAEGA → NGVVSSTSEIDINNVNNNQS NEPQP in isoform A and isoform E. 1 PublicationVSP_011414Add
    BLAST
    Alternative sequencei761 – 7611A → GEIIYRVELPDMEQITLIYL ENNDADYP in isoform L. 1 PublicationVSP_011415

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M73529 mRNA. Translation: AAA28468.1.
    AY332243 mRNA. Translation: AAQ01226.1.
    AE014298 Genomic DNA. Translation: AAF48037.2.
    AE014298 Genomic DNA. Translation: AAF48038.2.
    AE014298 Genomic DNA. Translation: AAF48039.2.
    AE014298 Genomic DNA. Translation: AAN09630.1.
    AE014298 Genomic DNA. Translation: AAS65308.1.
    AE014298 Genomic DNA. Translation: AAS65309.1.
    AE014298 Genomic DNA. Translation: AAS65310.1.
    AE014298 Genomic DNA. Translation: AAS65311.1.
    AE014298 Genomic DNA. Translation: AAS65312.1.
    AE014298 Genomic DNA. Translation: AAS65313.1.
    AE014298 Genomic DNA. Translation: ABW09394.1.
    AE014298 Genomic DNA. Translation: ABW09395.1.
    AY059433 mRNA. Translation: AAL13339.1.
    AY069408 mRNA. Translation: AAL39553.1. Different initiation.
    AY075410 mRNA. Translation: AAL68235.1.
    BT099726 mRNA. Translation: ACV53090.1.
    PIRiA39651.
    RefSeqiNP_001096955.1. NM_001103485.3. [P31007-9]
    NP_001096956.1. NM_001103486.3. [P31007-8]
    NP_001162719.1. NM_001169248.2. [P31007-1]
    NP_001245623.1. NM_001258694.2. [P31007-5]
    NP_001259447.1. NM_001272518.1. [P31007-1]
    NP_511120.2. NM_078565.5. [P31007-1]
    NP_727518.1. NM_167280.2. [P31007-7]
    NP_727519.1. NM_167281.2. [P31007-4]
    NP_727520.1. NM_167282.4. [P31007-3]
    NP_996402.1. NM_206679.2. [P31007-7]
    NP_996403.1. NM_206680.2. [P31007-7]
    NP_996404.1. NM_206681.4. [P31007-6]
    NP_996405.1. NM_206682.4. [P31007-5]
    NP_996406.1. NM_206683.4. [P31007-2]
    NP_996407.1. NM_206684.4. [P31007-1]
    UniGeneiDm.4352.

    Genome annotation databases

    EnsemblMetazoaiFBtr0073488; FBpp0089351; FBgn0001624. [P31007-2]
    GeneIDi32083.
    KEGGidme:Dmel_CG1725.
    UCSCiCG1725-RI. d. melanogaster.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M73529 mRNA. Translation: AAA28468.1 .
    AY332243 mRNA. Translation: AAQ01226.1 .
    AE014298 Genomic DNA. Translation: AAF48037.2 .
    AE014298 Genomic DNA. Translation: AAF48038.2 .
    AE014298 Genomic DNA. Translation: AAF48039.2 .
    AE014298 Genomic DNA. Translation: AAN09630.1 .
    AE014298 Genomic DNA. Translation: AAS65308.1 .
    AE014298 Genomic DNA. Translation: AAS65309.1 .
    AE014298 Genomic DNA. Translation: AAS65310.1 .
    AE014298 Genomic DNA. Translation: AAS65311.1 .
    AE014298 Genomic DNA. Translation: AAS65312.1 .
    AE014298 Genomic DNA. Translation: AAS65313.1 .
    AE014298 Genomic DNA. Translation: ABW09394.1 .
    AE014298 Genomic DNA. Translation: ABW09395.1 .
    AY059433 mRNA. Translation: AAL13339.1 .
    AY069408 mRNA. Translation: AAL39553.1 . Different initiation.
    AY075410 mRNA. Translation: AAL68235.1 .
    BT099726 mRNA. Translation: ACV53090.1 .
    PIRi A39651.
    RefSeqi NP_001096955.1. NM_001103485.3. [P31007-9 ]
    NP_001096956.1. NM_001103486.3. [P31007-8 ]
    NP_001162719.1. NM_001169248.2. [P31007-1 ]
    NP_001245623.1. NM_001258694.2. [P31007-5 ]
    NP_001259447.1. NM_001272518.1. [P31007-1 ]
    NP_511120.2. NM_078565.5. [P31007-1 ]
    NP_727518.1. NM_167280.2. [P31007-7 ]
    NP_727519.1. NM_167281.2. [P31007-4 ]
    NP_727520.1. NM_167282.4. [P31007-3 ]
    NP_996402.1. NM_206679.2. [P31007-7 ]
    NP_996403.1. NM_206680.2. [P31007-7 ]
    NP_996404.1. NM_206681.4. [P31007-6 ]
    NP_996405.1. NM_206682.4. [P31007-5 ]
    NP_996406.1. NM_206683.4. [P31007-2 ]
    NP_996407.1. NM_206684.4. [P31007-1 ]
    UniGenei Dm.4352.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    3TVT X-ray 1.60 A 618-970 [» ]
    ProteinModelPortali P31007.
    SMRi P31007. Positions 2-65, 214-970.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 58494. 21 interactions.
    DIPi DIP-31531N.
    IntActi P31007. 19 interactions.
    MINTi MINT-287852.
    STRINGi 7227.FBpp0089352.

    Proteomic databases

    PaxDbi P31007.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    EnsemblMetazoai FBtr0073488 ; FBpp0089351 ; FBgn0001624 . [P31007-2 ]
    GeneIDi 32083.
    KEGGi dme:Dmel_CG1725.
    UCSCi CG1725-RI. d. melanogaster.

    Organism-specific databases

    CTDi 1739.
    FlyBasei FBgn0001624. dlg1.

    Phylogenomic databases

    eggNOGi COG0194.
    GeneTreei ENSGT00660000095130.
    InParanoidi P31007.
    KOi K12076.
    OMAi PMINDEP.
    OrthoDBi EOG79GT6P.
    PhylomeDBi P31007.

    Enzyme and pathway databases

    SignaLinki P31007.

    Miscellaneous databases

    ChiTaRSi dlg1. drosophila.
    GenomeRNAii 32083.
    NextBioi 776723.

    Gene expression databases

    Bgeei P31007.

    Family and domain databases

    Gene3Di 2.30.42.10. 3 hits.
    3.40.50.300. 2 hits.
    InterProi IPR016313. DLG1.
    IPR008145. GK/Ca_channel_bsu.
    IPR008144. Guanylate_kin-like.
    IPR020590. Guanylate_kinase_CS.
    IPR004172. L27.
    IPR015143. L27_1.
    IPR027417. P-loop_NTPase.
    IPR001478. PDZ.
    IPR001452. SH3_domain.
    [Graphical view ]
    PANTHERi PTHR23119. PTHR23119. 1 hit.
    Pfami PF00625. Guanylate_kin. 1 hit.
    PF09058. L27_1. 1 hit.
    PF00595. PDZ. 3 hits.
    PF00018. SH3_1. 1 hit.
    [Graphical view ]
    SMARTi SM00072. GuKc. 1 hit.
    SM00569. L27. 1 hit.
    SM00228. PDZ. 3 hits.
    SM00326. SH3. 1 hit.
    [Graphical view ]
    SUPFAMi SSF50044. SSF50044. 2 hits.
    SSF50156. SSF50156. 3 hits.
    SSF52540. SSF52540. 1 hit.
    PROSITEi PS00856. GUANYLATE_KINASE_1. 1 hit.
    PS50052. GUANYLATE_KINASE_2. 1 hit.
    PS51022. L27. 1 hit.
    PS50106. PDZ. 3 hits.
    PS50002. SH3. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The discs-large tumor suppressor gene of Drosophila encodes a guanylate kinase homolog localized at septate junctions."
      Woods D.F., Bryant P.J.
      Cell 66:451-464(1991) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM E), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
      Strain: Oregon-R.
      Tissue: Embryo.
    2. "Novel isoforms of Dlg are fundamental for neuronal development in Drosophila."
      Mendoza C., Olguin P., Lafferte G., Thomas U., Ebitsch S., Gundelfinger E.D., Kukuljan M., Sierralta J.
      J. Neurosci. 23:2093-2101(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS B; F; H; I AND L), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
      Tissue: Embryo.
    3. "The genome sequence of Drosophila melanogaster."
      Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D.
      , Zhang Q., Chen L.X., Brandon R.C., Rogers Y.-H.C., Blazej R.G., Champe M., Pfeiffer B.D., Wan K.H., Doyle C., Baxter E.G., Helt G., Nelson C.R., Miklos G.L.G., Abril J.F., Agbayani A., An H.-J., Andrews-Pfannkoch C., Baldwin D., Ballew R.M., Basu A., Baxendale J., Bayraktaroglu L., Beasley E.M., Beeson K.Y., Benos P.V., Berman B.P., Bhandari D., Bolshakov S., Borkova D., Botchan M.R., Bouck J., Brokstein P., Brottier P., Burtis K.C., Busam D.A., Butler H., Cadieu E., Center A., Chandra I., Cherry J.M., Cawley S., Dahlke C., Davenport L.B., Davies P., de Pablos B., Delcher A., Deng Z., Mays A.D., Dew I., Dietz S.M., Dodson K., Doup L.E., Downes M., Dugan-Rocha S., Dunkov B.C., Dunn P., Durbin K.J., Evangelista C.C., Ferraz C., Ferriera S., Fleischmann W., Fosler C., Gabrielian A.E., Garg N.S., Gelbart W.M., Glasser K., Glodek A., Gong F., Gorrell J.H., Gu Z., Guan P., Harris M., Harris N.L., Harvey D.A., Heiman T.J., Hernandez J.R., Houck J., Hostin D., Houston K.A., Howland T.J., Wei M.-H., Ibegwam C., Jalali M., Kalush F., Karpen G.H., Ke Z., Kennison J.A., Ketchum K.A., Kimmel B.E., Kodira C.D., Kraft C.L., Kravitz S., Kulp D., Lai Z., Lasko P., Lei Y., Levitsky A.A., Li J.H., Li Z., Liang Y., Lin X., Liu X., Mattei B., McIntosh T.C., McLeod M.P., McPherson D., Merkulov G., Milshina N.V., Mobarry C., Morris J., Moshrefi A., Mount S.M., Moy M., Murphy B., Murphy L., Muzny D.M., Nelson D.L., Nelson D.R., Nelson K.A., Nixon K., Nusskern D.R., Pacleb J.M., Palazzolo M., Pittman G.S., Pan S., Pollard J., Puri V., Reese M.G., Reinert K., Remington K., Saunders R.D.C., Scheeler F., Shen H., Shue B.C., Siden-Kiamos I., Simpson M., Skupski M.P., Smith T.J., Spier E., Spradling A.C., Stapleton M., Strong R., Sun E., Svirskas R., Tector C., Turner R., Venter E., Wang A.H., Wang X., Wang Z.-Y., Wassarman D.A., Weinstock G.M., Weissenbach J., Williams S.M., Woodage T., Worley K.C., Wu D., Yang S., Yao Q.A., Ye J., Yeh R.-F., Zaveri J.S., Zhan M., Zhang G., Zhao Q., Zheng L., Zheng X.H., Zhong F.N., Zhong W., Zhou X., Zhu S.C., Zhu X., Smith H.O., Gibbs R.A., Myers E.W., Rubin G.M., Venter J.C.
      Science 287:2185-2195(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: Berkeley.
    4. Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING.
      Strain: Berkeley.
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS F AND I), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 711-970 (ISOFORM G).
      Strain: Berkeley.
      Tissue: Embryo and Head.
    6. Carlson J.W., Booth B., Frise E., Park S., Wan K.H., Yu C., Celniker S.E.
      Submitted (SEP-2009) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM G).
      Strain: Berkeley.
      Tissue: Embryo.
    7. "Cooperative regulation of cell polarity and growth by Drosophila tumor suppressors."
      Bilder D., Li M., Perrimon N.
      Science 289:113-116(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    8. "Phosphoproteome analysis of Drosophila melanogaster embryos."
      Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.
      J. Proteome Res. 7:1675-1682(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-496 AND THR-714, IDENTIFICATION BY MASS SPECTROMETRY.
      Tissue: Embryo.

    Entry informationi

    Entry nameiDLG1_DROME
    AccessioniPrimary (citable) accession number: P31007
    Secondary accession number(s): A4V4A8
    , A4V4B0, A8JUR9, A8JUS0, C7LAH6, Q7KV38, Q7KV39, Q7KV40, Q7YXH8, Q8SY37, Q8T0C6, Q95TF5, Q9VYZ4, Q9VYZ5, Q9VYZ6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 1, 1993
    Last sequence update: August 31, 2004
    Last modified: October 1, 2014
    This is version 160 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programDrosophila annotation project

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Drosophila
      Drosophila: entries, gene names and cross-references to FlyBase
    2. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3