SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P31007

- DLG1_DROME

UniProt

P31007 - DLG1_DROME

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Disks large 1 tumor suppressor protein
Gene
dlg1, l(1)dlg1, CG1725
Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

During embryonic development, some isoforms are essential for proper neuronal differentiation and organization. Required for cell polarity; maintenance of apicobasal polarity. Plays a critical role at septate junctions in cellular growth control during larval development. The presence of a guanylate kinase domain suggests involvement in cellular adhesion as well as signal transduction to control cellular proliferation.3 Publications

GO - Molecular functioni

  1. epidermal growth factor receptor binding Source: FlyBase
  2. guanylate kinase activity Source: FlyBase
  3. protein binding Source: IntAct
  4. signal transducer activity Source: UniProtKB-KW
  5. structural molecule activity Source: FlyBase

GO - Biological processi

  1. anterior/posterior axis specification, follicular epithelium Source: BHF-UCL
  2. asymmetric protein localization Source: FlyBase
  3. asymmetric protein localization involved in cell fate determination Source: FlyBase
  4. basal protein localization Source: FlyBase
  5. cell adhesion Source: UniProtKB-KW
  6. cell fate commitment involved in pattern specification Source: BHF-UCL
  7. cell fate specification Source: BHF-UCL
  8. cell proliferation Source: FlyBase
  9. cytoskeleton organization Source: FlyBase
  10. dorsal closure Source: FlyBase
  11. establishment of mitotic spindle orientation Source: FlyBase
  12. establishment of spindle orientation Source: FlyBase
  13. establishment or maintenance of epithelial cell apical/basal polarity Source: FlyBase
  14. establishment or maintenance of neuroblast polarity Source: FlyBase
  15. establishment or maintenance of polarity of embryonic epithelium Source: FlyBase
  16. establishment or maintenance of polarity of follicular epithelium Source: FlyBase
  17. establishment or maintenance of polarity of larval imaginal disc epithelium Source: FlyBase
  18. gravitaxis Source: FlyBase
  19. locomotor rhythm Source: FlyBase
  20. male courtship behavior Source: FlyBase
  21. mating behavior Source: FlyBase
  22. morphogenesis of a polarized epithelium Source: FlyBase
  23. morphogenesis of an epithelium Source: FlyBase
  24. morphogenesis of follicular epithelium Source: FlyBase
  25. morphogenesis of larval imaginal disc epithelium Source: FlyBase
  26. negative regulation of cell proliferation Source: FlyBase
  27. negative regulation of transcription from RNA polymerase II promoter Source: BHF-UCL
  28. nervous system development Source: FlyBase
  29. nucleotide phosphorylation Source: GOC
  30. ovarian follicle cell development Source: BHF-UCL
  31. pole plasm protein localization Source: BHF-UCL
  32. positive phototaxis Source: FlyBase
  33. positive regulation of synaptic growth at neuromuscular junction Source: FlyBase
  34. protein localization Source: FlyBase
  35. regulation of JAK-STAT cascade Source: BHF-UCL
  36. regulation of Notch signaling pathway Source: BHF-UCL
  37. regulation of border follicle cell delamination Source: FlyBase
  38. regulation of cell cycle Source: FlyBase
  39. regulation of cell proliferation Source: FlyBase
  40. regulation of epidermal growth factor receptor signaling pathway Source: BHF-UCL
  41. septate junction assembly Source: FlyBase
  42. synaptic growth at neuromuscular junction Source: FlyBase
  43. synaptic transmission Source: FlyBase
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein, Transducer

Keywords - Biological processi

Cell adhesion, Differentiation, Neurogenesis

Enzyme and pathway databases

SignaLinkiP31007.

Names & Taxonomyi

Protein namesi
Recommended name:
Disks large 1 tumor suppressor protein
Gene namesi
Name:dlg1
Synonyms:l(1)dlg1
ORF Names:CG1725
OrganismiDrosophila melanogaster (Fruit fly)
Taxonomic identifieri7227 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
ProteomesiUP000000803: Chromosome X

Organism-specific databases

FlyBaseiFBgn0001624. dlg1.

Subcellular locationi

Cytoplasm. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasmcytoskeleton. Cell junctionseptate junction
Note: Cytoskeleton- and membrane-associated. Located at the cytoplasmic face of the membrane in the cellular blastoderm and becomes associated with septate junctions which begin to form between epithelial cells at the time of dorsal closure. In adult flies, located at the apical-lateral membrane boundary of epithelial cells.3 Publications

GO - Cellular componenti

  1. apical cortex Source: FlyBase
  2. apicolateral plasma membrane Source: FlyBase
  3. basolateral plasma membrane Source: FlyBase
  4. cell cortex Source: FlyBase
  5. cytoskeleton Source: UniProtKB-SubCell
  6. lateral plasma membrane Source: FlyBase
  7. membrane Source: FlyBase
  8. neuromuscular junction Source: FlyBase
  9. perinuclear region of cytoplasm Source: FlyBase
  10. plasma membrane Source: FlyBase
  11. postsynaptic membrane Source: FlyBase
  12. septate junction Source: FlyBase
  13. smooth septate junction Source: FlyBase
  14. synapse Source: FlyBase
  15. terminal bouton Source: FlyBase
  16. type Ib terminal bouton Source: FlyBase
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasm, Cytoskeleton, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 970970Disks large 1 tumor suppressor protein
PRO_0000094538Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei496 – 4961Phosphoserine1 Publication
Modified residuei714 – 7141Phosphothreonine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiP31007.

Expressioni

Tissue specificityi

During the cellular blastoderm stage, isoform B, isoform F, isoform H, isoform I and isoform L expression is localized to the cell borders. From stage 11 onwards, expression is found predominantly in the developing nervous system: axon bundles in the ventral cord and the brain. Stage 14 and 15 embryos exhibit expression in the developing body wall muscle. Expression in neuropil regions of the CNS and at NMJs persists through to larval development. Other isoforms show expression in embryonic epithelial cells. In larvae, expression is seen as a belt around salivary glands, imaginal disks and proventriculus. Expressed in adult reproductive tissues. In epithelia, coexpressed with scrib throughout development.3 Publications

Developmental stagei

Expressed both maternally and zygotically throughout development.1 Publication

Gene expression databases

BgeeiP31007.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
gukhQ4AB304EBI-389374,EBI-8282973
gukhQ9VE1311EBI-389394,EBI-3414026

Protein-protein interaction databases

BioGridi58494. 21 interactions.
IntActiP31007. 19 interactions.
MINTiMINT-287852.
STRINGi7227.FBpp0089352.

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi624 – 6274
Beta strandi651 – 6566
Beta strandi659 – 6657
Beta strandi679 – 6813
Helixi683 – 6919
Beta strandi769 – 7768
Beta strandi783 – 7875
Helixi790 – 80011
Turni802 – 8043
Turni822 – 8243
Helixi832 – 8409
Beta strandi844 – 8507
Beta strandi853 – 8586
Helixi859 – 86810
Beta strandi871 – 8744
Helixi879 – 8868
Beta strandi892 – 8965
Helixi901 – 9066
Helixi915 – 93016
Turni931 – 9333
Beta strandi935 – 9384
Helixi943 – 95715
Beta strandi960 – 9656

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3TVTX-ray1.60A618-970[»]
ProteinModelPortaliP31007.
SMRiP31007. Positions 2-65, 214-970.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini4 – 6461L27
Add
BLAST
Domaini216 – 30388PDZ 1
Add
BLAST
Domaini330 – 42192PDZ 2
Add
BLAST
Domaini506 – 58782PDZ 3
Add
BLAST
Domaini620 – 69071SH3
Add
BLAST
Domaini780 – 955176Guanylate kinase-like
Add
BLAST

Sequence similaritiesi

Belongs to the MAGUK family.
Contains 1 L27 domain.
Contains 3 PDZ (DHR) domains.
Contains 1 SH3 domain.

Keywords - Domaini

Repeat, SH3 domain

Phylogenomic databases

eggNOGiCOG0194.
GeneTreeiENSGT00660000095130.
InParanoidiP31007.
KOiK12076.
OMAiPMINDEP.
OrthoDBiEOG79GT6P.
PhylomeDBiP31007.

Family and domain databases

Gene3Di2.30.42.10. 3 hits.
3.40.50.300. 2 hits.
InterProiIPR016313. DLG1.
IPR008145. GK/Ca_channel_bsu.
IPR008144. Guanylate_kin-like.
IPR020590. Guanylate_kinase_CS.
IPR004172. L27.
IPR015143. L27_1.
IPR027417. P-loop_NTPase.
IPR001478. PDZ.
IPR001452. SH3_domain.
[Graphical view]
PANTHERiPTHR23119. PTHR23119. 1 hit.
PfamiPF00625. Guanylate_kin. 1 hit.
PF09058. L27_1. 1 hit.
PF00595. PDZ. 3 hits.
PF00018. SH3_1. 1 hit.
[Graphical view]
SMARTiSM00072. GuKc. 1 hit.
SM00569. L27. 1 hit.
SM00228. PDZ. 3 hits.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 2 hits.
SSF50156. SSF50156. 3 hits.
SSF52540. SSF52540. 1 hit.
PROSITEiPS00856. GUANYLATE_KINASE_1. 1 hit.
PS50052. GUANYLATE_KINASE_2. 1 hit.
PS51022. L27. 1 hit.
PS50106. PDZ. 3 hits.
PS50002. SH3. 1 hit.
[Graphical view]

Sequences (9)i

Sequence statusi: Complete.

This entry describes 9 isoformsi produced by alternative splicing. Align

Isoform B (identifier: P31007-2) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MPVKKQEAHR ALELLEDYHA RLSEPQDRAL RIAIERVIRI FKSRLFQALL    50
DIQEFYELTL LDDSKSIQQK TAETLQIATK WEKDGQAVKI ADFIKSSNLN 100
RNCAYEFNND ASSNQTNQSA LNQNPIANNV SAQAQAEALS RTFKSELEEI 150
LNQRMRIESD TENAKEPTVE QQQKQQQAQQ RSSRSPQQQN PQQQQGSKSR 200
SGSQTVNGDD SWLYEDIQLE RGNSGLGFSI AGGTDNPHIG TDTSIYITKL 250
ISGGAAAADG RLSINDIIVS VNDVSVVDVP HASAVDALKK AGNVVKLHVK 300
RKRGTATTPA AGSAAGDARD SAASGPKVIE IDLVKGGKGL GFSIAGGIGN 350
QHIPGDNGIY VTKLMDGGAA QVDGRLSIGD KLIAVRTNGS EKNLENVTHE 400
LAVATLKSIT DKVTLIIGKT QHLTTSASGG GGGGLSSGQQ LSQSQSQLAT 450
SQSQSQVHQQ QHATPMVNSQ STEPGSRYAS TNVLAAVPPG TPRAVSTEDI 500
TREPRTITIQ KGPQGLGFNI VGGEDGQGIY VSFILAGGPA DLGSELKRGD 550
QLLSVNNVNL THATHEEAAQ ALKTSGGVVT LLAQYRPEEY NRFEARIQEL 600
KQQAALGAGG SGTLLRTTQK RSLYVRALFD YDPNRDDGLP SRGLPFKHGD 650
ILHVTNASDD EWWQARRVLG DNEDEQIGIV PSKRRWERKM RARDRSVKFQ 700
GHAAANNNLD KQSTLDRKKK NFTFSRKFPF MKSRDEKNED GSDQEPFMLC 750
YTQDDANAEG ASEENVLSYE AVQRLSINYT RPVIILGPLK DRINDDLISE 800
YPDKFGSCVP HTTRPKREYE VDGRDYHFVS SREQMERDIQ NHLFIEAGQY 850
NDNLYGTSVA SVREVAEKGK HCILDVSGNA IKRLQVAQLY PVAVFIKPKS 900
VDSVMEMNRR MTEEQAKKTY ERAIKMEQEF GEYFTGVVQG DTIEEIYSKV 950
KSMIWSQSGP TIWVPSKESL 970

Note: Contains the N-terminal domain essential for correct neuronal development.

Length:970
Mass (Da):106,673
Last modified:August 31, 2004 - v2
Checksum:i544D1E1AD03B0674
GO
Isoform A (identifier: P31007-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-37: MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERV → MTTRKKKRDGGGSGGGFIKKVSSLFNLDSLHKASSTK
     38-205: Missing.
     473-473: E → GALNSMGQTV...NRSQSPQPRQ
     747-761: FMLCYTQDDANAEGA → NGVVSSTSEIDINNVNNNQSNEPQP

Note: No experimental confirmation available.

Show »
Length:968
Mass (Da):103,239
Checksum:iE641D9BE7669331C
GO
Isoform E (identifier: P31007-1) [UniParc]FASTAAdd to Basket

Also known as: Dlg-A, D

The sequence of this isoform differs from the canonical sequence as follows:
     1-29: MPVKKQEAHRALELLEDYHARLSEPQDRA → MTTRKKKRDGGGSGGGFIKKVSSLFNLDS
     30-205: Missing.
     473-473: E → GALNSMGQTV...NRSQSPQPRQ
     747-761: FMLCYTQDDANAEGA → NGVVSSTSEIDINNVNNNQSNEPQP

Show »
Length:960
Mass (Da):102,386
Checksum:i26E9B6026226BDA3
GO
Isoform F (identifier: P31007-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MPVKKQE → MDSDTDSERE...EEERIADIQK
     473-519: EPGSRYASTN...QKGPQGLGFN → AFMLCYTQDD...NDADYRKSSI
     520-970: Missing.

Note: Contains the N-terminal domain essential for correct neuronal development.

Show »
Length:816
Mass (Da):88,662
Checksum:i35894E1555DE5AAE
GO
Isoform G (identifier: P31007-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-29: MPVKKQEAHRALELLEDYHARLSEPQDRA → MTTRKKKRDGGGSGGGFIKKVSSLFNLDS
     30-205: Missing.
     473-473: E → GALNSMGQTV...NRSQSPQPRQ
     746-746: P → PNGVVSSTSEIDINNVNNNQSNEPQP

Note: No experimental confirmation available.

Show »
Length:975
Mass (Da):104,016
Checksum:i15D466336AA4194C
GO
Isoform H (identifier: P31007-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     93-151: Missing.

Note: Contains the N-terminal domain essential for correct neuronal development.

Show »
Length:911
Mass (Da):100,171
Checksum:i47ACCA6E52AD1168
GO
Isoform I (identifier: P31007-7) [UniParc]FASTAAdd to Basket

Also known as: C, J

The sequence of this isoform differs from the canonical sequence as follows:
     93-151: Missing.
     206-267: VNGDDSWLYE...ADGRLSINDI → SQIQIQSLTQ...KMLKRAFEST
     268-970: Missing.

Note: Contains the N-terminal domain essential for correct neuronal development.

Show »
Length:208
Mass (Da):24,378
Checksum:iBB8F4B44E9DE2562
GO
Isoform K (identifier: P31007-9) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-92: MPVKKQEAHR...KDGQAVKIAD → MIDWVSIVRH...GSRYACCCAN
     93-151: Missing.

Note: No experimental confirmation available.

Show »
Length:911
Mass (Da):100,458
Checksum:i6FE13A27211F2122
GO
Isoform L (identifier: P31007-8) [UniParc]FASTAAdd to Basket

Also known as: S97

The sequence of this isoform differs from the canonical sequence as follows:
     93-151: Missing.
     205-205: T → TLHKASSTK
     761-761: A → GEIIYRVELPDMEQITLIYLENNDADYP

Note: Contains the N-terminal domain essential for correct neuronal development.

Show »
Length:946
Mass (Da):104,263
Checksum:i6BAFDD6BE66191B7
GO

Sequence cautioni

The sequence AAL39553.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 9292MPVKK…VKIAD → MIDWVSIVRHSRRRFSNYVG SRSPVRMRRRRRQLTAPPPQ QQQQQHYHQQQQQDQHQSRE RQKKDKEKEKETEKDNESGG GIGSRYACCCAN in isoform K.
VSP_039402Add
BLAST
Alternative sequencei1 – 3737MPVKK…AIERV → MTTRKKKRDGGGSGGGFIKK VSSLFNLDSLHKASSTK in isoform A.
VSP_011403Add
BLAST
Alternative sequencei1 – 2929MPVKK…PQDRA → MTTRKKKRDGGGSGGGFIKK VSSLFNLDS in isoform E and isoform G.
VSP_011402Add
BLAST
Alternative sequencei1 – 77MPVKKQE → MDSDTDSEREKSSDPNEGLL SSDDKTFHDDDEPAEDSSPA DDEEEPEEEECLLPQKKAQI RCDQDQPPLVVLVQPSAEAI EVRQEIDDTNPVAVAAKASD MDGDSQLEVMEHQMETVTEP DPEPPKCPTSLRDSVRESVE CFYSAQDLLEYGHMLSSTSM VRTPDVESGYFEKSESDASR DEWEGPSSSSSGAARCRLLS GISGLSVSSSSRHSAEGLRM ELSRFRTMIETLERESLEKS QSELQLKAKSKAKPKPKQRS HVQDAAGESGSEQGSERGFW STIFGQAGLAISQDEEERIA DIQK in isoform F.
VSP_011401
Alternative sequencei30 – 205176Missing in isoform E and isoform G.
VSP_011404Add
BLAST
Alternative sequencei38 – 205168Missing in isoform A.
VSP_011405Add
BLAST
Alternative sequencei93 – 15159Missing in isoform I, isoform H, isoform K and isoform L.
VSP_011406Add
BLAST
Alternative sequencei205 – 2051T → TLHKASSTK in isoform L.
VSP_011407
Alternative sequencei206 – 26762VNGDD…SINDI → SQIQIQSLTQTYPNAHQRKR VLVSLHPHQHQHQSQIQHQH HYQLRHNNGIQAKMLKRAFE ST in isoform I.
VSP_011408Add
BLAST
Alternative sequencei268 – 970703Missing in isoform I.
VSP_011409Add
BLAST
Alternative sequencei473 – 51947EPGSR…GLGFN → AFMLCYTQDDANAEGGEIIY RVELPDMEQITLIYLENNDA DYRKSSI in isoform F.
VSP_011411Add
BLAST
Alternative sequencei473 – 4731E → GALNSMGQTVVDSPSIPQAA AAVAAAANASASASVIASNN TISNTTVTTVTATATASNSS SKLPPSLGANSSISISNSNS NSNSNNINNINSINNNNSSS SSTTATVAAATPTAASAAAA AASSPPANSFYNNASMPALP VESNQTNNRSQSPQPRQ in isoform A, isoform E and isoform G.
VSP_011410
Alternative sequencei520 – 970451Missing in isoform F.
VSP_011412Add
BLAST
Alternative sequencei746 – 7461P → PNGVVSSTSEIDINNVNNNQ SNEPQP in isoform G.
VSP_011413
Alternative sequencei747 – 76115FMLCY…NAEGA → NGVVSSTSEIDINNVNNNQS NEPQP in isoform A and isoform E.
VSP_011414Add
BLAST
Alternative sequencei761 – 7611A → GEIIYRVELPDMEQITLIYL ENNDADYP in isoform L.
VSP_011415

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti365 – 3651M → T in AAA28468. 1 Publication
Sequence conflicti365 – 3651M → T in AAQ01226. 1 Publication
Sequence conflicti369 – 3691A → R in AAA28468. 1 Publication
Sequence conflicti369 – 3691A → R in AAQ01226. 1 Publication
Sequence conflicti395 – 3951E → G in ACV53090. 1 Publication
Isoform E (identifier: P31007-1)
Sequence conflicti355 – 3551S → D in AAA28468. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
M73529 mRNA. Translation: AAA28468.1.
AY332243 mRNA. Translation: AAQ01226.1.
AE014298 Genomic DNA. Translation: AAF48037.2.
AE014298 Genomic DNA. Translation: AAF48038.2.
AE014298 Genomic DNA. Translation: AAF48039.2.
AE014298 Genomic DNA. Translation: AAN09630.1.
AE014298 Genomic DNA. Translation: AAS65308.1.
AE014298 Genomic DNA. Translation: AAS65309.1.
AE014298 Genomic DNA. Translation: AAS65310.1.
AE014298 Genomic DNA. Translation: AAS65311.1.
AE014298 Genomic DNA. Translation: AAS65312.1.
AE014298 Genomic DNA. Translation: AAS65313.1.
AE014298 Genomic DNA. Translation: ABW09394.1.
AE014298 Genomic DNA. Translation: ABW09395.1.
AY059433 mRNA. Translation: AAL13339.1.
AY069408 mRNA. Translation: AAL39553.1. Different initiation.
AY075410 mRNA. Translation: AAL68235.1.
BT099726 mRNA. Translation: ACV53090.1.
PIRiA39651.
RefSeqiNP_001096955.1. NM_001103485.3. [P31007-9]
NP_001096956.1. NM_001103486.3. [P31007-8]
NP_001162719.1. NM_001169248.2. [P31007-1]
NP_001245623.1. NM_001258694.2. [P31007-5]
NP_001259447.1. NM_001272518.1. [P31007-1]
NP_511120.2. NM_078565.5. [P31007-1]
NP_727518.1. NM_167280.2. [P31007-7]
NP_727519.1. NM_167281.2. [P31007-4]
NP_727520.1. NM_167282.4. [P31007-3]
NP_996402.1. NM_206679.2. [P31007-7]
NP_996403.1. NM_206680.2. [P31007-7]
NP_996404.1. NM_206681.4. [P31007-6]
NP_996405.1. NM_206682.4. [P31007-5]
NP_996406.1. NM_206683.4. [P31007-2]
NP_996407.1. NM_206684.4. [P31007-1]
UniGeneiDm.4352.

Genome annotation databases

EnsemblMetazoaiFBtr0073488; FBpp0089351; FBgn0001624. [P31007-2]
GeneIDi32083.
KEGGidme:Dmel_CG1725.
UCSCiCG1725-RI. d. melanogaster.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
M73529 mRNA. Translation: AAA28468.1 .
AY332243 mRNA. Translation: AAQ01226.1 .
AE014298 Genomic DNA. Translation: AAF48037.2 .
AE014298 Genomic DNA. Translation: AAF48038.2 .
AE014298 Genomic DNA. Translation: AAF48039.2 .
AE014298 Genomic DNA. Translation: AAN09630.1 .
AE014298 Genomic DNA. Translation: AAS65308.1 .
AE014298 Genomic DNA. Translation: AAS65309.1 .
AE014298 Genomic DNA. Translation: AAS65310.1 .
AE014298 Genomic DNA. Translation: AAS65311.1 .
AE014298 Genomic DNA. Translation: AAS65312.1 .
AE014298 Genomic DNA. Translation: AAS65313.1 .
AE014298 Genomic DNA. Translation: ABW09394.1 .
AE014298 Genomic DNA. Translation: ABW09395.1 .
AY059433 mRNA. Translation: AAL13339.1 .
AY069408 mRNA. Translation: AAL39553.1 . Different initiation.
AY075410 mRNA. Translation: AAL68235.1 .
BT099726 mRNA. Translation: ACV53090.1 .
PIRi A39651.
RefSeqi NP_001096955.1. NM_001103485.3. [P31007-9 ]
NP_001096956.1. NM_001103486.3. [P31007-8 ]
NP_001162719.1. NM_001169248.2. [P31007-1 ]
NP_001245623.1. NM_001258694.2. [P31007-5 ]
NP_001259447.1. NM_001272518.1. [P31007-1 ]
NP_511120.2. NM_078565.5. [P31007-1 ]
NP_727518.1. NM_167280.2. [P31007-7 ]
NP_727519.1. NM_167281.2. [P31007-4 ]
NP_727520.1. NM_167282.4. [P31007-3 ]
NP_996402.1. NM_206679.2. [P31007-7 ]
NP_996403.1. NM_206680.2. [P31007-7 ]
NP_996404.1. NM_206681.4. [P31007-6 ]
NP_996405.1. NM_206682.4. [P31007-5 ]
NP_996406.1. NM_206683.4. [P31007-2 ]
NP_996407.1. NM_206684.4. [P31007-1 ]
UniGenei Dm.4352.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
3TVT X-ray 1.60 A 618-970 [» ]
ProteinModelPortali P31007.
SMRi P31007. Positions 2-65, 214-970.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 58494. 21 interactions.
IntActi P31007. 19 interactions.
MINTi MINT-287852.
STRINGi 7227.FBpp0089352.

Proteomic databases

PaxDbi P31007.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

EnsemblMetazoai FBtr0073488 ; FBpp0089351 ; FBgn0001624 . [P31007-2 ]
GeneIDi 32083.
KEGGi dme:Dmel_CG1725.
UCSCi CG1725-RI. d. melanogaster.

Organism-specific databases

CTDi 1739.
FlyBasei FBgn0001624. dlg1.

Phylogenomic databases

eggNOGi COG0194.
GeneTreei ENSGT00660000095130.
InParanoidi P31007.
KOi K12076.
OMAi PMINDEP.
OrthoDBi EOG79GT6P.
PhylomeDBi P31007.

Enzyme and pathway databases

SignaLinki P31007.

Miscellaneous databases

ChiTaRSi dlg1. drosophila.
GenomeRNAii 32083.
NextBioi 776723.

Gene expression databases

Bgeei P31007.

Family and domain databases

Gene3Di 2.30.42.10. 3 hits.
3.40.50.300. 2 hits.
InterProi IPR016313. DLG1.
IPR008145. GK/Ca_channel_bsu.
IPR008144. Guanylate_kin-like.
IPR020590. Guanylate_kinase_CS.
IPR004172. L27.
IPR015143. L27_1.
IPR027417. P-loop_NTPase.
IPR001478. PDZ.
IPR001452. SH3_domain.
[Graphical view ]
PANTHERi PTHR23119. PTHR23119. 1 hit.
Pfami PF00625. Guanylate_kin. 1 hit.
PF09058. L27_1. 1 hit.
PF00595. PDZ. 3 hits.
PF00018. SH3_1. 1 hit.
[Graphical view ]
SMARTi SM00072. GuKc. 1 hit.
SM00569. L27. 1 hit.
SM00228. PDZ. 3 hits.
SM00326. SH3. 1 hit.
[Graphical view ]
SUPFAMi SSF50044. SSF50044. 2 hits.
SSF50156. SSF50156. 3 hits.
SSF52540. SSF52540. 1 hit.
PROSITEi PS00856. GUANYLATE_KINASE_1. 1 hit.
PS50052. GUANYLATE_KINASE_2. 1 hit.
PS51022. L27. 1 hit.
PS50106. PDZ. 3 hits.
PS50002. SH3. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The discs-large tumor suppressor gene of Drosophila encodes a guanylate kinase homolog localized at septate junctions."
    Woods D.F., Bryant P.J.
    Cell 66:451-464(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM E), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
    Strain: Oregon-R.
    Tissue: Embryo.
  2. "Novel isoforms of Dlg are fundamental for neuronal development in Drosophila."
    Mendoza C., Olguin P., Lafferte G., Thomas U., Ebitsch S., Gundelfinger E.D., Kukuljan M., Sierralta J.
    J. Neurosci. 23:2093-2101(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS B; F; H; I AND L), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    Tissue: Embryo.
  3. "The genome sequence of Drosophila melanogaster."
    Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D.
    , Zhang Q., Chen L.X., Brandon R.C., Rogers Y.-H.C., Blazej R.G., Champe M., Pfeiffer B.D., Wan K.H., Doyle C., Baxter E.G., Helt G., Nelson C.R., Miklos G.L.G., Abril J.F., Agbayani A., An H.-J., Andrews-Pfannkoch C., Baldwin D., Ballew R.M., Basu A., Baxendale J., Bayraktaroglu L., Beasley E.M., Beeson K.Y., Benos P.V., Berman B.P., Bhandari D., Bolshakov S., Borkova D., Botchan M.R., Bouck J., Brokstein P., Brottier P., Burtis K.C., Busam D.A., Butler H., Cadieu E., Center A., Chandra I., Cherry J.M., Cawley S., Dahlke C., Davenport L.B., Davies P., de Pablos B., Delcher A., Deng Z., Mays A.D., Dew I., Dietz S.M., Dodson K., Doup L.E., Downes M., Dugan-Rocha S., Dunkov B.C., Dunn P., Durbin K.J., Evangelista C.C., Ferraz C., Ferriera S., Fleischmann W., Fosler C., Gabrielian A.E., Garg N.S., Gelbart W.M., Glasser K., Glodek A., Gong F., Gorrell J.H., Gu Z., Guan P., Harris M., Harris N.L., Harvey D.A., Heiman T.J., Hernandez J.R., Houck J., Hostin D., Houston K.A., Howland T.J., Wei M.-H., Ibegwam C., Jalali M., Kalush F., Karpen G.H., Ke Z., Kennison J.A., Ketchum K.A., Kimmel B.E., Kodira C.D., Kraft C.L., Kravitz S., Kulp D., Lai Z., Lasko P., Lei Y., Levitsky A.A., Li J.H., Li Z., Liang Y., Lin X., Liu X., Mattei B., McIntosh T.C., McLeod M.P., McPherson D., Merkulov G., Milshina N.V., Mobarry C., Morris J., Moshrefi A., Mount S.M., Moy M., Murphy B., Murphy L., Muzny D.M., Nelson D.L., Nelson D.R., Nelson K.A., Nixon K., Nusskern D.R., Pacleb J.M., Palazzolo M., Pittman G.S., Pan S., Pollard J., Puri V., Reese M.G., Reinert K., Remington K., Saunders R.D.C., Scheeler F., Shen H., Shue B.C., Siden-Kiamos I., Simpson M., Skupski M.P., Smith T.J., Spier E., Spradling A.C., Stapleton M., Strong R., Sun E., Svirskas R., Tector C., Turner R., Venter E., Wang A.H., Wang X., Wang Z.-Y., Wassarman D.A., Weinstock G.M., Weissenbach J., Williams S.M., Woodage T., Worley K.C., Wu D., Yang S., Yao Q.A., Ye J., Yeh R.-F., Zaveri J.S., Zhan M., Zhang G., Zhao Q., Zheng L., Zheng X.H., Zhong F.N., Zhong W., Zhou X., Zhu S.C., Zhu X., Smith H.O., Gibbs R.A., Myers E.W., Rubin G.M., Venter J.C.
    Science 287:2185-2195(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: Berkeley.
  4. Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING.
    Strain: Berkeley.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS F AND I), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 711-970 (ISOFORM G).
    Strain: Berkeley.
    Tissue: Embryo and Head.
  6. Carlson J.W., Booth B., Frise E., Park S., Wan K.H., Yu C., Celniker S.E.
    Submitted (SEP-2009) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM G).
    Strain: Berkeley.
    Tissue: Embryo.
  7. "Cooperative regulation of cell polarity and growth by Drosophila tumor suppressors."
    Bilder D., Li M., Perrimon N.
    Science 289:113-116(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  8. "Phosphoproteome analysis of Drosophila melanogaster embryos."
    Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.
    J. Proteome Res. 7:1675-1682(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-496 AND THR-714, IDENTIFICATION BY MASS SPECTROMETRY.
    Tissue: Embryo.

Entry informationi

Entry nameiDLG1_DROME
AccessioniPrimary (citable) accession number: P31007
Secondary accession number(s): A4V4A8
, A4V4B0, A8JUR9, A8JUS0, C7LAH6, Q7KV38, Q7KV39, Q7KV40, Q7YXH8, Q8SY37, Q8T0C6, Q95TF5, Q9VYZ4, Q9VYZ5, Q9VYZ6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 1, 1993
Last sequence update: August 31, 2004
Last modified: July 9, 2014
This is version 159 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi