Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Probable G-protein coupled receptor 83

Gene

Gpr83

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Orphan receptor. Could be a neuropeptide Y receptor.

GO - Molecular functioni

GO - Biological processi

  • response to glucocorticoid Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

ReactomeiR-MMU-418555. G alpha (s) signalling events.

Names & Taxonomyi

Protein namesi
Recommended name:
Probable G-protein coupled receptor 83
Alternative name(s):
Glucocorticoid-induced receptor
Gene namesi
Name:Gpr83
Synonyms:Gir, Gpr72
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 9

Organism-specific databases

MGIiMGI:95712. Gpr83.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini18 – 7154ExtracellularSequence analysisAdd
BLAST
Transmembranei72 – 9221Helical; Name=1Sequence analysisAdd
BLAST
Topological domaini93 – 10715CytoplasmicSequence analysisAdd
BLAST
Transmembranei108 – 12922Helical; Name=2Sequence analysisAdd
BLAST
Topological domaini130 – 14516ExtracellularSequence analysisAdd
BLAST
Transmembranei146 – 16722Helical; Name=3Sequence analysisAdd
BLAST
Topological domaini168 – 18619CytoplasmicSequence analysisAdd
BLAST
Transmembranei187 – 20822Helical; Name=4Sequence analysisAdd
BLAST
Topological domaini209 – 23830ExtracellularSequence analysisAdd
BLAST
Transmembranei239 – 26022Helical; Name=5Sequence analysisAdd
BLAST
Topological domaini261 – 29333CytoplasmicSequence analysisAdd
BLAST
Transmembranei294 – 31522Helical; Name=6Sequence analysisAdd
BLAST
Topological domaini316 – 32712ExtracellularSequence analysisAdd
BLAST
Transmembranei328 – 34821Helical; Name=7Sequence analysisAdd
BLAST
Topological domaini349 – 42375CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

  • integral component of membrane Source: UniProtKB-KW
  • nonmotile primary cilium Source: MGI
  • plasma membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Chemistry

GuidetoPHARMACOLOGYi119.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1717Sequence analysisAdd
BLAST
Chaini18 – 423406Probable G-protein coupled receptor 83PRO_0000012804Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi38 – 381N-linked (GlcNAc...)Sequence analysis
Glycosylationi46 – 461N-linked (GlcNAc...)Sequence analysis
Glycosylationi134 – 1341N-linked (GlcNAc...)Sequence analysis
Disulfide bondi144 ↔ 224PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiP30731.
PRIDEiP30731.

PTM databases

PhosphoSiteiP30731.

Expressioni

Tissue specificityi

Brain, thymus and spleen.

Inductioni

By glucocorticoids and cAMP; in T-cells.

Gene expression databases

BgeeiP30731.
CleanExiMM_GPR83.
ExpressionAtlasiP30731. baseline and differential.
GenevisibleiP30731. MM.

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000034408.

Structurei

3D structure databases

ProteinModelPortaliP30731.
SMRiP30731. Positions 31-361.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3656. Eukaryota.
ENOG410XRW9. LUCA.
HOGENOMiHOG000112793.
HOVERGENiHBG051819.
InParanoidiP30731.
KOiK04210.
OMAiNENFRIE.
OrthoDBiEOG7ZD1VD.
TreeFamiTF315303.

Family and domain databases

InterProiIPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
IPR000611. NPY_rcpt.
[Graphical view]
PfamiPF00001. 7tm_1. 1 hit.
[Graphical view]
PRINTSiPR00237. GPCRRHODOPSN.
PR01012. NRPEPTIDEYR.
SMARTiSM01381. 7TM_GPCR_Srsx. 1 hit.
[Graphical view]
PROSITEiPS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Experimental confirmation may be lacking for some isoforms.

Isoform 1 (identifier: P30731-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKVPPVLLLF LLSSVRATEQ PQVVTEHPSM EAALTGPNAS SHFWANYTFS
60 70 80 90 100
DWQNFVGRRR YGAESQNPTV KALLIVAYSF TIVFSLFGNV LVCHVIFKNQ
110 120 130 140 150
RMHSATSLFI VNLAVADIMI TLLNTPFTLV RFVNSTWVFG KGMCHVSRFA
160 170 180 190 200
QYCSLHVSAL TLTAIAVDRH QVIMHPLKPR ISITKGVIYI AVIWVMATFF
210 220 230 240 250
SLPHAICQKL FTFKYSEDIV RSLCLPDFPE PADLFWKYLD LATFILLYLL
260 270 280 290 300
PLFIISVAYA RVAKKLWLCN TIGDVTTEQY LALRRKKKTT VKMLVLVVVL
310 320 330 340 350
FALCWFPLNC YVLLLSSKAI HTNNALYFAF HWFAMSSTCY NPFIYCWLNE
360 370 380 390 400
NFRVELKALL SMCQRPPKPQ EDRLPSPVPS FRVAWTEKSH GRRAPLPNHH
410 420
LPSSQIQSGK TDLSSVEPVV AMS
Length:423
Mass (Da):48,137
Last modified:November 1, 1995 - v2
Checksum:i3ACE43452BF15391
GO
Isoform 2 (identifier: P30731-2) [UniParc]FASTAAdd to basket

Also known as: RP39

The sequence of this isoform differs from the canonical sequence as follows:
     130-171: Missing.

Show »
Length:381
Mass (Da):43,417
Checksum:i2EEDB8584184A0A3
GO
Isoform 3 (identifier: P30731-3) [UniParc]FASTAAdd to basket

Also known as: RP82

The sequence of this isoform differs from the canonical sequence as follows:
     171-171: Q → QGLTAIAVDRHQGLELQKMVRPRGDGGELRSPSVTFVPSSLCPALFTCKRPWDFQESQSLHDTLFPPLE

Show »
Length:491
Mass (Da):55,683
Checksum:iBAEE1C4B96B088DD
GO
Isoform 4 (identifier: P30731-4) [UniParc]FASTAAdd to basket

Also known as: RP105

The sequence of this isoform differs from the canonical sequence as follows:
     171-171: Q → QRPWDFQESQSLHDTLFPPLE

Show »
Length:443
Mass (Da):50,561
Checksum:i5A4DFB3543C29152
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei130 – 17142Missing in isoform 2. 1 PublicationVSP_001988Add
BLAST
Alternative sequencei171 – 1711Q → QGLTAIAVDRHQGLELQKMV RPRGDGGELRSPSVTFVPSS LCPALFTCKRPWDFQESQSL HDTLFPPLE in isoform 3. 1 PublicationVSP_001989
Alternative sequencei171 – 1711Q → QRPWDFQESQSLHDTLFPPL E in isoform 4. 1 PublicationVSP_001990

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M80481 mRNA. Translation: AAA17882.1.
CCDSiCCDS22829.1. [P30731-1]
CCDS80959.1. [P30731-2]
PIRiA40470.
B40470.
C40470.
D40470.
RefSeqiNP_034417.1. NM_010287.3. [P30731-1]
XP_006510080.1. XM_006510017.2. [P30731-4]
UniGeneiMm.4672.

Genome annotation databases

EnsembliENSMUST00000034408; ENSMUSP00000034408; ENSMUSG00000031932. [P30731-1]
ENSMUST00000115624; ENSMUSP00000111287; ENSMUSG00000031932. [P30731-2]
GeneIDi14608.
KEGGimmu:14608.
UCSCiuc009off.1. mouse. [P30731-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M80481 mRNA. Translation: AAA17882.1.
CCDSiCCDS22829.1. [P30731-1]
CCDS80959.1. [P30731-2]
PIRiA40470.
B40470.
C40470.
D40470.
RefSeqiNP_034417.1. NM_010287.3. [P30731-1]
XP_006510080.1. XM_006510017.2. [P30731-4]
UniGeneiMm.4672.

3D structure databases

ProteinModelPortaliP30731.
SMRiP30731. Positions 31-361.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000034408.

Chemistry

GuidetoPHARMACOLOGYi119.

Protein family/group databases

GPCRDBiSearch...

PTM databases

PhosphoSiteiP30731.

Proteomic databases

PaxDbiP30731.
PRIDEiP30731.

Protocols and materials databases

DNASUi14608.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000034408; ENSMUSP00000034408; ENSMUSG00000031932. [P30731-1]
ENSMUST00000115624; ENSMUSP00000111287; ENSMUSG00000031932. [P30731-2]
GeneIDi14608.
KEGGimmu:14608.
UCSCiuc009off.1. mouse. [P30731-1]

Organism-specific databases

CTDi10888.
MGIiMGI:95712. Gpr83.

Phylogenomic databases

eggNOGiKOG3656. Eukaryota.
ENOG410XRW9. LUCA.
HOGENOMiHOG000112793.
HOVERGENiHBG051819.
InParanoidiP30731.
KOiK04210.
OMAiNENFRIE.
OrthoDBiEOG7ZD1VD.
TreeFamiTF315303.

Enzyme and pathway databases

ReactomeiR-MMU-418555. G alpha (s) signalling events.

Miscellaneous databases

PROiP30731.
SOURCEiSearch...

Gene expression databases

BgeeiP30731.
CleanExiMM_GPR83.
ExpressionAtlasiP30731. baseline and differential.
GenevisibleiP30731. MM.

Family and domain databases

InterProiIPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
IPR000611. NPY_rcpt.
[Graphical view]
PfamiPF00001. 7tm_1. 1 hit.
[Graphical view]
PRINTSiPR00237. GPCRRHODOPSN.
PR01012. NRPEPTIDEYR.
SMARTiSM01381. 7TM_GPCR_Srsx. 1 hit.
[Graphical view]
PROSITEiPS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Identification of a gene induced by glucocorticoids in murine T-cells: a potential G protein-coupled receptor."
    Harrigan M.T., Campbell N.F., Bourgeois S.
    Mol. Endocrinol. 5:1331-1338(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4).

Entry informationi

Entry nameiGPR83_MOUSE
AccessioniPrimary (citable) accession number: P30731
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 1, 1993
Last sequence update: November 1, 1995
Last modified: June 8, 2016
This is version 134 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.