P30613 (KPYR_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 160.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Pyruvate kinase isozymes R/L EC=2.7.1.40 Alternative name(s): Pyruvate kinase 1 R-type/L-type pyruvate kinase Red cell/liver pyruvate kinase | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 574 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Plays a key role in glycolysis By similarity. |
| Catalytic activity | ATP + pyruvate = ADP + phosphoenolpyruvate. |
| Cofactor | Magnesium. Potassium. |
| Enzyme regulation | Allosterically activated by fructose 1,6-bisphosphate. Ref.14 |
| Pathway | Carbohydrate degradation; glycolysis; pyruvate from D-glyceraldehyde 3-phosphate: step 5/5. |
| Subunit structure | Homotetramer. Ref.14 |
| Involvement in disease | Pyruvate kinase hyperactivity (PKHYP) [MIM:102900]: Autosomal dominant phenotype characterized by increase of red blood cell ATP. Pyruvate kinase deficiency of red cells (PKRD) [MIM:266200]: A frequent cause of hereditary non-spherocytic hemolytic anemia. Clinically, pyruvate kinase-deficient patients suffer from a highly variable degree of chronic hemolysis, ranging from severe neonatal jaundice and fatal anemia at birth, severe transfusion-dependent chronic hemolysis, moderate hemolysis with exacerbation during infection, to a fully compensated hemolysis without apparent anemia. |
| Miscellaneous | There are 4 isozymes of pyruvate kinase in mammals: L, R, M1 and M2. L type is major isozyme in the liver, R is found in red cells, M1 is the main form in muscle, heart and brain, and M2 is found in early fetal tissues. |
| Sequence similarities | Belongs to the pyruvate kinase family. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform R-type (identifier: P30613-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform L-type (identifier: P30613-2) The sequence of this isoform differs from the canonical sequence as follows: 1-33: MSIQENISSLQLRSWVSKSQRDLAKSILIGAPG → ME |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 574 | 574 | Pyruvate kinase isozymes R/L | PRO_0000112094 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 475 – 480 | 6 | Allosteric activator binding | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 559 – 564 | 6 | Allosteric activator binding | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 118 | 1 | Potassium | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 120 | 1 | Potassium | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 156 | 1 | Potassium | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 157 | 1 | Potassium; via carbonyl oxygen | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 315 | 1 | Magnesium | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 339 | 1 | Magnesium | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 116 | 1 | Substrate | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 338 | 1 | Substrate; via amide nitrogen | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 339 | 1 | Substrate; via amide nitrogen | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 371 | 1 | Substrate | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 525 | 1 | Allosteric activator | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 532 | 1 | Allosteric activator | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 313 | 1 | Transition state stabilizer By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 33 | 33 | MSIQE…IGAPG → ME in isoform L-type. | VSP_002883 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 37 | 1 | G → E in PKHYP. Ref.23 | VAR_011435 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 40 | 1 | R → W in PKRD. Ref.28 | VAR_058467 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 48 – 53 | 6 | Missing in PKRD. | VAR_058468 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 73 | 1 | L → P in PKRD. Ref.28 | VAR_058469 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 80 | 1 | S → P in PKRD. | VAR_011436 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 86 | 1 | R → P in PKRD. | VAR_011437 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 90 | 1 | I → N in PKRD. Ref.28 | VAR_011438 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 95 | 1 | G → R in PKRD. | VAR_011439 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 107 | 1 | M → T in PKRD. | VAR_004028 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 111 | 1 | G → R in PKRD. Ref.28 | VAR_011440 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 115 | 1 | A → P in PKRD; Val de Marne. | VAR_011441 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 120 | 1 | S → F in PKRD; Beaujon. | VAR_011442 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 130 | 1 | S → Y in PKRD; Conakry. Ref.25 | VAR_011443 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 131 | 1 | Missing in PKRD. | VAR_004029 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 134 | 1 | V → D in PKRD. Ref.18 | VAR_004030 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 153 | 1 | I → T in PKRD. | VAR_011474 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 154 | 1 | A → T in PKRD. Ref.28 | VAR_058470 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 155 | 1 | L → P in PKRD. Ref.18 | VAR_004031 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 159 | 1 | G → V in PKRD. | VAR_011444 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 163 | 1 | R → C in PKRD; Linz. Ref.15 | VAR_004033 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 163 | 1 | R → L in PKRD. Ref.28 | VAR_058471 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 165 | 1 | G → V in PKRD. Ref.28 | VAR_058472 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 172 | 1 | E → Q in PKRD; Sassari. Ref.24 | VAR_004032 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 219 | 1 | I → T in PKRD. | VAR_011475 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 221 | 1 | D → DD in PKRD. | VAR_004034 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 222 | 1 | G → A in PKRD; Katsushika. | VAR_011445 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 263 | 1 | G → R in PKRD. | VAR_011447 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 263 | 1 | G → W in PKRD. | VAR_011448 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 272 | 1 | L → V in PKRD. Ref.28 | VAR_058473 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 275 | 1 | G → R in PKRD. | VAR_004035 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 281 | 1 | D → N in PKRD. | VAR_004036 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 287 | 1 | F → V in PKRD. | VAR_004037 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 288 | 1 | V → L in PKRD; Moriguchi. | VAR_011449 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 293 | 1 | D → N in PKRD. | VAR_011446 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 295 | 1 | A → V in PKRD. | VAR_011450 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 310 | 1 | I → N in PKRD; Dordrecht. Ref.28 | VAR_011451 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 314 | 1 | I → T in PKRD; Hong Kong. | VAR_004038 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 315 | 1 | E → K in PKRD. | VAR_011452 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 320 | 1 | V → L in PKRD. Ref.28 | VAR_058474 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 331 | 1 | D → E in PKRD; Parma. Ref.21 | VAR_004039 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 331 | 1 | D → N in PKRD. | VAR_011453 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 332 | 1 | G → S in PKRD; loss of catalytical activity. Ref.14 Ref.20 Ref.26 | VAR_004040 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 335 | 1 | V → M in PKRD. Ref.27 | VAR_011476 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 336 | 1 | A → S in PKRD. Ref.20 | VAR_004041 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 337 | 1 | R → P in PKRD. Ref.26 | VAR_004042 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 337 | 1 | R → Q in PKRD. Ref.24 | VAR_004043 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 339 | 1 | D → H in PKRD. Ref.24 | VAR_004044 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 341 | 1 | G → A in PKRD. Ref.21 Ref.29 | VAR_004045 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 341 | 1 | G → D in PKRD. | VAR_011454 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 342 | 1 | I → F in PKRD. | VAR_011455 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 348 | 1 | K → N in PKRD; Kamata. | VAR_011456 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 348 | 1 | Missing in PKRD; Brescia. Ref.27 | VAR_011457 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 352 | 1 | A → D in PKRD. | VAR_011477 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 354 | 1 | Missing in PKRD. Ref.20 | VAR_004046 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 357 | 1 | I → T in PKRD. Ref.24 | VAR_004047 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 358 | 1 | G → E in PKRD. Ref.28 | VAR_058475 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 359 | 1 | R → C in PKRD; Aomori. | VAR_004048 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 359 | 1 | R → H in PKRD. Ref.18 | VAR_004049 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 361 | 1 | N → D in PKRD. Ref.20 | VAR_004050 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 364 | 1 | G → D in PKRD; Tjaereborg; unstability of the protein and decrease in catalytic activity. Ref.14 | VAR_011458 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 368 | 1 | V → F in PKRD; Osaka. Ref.7 | VAR_004051 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 374 | 1 | L → P in PKRD. Ref.28 | VAR_058476 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 376 | 1 | S → I in PKRD. | VAR_011459 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 384 | 1 | T → M in PKRD; Tokyo/Beirut; most common mutation in Japanese population; no conformational change. Ref.1 Ref.14 Ref.15 | VAR_004052 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 385 | 1 | R → W in PKRD. | VAR_011478 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 387 | 1 | E → G in PKRD. Ref.27 | VAR_011460 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 390 | 1 | D → N in PKRD; Mantova; almost complete inactivation. Ref.14 | VAR_011461 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 392 | 1 | A → T in PKRD. Ref.20 | VAR_004053 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 393 | 1 | N → K in PKRD. Ref.21 | VAR_004054 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 393 | 1 | N → S in PKRD; Paris. Ref.21 | VAR_004055 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 394 | 1 | A → D in PKRD. Ref.27 | VAR_011462 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 394 | 1 | A → V in PKRD. Ref.27 | VAR_011463 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 401 | 1 | C → CS in PKRD. | VAR_004056 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 408 | 1 | T → A in PKRD; Hirosaki. | VAR_011464 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 408 | 1 | T → I in PKRD. Ref.24 | VAR_004057 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 421 | 1 | Q → K in PKRD; Fukushima/Maebashi/Sendai. Ref.16 | VAR_004058 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 426 | 1 | R → Q in PKRD; Sapporo. Ref.17 | VAR_004059 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 426 | 1 | R → W in PKRD; Naniwa. | VAR_004060 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 427 | 1 | E → A in PKRD. | VAR_011465 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 427 | 1 | E → D in PKRD. | VAR_011466 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 431 | 1 | A → T in PKRD. Ref.24 | VAR_004061 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 458 | 1 | G → D in PKRD. Ref.21 | VAR_004062 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 459 | 1 | A → V in PKRD. | VAR_004063 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 460 | 1 | V → M in PKRD. Ref.21 | VAR_004064 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 468 | 1 | A → G in PKRD. | VAR_011479 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 468 | 1 | A → V in PKRD; Hadano. | VAR_004065 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 477 | 1 | T → A in PKRD. | VAR_011467 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 479 | 1 | R → H in PKRD; Amish; no conformational change. Ref.14 Ref.19 | VAR_011480 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 485 | 1 | S → F in PKRD. | VAR_011468 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 486 | 1 | R → W in PKRD; frequent mutation; no conformational change. Ref.14 Ref.18 Ref.24 Ref.26 | VAR_004066 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 488 | 1 | R → Q in PKRD. | VAR_011469 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 490 | 1 | R → W in PKRD. | VAR_004067 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 495 | 1 | A → T in PKRD. | VAR_011470 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 495 | 1 | A → V in PKRD. Ref.18 | VAR_004068 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 498 | 1 | R → C in PKRD. Ref.26 | VAR_004069 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 498 | 1 | R → H in PKRD. Ref.20 Ref.21 | VAR_004070 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 504 | 1 | R → L in PKRD; instability of the protein. Ref.14 | VAR_011471 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 506 | 1 | V → I. Ref.4 Corresponds to variant rs8177988 [ dbSNP | Ensembl ]. | VAR_018848 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 510 | 1 | R → Q in PKRD; the most common mutation in European population. Ref.18 Ref.20 Ref.26 | VAR_004071 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 511 | 1 | G → R in PKRD. | VAR_011472 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 531 | 1 | R → C in PKRD. | VAR_011473 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 532 | 1 | R → Q in PKRD. Ref.24 | VAR_004072 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 532 | 1 | R → W in PKRD; Complete loss in the responsiveness to fructose 1,6-bisphosphate, FBP. Ref.14 Ref.20 | VAR_004073 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 552 | 1 | V → M in PKRD. | VAR_004074 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 557 | 1 | G → A in PKRD. | VAR_011481 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 559 | 1 | R → G in PKRD. | VAR_004075 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 566 | 1 | N → K in PKRD. | VAR_004076 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 569 | 1 | R → Q in PKRD. Ref.29 | VAR_011482 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 423 | 1 | A → R in AAA60104. Ref.2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 49 – 51 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 55 – 57 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 61 – 64 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 69 – 74 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 88 – 93 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 96 – 98 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 101 – 110 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 112 – 118 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 124 – 139 | 16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 140 – 143 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 145 – 147 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 152 – 156 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 162 – 164 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 170 – 172 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 175 – 177 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 182 – 186 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 189 – 191 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 199 – 203 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 207 – 210 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 216 – 219 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 220 – 223 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 224 – 232 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 235 – 242 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 244 – 246 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 251 – 253 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 266 – 277 | 12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 281 – 285 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 291 – 301 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 303 – 305 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 309 – 314 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 317 – 321 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 323 – 329 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 330 – 336 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 337 – 343 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 346 – 348 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 349 – 363 | 15 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 367 – 372 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 375 – 378 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 385 – 397 | 13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 400 – 405 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 406 – 409 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 414 – 430 | 17 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 434 – 442 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 451 – 466 | 16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 469 – 474 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 476 – 478 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 479 – 485 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 490 – 498 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 500 – 505 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 506 – 508 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 512 – 516 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 525 – 542 | 18 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 551 – 561 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 565 – 572 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "cDNA cloning of human R-type pyruvate kinase and identification of a single amino acid substitution (Thr384-->Met) affecting enzymatic stability in a pyruvate kinase variant (PK Tokyo) associated with hereditary hemolytic anemia." Kanno H., Fujii H., Hirono A., Miwa S. Proc. Natl. Acad. Sci. U.S.A. 88:8218-8221(1991) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], VARIANT PKRD MET-384. |
| [2] | "Human liver type pyruvate kinase: complete amino acid sequence and the expression in mammalian cells." Tani K., Fujii H., Nagata S., Miwa S. Proc. Natl. Acad. Sci. U.S.A. 85:1792-1795(1988) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. |
| [3] | Kanno H. Submitted (JUL-1998) to the EMBL/GenBank/DDBJ databases Cited for: SEQUENCE REVISION TO 130 AND 232. |
| [4] | NIEHS SNPs program Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT ILE-506. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM R-TYPE). Tissue: Pancreas. |
| [6] | "Human liver type pyruvate kinase: cDNA cloning and chromosomal assignment." Tani K., Fujii H., Tsutsumi H., Sukegawa J., Toyoshima K., Yoshida M.C., Noguchi T., Tanaka T., Miwa S. Biochem. Biophys. Res. Commun. 143:431-438(1987) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 470-574. |
| [7] | "Molecular basis of impaired pyruvate kinase isozyme conversion in erythroid cells: a single amino acid substitution near the active site and decreased mRNA content of the R-type PK." Kanno H., Fujii H., Tsujino G., Miwa S. Biochem. Biophys. Res. Commun. 192:46-52(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 365-431, VARIANT PKRD PHE-368. |
| [8] | "Mutations in pyruvate kinase." Beutler E., Baronciani L. Hum. Mutat. 7:1-6(1996) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW ON VARIANTS. |
| [9] | "Hematologically important mutations: red cell pyruvate kinase." Baronciani L., Bianchi P., Zanella A. Blood Cells Mol. Dis. 22:85-89(1996) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW ON VARIANTS. |
| [10] | "Hematologically important mutations: red cell pyruvate kinase (1st update)." Baronciani L., Bianchi P., Zanella A. Blood Cells Mol. Dis. 22:259-264(1996) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW ON VARIANTS. |
| [11] | "Hematologically important mutations: red cell pyruvate kinase (2nd update)." Baronciani L., Bianchi P., Zanella A. Blood Cells Mol. Dis. 24:273-279(1998) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW ON VARIANTS. |
| [12] | "Hematologically important mutations: red cell pyruvate kinase (third update)." Bianchi P., Zanella A. Blood Cells Mol. Dis. 26:47-53(2000) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW ON VARIANTS. |
| [13] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [14] | "Structure and function of human erythrocyte pyruvate kinase. Molecular basis of nonspherocytic hemolytic anemia." Valentini G., Chiarelli L.R., Fortin R., Dolzan M., Galizzi A., Abraham D.J., Wang C., Bianchi P., Zanella A., Mattevi A. J. Biol. Chem. 277:23807-23814(2002) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.73 ANGSTROMS) OF 47-574 IN COMPLEX WITH FRUCTOSE 1,6-BISPHOSPHATE, ALLOSTERIC ACTIVATION, ENZYME REGULATION, CHARACTERIZATION OF VARIANTS PKRD SER-332; ASP-364; ASN-390; HIS-479; TRP-486; LEU-504 AND TRP-532, CHARACTERIZATION OF VARIANT MET-384, SUBUNIT. |
| [15] | "Point mutations in the L-type pyruvate kinase gene of two children with hemolytic anemia caused by pyruvate kinase deficiency." Neubauer B., Lakomek M., Winkler H., Parke M., Hofferbert S., Schroter W. Blood 77:1871-1875(1991) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS PKRD CYS-163 AND MET-384. |
| [16] | "Identical point mutations of the R-type pyruvate kinase (PK) cDNA found in unrelated PK variants associated with hereditary hemolytic anemia." Kanno H., Fujii H., Hirono A., Omine M., Miwa S. Blood 79:1347-1350(1992) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT PKRD LYS-421. |
| [17] | "Low substrate affinity of pyruvate kinase variant (PK Sapporo) caused by a single amino acid substitution (426 Arg-->Gln) associated with hereditary hemolytic anemia." Kanno H., Fujii H., Miwa S. Blood 81:2439-2441(1993) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT PKRD GLN-426. |
| [18] | "Analysis of pyruvate kinase-deficiency mutations that produce nonspherocytic hemolytic anemia." Baronciani L., Beutler E. Proc. Natl. Acad. Sci. U.S.A. 90:4324-4327(1993) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS PKRD ASP-134; PRO-155; HIS-359; TRP-486; VAL-495 AND GLN-510. |
| [19] | "Molecular abnormality of erythrocyte pyruvate kinase deficiency in the Amish." Kanno H., Ballas S.K., Miwa S., Fujii H., Bowman H.S. Blood 83:2311-2316(1994) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT PKRD HIS-479. |
| [20] | "Mutations in the pyruvate kinase L gene in patients with hereditary hemolytic anemia." Lenzner C., Nuernberg P., Thiele B.-J., Reis A., Brabec V., Sakalova A., Jacobasch G. Blood 83:2817-2822(1994) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS PKRD SER-332; SER-336; LYS-354 DEL; ASP-361; THR-392; HIS-498; GLN-510 AND TRP-532. |
| [21] | "Molecular study of pyruvate kinase deficient patients with hereditary nonspherocytic hemolytic anemia." Baronciani L., Beutler E. J. Clin. Invest. 95:1702-1709(1995) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS PKRD GLU-331; ALA-341; LYS-393; SER-393; ASP-458; MET-460 AND HIS-498. |
| [22] | "Study of the molecular defects in pyruvate kinase (PK) deficient patients affected by hereditary nonspherocytic hemolytic anemia (HNHA)." Baronciani L., Westwood B., Beutler E. J. Invest. Med. 43:341A-341A(1995) Cited for: VARIANTS PKRD. |
| [23] | "G-to-T transition at cDNA nt 110 (K37Q) in the PKLR (pyruvate kinase) gene is the molecular basis of a case of hereditary increase of red blood cell ATP." Beutler E., Westwood B., van Zwieten R., Roos D. Hum. Mutat. 9:282-285(1997) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT PKHYP GLU-37. |
| [24] | "Molecular characterization of the PK-LR gene in pyruvate kinase deficient Spanish patients." Zarza R., Alvarez R., Pujades A., Nomdedeu B., Carrera A., Estella J., Remacha A., Sanchez J.M., Morey M., Cortes T., Perez Lungmus G., Bureo E., Vives Corrons J.L. Br. J. Haematol. 103:377-382(1998) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS PKRD GLN-172; GLN-337; HIS-339; THR-357; ILE-408; THR-431; TRP-486 AND GLN-532. |
| [25] | "A new sickle cell disease phenotype associating Hb S trait, severe pyruvate kinase deficiency (PK Conakry), and an alpha-2 globin gene variant (Hb Conakry)." Cohen-Solal M., Prehu C., Wajcman H., Poyart C., Bardakdjian-Michau J., Kister J., Prome D., Valentin C., Bachir D., Galacteros F. Br. J. Haematol. 103:950-956(1998) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT PKRD TYR-130. |
| [26] | "Novel mutations and structural implications in R-type pyruvate kinase-deficient patients from Southern Italy." Pastore L., della Morte R., Frisso G., Alfinito F., Vitale D., Calise R.M., Ferraro F., Zagari A., Rotoli B., Salvatore F. Hum. Mutat. 11:127-134(1998) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS PKRD SER-332; PRO-337; TRP-486; CYS-498 AND GLN-510. |
| [27] | "Molecular characterization of the PK-LR gene in sixteen pyruvate kinase-deficient patients." Zanella A., Bianchi P., Fermo E., Iurlo A., Zappa M., Vercellati C., Boschetti C., Baronciani L., Cotton F. Br. J. Haematol. 113:43-48(2001) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS PKRD MET-335; LYS-348 DEL; GLY-387; ASP-394 AND VAL-394. |
| [28] | "Fifteen novel mutations in PKLR associated with pyruvate kinase (PK) deficiency: structural implications of amino acid substitutions in PK." van Wijk R., Huizinga E.G., van Wesel A.C.W., van Oirschot B.A., Hadders M.A., van Solinge W.W. Hum. Mutat. 30:446-453(2009) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS PKRD TRP-40; 48-THR--THR-53 DEL; PRO-73; ASN-90; ARG-111; THR-154; LEU-163; VAL-165; VAL-272; ASN-310; LEU-320; GLU-358 AND PRO-374. |
| [29] | "Exome sequencing and unrelated findings in the context of complex disease research: ethical and clinical implications." Lyon G.J., Jiang T., Van Wijk R., Wang W., Bodily P.M., Xing J., Tian L., Robison R.J., Clement M., Lin Y., Zhang P., Liu Y., Moore B., Glessner J.T., Elia J., Reimherr F., van Solinge W.W., Yandell M. Wang K.Discov. Med. 12:41-55(2011) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS PKRD ALA-341 AND GLN-569. |
| + | Additional computationally mapped references. |
Web resources
| GeneReviews |
| NIEHS-SNPs |
| Wikipedia Pyruvate kinase entry |
| PKLR Mutation Database |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AB015983 mRNA. Translation: BAA31706.1. M15465 mRNA. Translation: AAA60104.1. AY316591 Genomic DNA. Translation: AAP69527.1. BC025737 mRNA. Translation: AAH25737.1. S60712 mRNA. Translation: AAB26262.1. | ||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00027165. IPI00941093. | ||||||||||||||||||||||||||||||||||||||||||
| PIR | KIHUPR. I52269. | ||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_000289.1. NM_000298.5. NP_870986.1. NM_181871.3. | ||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.95990. | ||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | P30613. | ||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||
| IntAct | P30613. 4 interactions. | ||||||||||||||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000339933. | ||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | P30613. | ||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||
| DMDM | 8247933. | ||||||||||||||||||||||||||||||||||||||||||
2D gel databases | |||||||||||||||||||||||||||||||||||||||||||
| REPRODUCTION-2DPAGE | P30613. | ||||||||||||||||||||||||||||||||||||||||||
| SWISS-2DPAGE | P30613. | ||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||
| PaxDb | P30613. | ||||||||||||||||||||||||||||||||||||||||||
| PRIDE | P30613. | ||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||
| DNASU | 5313. | ||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000342741; ENSP00000339933; ENSG00000143627. ENST00000392414; ENSP00000376214; ENSG00000143627. ENST00000571194; ENSP00000461487; ENSG00000262785. ENST00000572740; ENSP00000459921; ENSG00000262785. | ||||||||||||||||||||||||||||||||||||||||||
| GeneID | 5313. | ||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:5313. | ||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc001fka.4. human. uc001fkb.4. human. | ||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||
| CTD | 5313. | ||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC01M155259. | ||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:9020. PKLR. | ||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB034376. CAB034378. | ||||||||||||||||||||||||||||||||||||||||||
| MIM | 102900. phenotype. 266200. phenotype. 609712. gene. | ||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_P30613. | ||||||||||||||||||||||||||||||||||||||||||
| Orphanet | 766. Hemolytic anemia due to red cell pyruvate kinase deficiency. | ||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA33352. | ||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||
| eggNOG | COG0469. | ||||||||||||||||||||||||||||||||||||||||||
| HOGENOM | HOG000021559. | ||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG000941. | ||||||||||||||||||||||||||||||||||||||||||
| KO | K12406. | ||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | hnf3bpathway. FOXA2 and FOXA3 transcription factor networks. | ||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_111045. Developmental Biology. REACT_111217. Metabolism. | ||||||||||||||||||||||||||||||||||||||||||
| SABIO-RK | P30613. | ||||||||||||||||||||||||||||||||||||||||||
| UniPathway | UPA00109; UER00188. | ||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | P30613. | ||||||||||||||||||||||||||||||||||||||||||
| Bgee | P30613. | ||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_PKLR. | ||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | P30613. | ||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000143627. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||
| Gene3D | 2.40.33.10. 1 hit. 3.20.20.60. 2 hits. 3.40.1380.20. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR001697. Pyr_Knase. IPR015813. Pyrv/PenolPyrv_Kinase. IPR011037. Pyrv_Knase-like_insert_dom. IPR015794. Pyrv_Knase_a/b. IPR018209. Pyrv_Knase_AS. IPR015793. Pyrv_Knase_brl. IPR015795. Pyrv_Knase_C. IPR015806. Pyrv_Knase_insert_dom. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| PANTHER | PTHR11817. PTHR11817. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00224. PK. 1 hit. PF02887. PK_C. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| PRINTS | PR01050. PYRUVTKNASE. | ||||||||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF50800. PK_B_barrel_like. 1 hit. SSF52935. Pyruvate_kinase. 1 hit. SSF51621. Pyrv/PenolPyrv_Kinase_cat. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||
| TIGRFAMs | TIGR01064. pyruv_kin. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS00110. PYRUVATE_KINASE. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||
| ChEMBL | CHEMBL1075126. | ||||||||||||||||||||||||||||||||||||||||||
| DrugBank | DB00119. Pyruvic acid. | ||||||||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | P30613. | ||||||||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 5313. | ||||||||||||||||||||||||||||||||||||||||||
| NextBio | 20542. | ||||||||||||||||||||||||||||||||||||||||||
| PMAP-CutDB | P30613. | ||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | KPYR_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P30613 Secondary accession number(s): P11973 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
