Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Pyruvate kinase PKLR

Gene

PKLR

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Plays a key role in glycolysis.By similarity

Catalytic activityi

ATP + pyruvate = ADP + phosphoenolpyruvate.

Cofactori

Protein has several cofactor binding sites:
  • Mg2+1 Publication
  • K+1 Publication

Enzyme regulationi

Allosterically activated by fructose 1,6-bisphosphate.1 Publication

Pathwayi: glycolysis

This protein is involved in step 5 of the subpathway that synthesizes pyruvate from D-glyceraldehyde 3-phosphate.
Proteins known to be involved in the 5 steps of the subpathway in this organism are:
  1. Glyceraldehyde-3-phosphate dehydrogenase, Glyceraldehyde-3-phosphate dehydrogenase (HEL-S-162eP), Glyceraldehyde-3-phosphate dehydrogenase (GAPDH), Glyceraldehyde-3-phosphate dehydrogenase (HEL-S-278), Glyceraldehyde-3-phosphate dehydrogenase, testis-specific (GAPDHS)
  2. Phosphoglycerate kinase 2 (PGK2), Phosphoglycerate kinase 1 (PGK1)
  3. no protein annotated in this organism
  4. Alpha-enolase (ENO1), Beta-enolase (ENO3), Enolase 4 (ENO4), Gamma-enolase (ENO2)
  5. Pyruvate kinase, Pyruvate kinase PKM (PKM), Pyruvate kinase (PKM2), Pyruvate kinase (PKM), Pyruvate kinase (PKM2), Pyruvate kinase (PKM), Pyruvate kinase, Pyruvate kinase (PKM), Pyruvate kinase, Pyruvate kinase PKLR (PKLR), Pyruvate kinase, Pyruvate kinase (PKM2), Pyruvate kinase (HEL-S-30), Pyruvate kinase (PKM), Pyruvate kinase (PKM2)
This subpathway is part of the pathway glycolysis, which is itself part of Carbohydrate degradation.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes pyruvate from D-glyceraldehyde 3-phosphate, the pathway glycolysis and in Carbohydrate degradation.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei116 – 1161SubstrateCombined sources1 Publication
Metal bindingi118 – 1181PotassiumCombined sources1 Publication
Metal bindingi120 – 1201PotassiumCombined sources1 Publication
Metal bindingi156 – 1561PotassiumCombined sources1 Publication
Metal bindingi157 – 1571Potassium; via carbonyl oxygenCombined sources1 Publication
Binding sitei313 – 3131Substrate; via amide nitrogenCombined sources1 Publication
Sitei313 – 3131Transition state stabilizerBy similarity
Metal bindingi315 – 3151ManganeseCombined sources1 Publication
Binding sitei338 – 3381Substrate; via amide nitrogenCombined sources1 Publication
Metal bindingi339 – 3391ManganeseCombined sources1 Publication
Binding sitei339 – 3391Substrate; via amide nitrogenCombined sources1 Publication
Binding sitei371 – 3711SubstrateCombined sources1 Publication
Binding sitei525 – 5251Allosteric activatorCombined sources1 Publication
Binding sitei532 – 5321Allosteric activatorCombined sources1 Publication

GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • kinase activity Source: UniProtKB-KW
  • magnesium ion binding Source: InterPro
  • potassium ion binding Source: InterPro
  • pyruvate kinase activity Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Kinase, Transferase

Keywords - Biological processi

Glycolysis

Keywords - Ligandi

ATP-binding, Magnesium, Metal-binding, Nucleotide-binding, Potassium, Pyruvate

Enzyme and pathway databases

BioCyciMetaCyc:HS07088-MONOMER.
BRENDAi2.7.1.40. 2681.
ReactomeiR-HSA-163765. ChREBP activates metabolic gene expression.
R-HSA-210745. Regulation of gene expression in beta cells.
R-HSA-70171. Glycolysis.
SABIO-RKP30613.
UniPathwayiUPA00109; UER00188.

Names & Taxonomyi

Protein namesi
Recommended name:
Pyruvate kinase PKLR (EC:2.7.1.40)
Alternative name(s):
Pyruvate kinase 1
Pyruvate kinase isozymes L/R
R-type/L-type pyruvate kinase
Red cell/liver pyruvate kinase
Gene namesi
Name:PKLR
Synonyms:PK1, PKL
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:9020. PKLR.

Subcellular locationi

GO - Cellular componenti

  • cytosol Source: Reactome
  • extracellular exosome Source: UniProtKB
Complete GO annotation...

Pathology & Biotechi

Involvement in diseasei

Pyruvate kinase hyperactivity (PKHYP)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAutosomal dominant phenotype characterized by increase of red blood cell ATP.
See also OMIM:102900
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti37 – 371G → E in PKHYP. 1 Publication
Corresponds to variant rs118204087 [ dbSNP | Ensembl ].
VAR_011435
Pyruvate kinase deficiency of red cells (PKRD)16 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA frequent cause of hereditary non-spherocytic hemolytic anemia. Clinically, pyruvate kinase-deficient patients suffer from a highly variable degree of chronic hemolysis, ranging from severe neonatal jaundice and fatal anemia at birth, severe transfusion-dependent chronic hemolysis, moderate hemolysis with exacerbation during infection, to a fully compensated hemolysis without apparent anemia.
See also OMIM:266200
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti40 – 401R → W in PKRD. 1 Publication
VAR_058467
Natural varianti48 – 536Missing in PKRD. 1 Publication
VAR_058468
Natural varianti73 – 731L → P in PKRD. 1 Publication
VAR_058469
Natural varianti80 – 801S → P in PKRD.
VAR_011436
Natural varianti86 – 861R → P in PKRD.
VAR_011437
Natural varianti90 – 901I → N in PKRD. 1 Publication
VAR_011438
Natural varianti95 – 951G → R in PKRD.
Corresponds to variant rs750857114 [ dbSNP | Ensembl ].
VAR_011439
Natural varianti107 – 1071M → T in PKRD.
VAR_004028
Natural varianti111 – 1111G → R in PKRD. 1 Publication
VAR_011440
Natural varianti115 – 1151A → P in PKRD; Val de Marne.
VAR_011441
Natural varianti120 – 1201S → F in PKRD; Beaujon.
VAR_011442
Natural varianti130 – 1301S → Y in PKRD; Conakry. 1 Publication
Corresponds to variant rs118204089 [ dbSNP | Ensembl ].
VAR_011443
Natural varianti131 – 1311Missing in PKRD.
VAR_004029
Natural varianti134 – 1341V → D in PKRD. 1 Publication
Corresponds to variant rs574051756 [ dbSNP | Ensembl ].
VAR_004030
Natural varianti153 – 1531I → T in PKRD.
VAR_011474
Natural varianti154 – 1541A → T in PKRD. 1 Publication
Corresponds to variant rs780192373 [ dbSNP | Ensembl ].
VAR_058470
Natural varianti155 – 1551L → P in PKRD. 1 Publication
VAR_004031
Natural varianti159 – 1591G → V in PKRD.
VAR_011444
Natural varianti163 – 1631R → C in PKRD; Linz. 1 Publication
Corresponds to variant rs118204083 [ dbSNP | Ensembl ].
VAR_004033
Natural varianti163 – 1631R → L in PKRD. 1 Publication
VAR_058471
Natural varianti165 – 1651G → V in PKRD. 1 Publication
VAR_058472
Natural varianti172 – 1721E → Q in PKRD; Sassari. 1 Publication
Corresponds to variant rs757359024 [ dbSNP | Ensembl ].
VAR_004032
Natural varianti219 – 2191I → T in PKRD.
Corresponds to variant rs200572803 [ dbSNP | Ensembl ].
VAR_011475
Natural varianti221 – 2211D → DD in PKRD.
VAR_004034
Natural varianti222 – 2221G → A in PKRD; Katsushika.
VAR_011445
Natural varianti263 – 2631G → R in PKRD.
VAR_011447
Natural varianti263 – 2631G → W in PKRD.
VAR_011448
Natural varianti272 – 2721L → V in PKRD. 1 Publication
Corresponds to variant rs147659527 [ dbSNP | Ensembl ].
VAR_058473
Natural varianti275 – 2751G → R in PKRD.
Corresponds to variant rs747549978 [ dbSNP | Ensembl ].
VAR_004035
Natural varianti281 – 2811D → N in PKRD.
VAR_004036
Natural varianti287 – 2871F → V in PKRD.
VAR_004037
Natural varianti288 – 2881V → L in PKRD; Moriguchi.
VAR_011449
Natural varianti293 – 2931D → N in PKRD.
VAR_011446
Natural varianti295 – 2951A → V in PKRD.
Corresponds to variant rs766353400 [ dbSNP | Ensembl ].
VAR_011450
Natural varianti310 – 3101I → N in PKRD; Dordrecht. 1 Publication
VAR_011451
Natural varianti314 – 3141I → T in PKRD; Hong Kong.
VAR_004038
Natural varianti315 – 3151E → K in PKRD.
VAR_011452
Natural varianti320 – 3201V → L in PKRD. 1 Publication
Corresponds to variant rs549295725 [ dbSNP | Ensembl ].
VAR_058474
Natural varianti331 – 3311D → E in PKRD; Parma. 1 Publication
Corresponds to variant rs138476691 [ dbSNP | Ensembl ].
VAR_004039
Natural varianti331 – 3311D → N in PKRD.
Corresponds to variant rs773893686 [ dbSNP | Ensembl ].
VAR_011453
Natural varianti332 – 3321G → S in PKRD; loss of catalytical activity. 3 Publications
Corresponds to variant rs773626254 [ dbSNP | Ensembl ].
VAR_004040
Natural varianti335 – 3351V → M in PKRD. 1 Publication
VAR_011476
Natural varianti336 – 3361A → S in PKRD. 1 Publication
VAR_004041
Natural varianti337 – 3371R → P in PKRD. 1 Publication
VAR_004042
Natural varianti337 – 3371R → Q in PKRD. 1 Publication
VAR_004043
Natural varianti339 – 3391D → H in PKRD. 1 Publication
VAR_004044
Natural varianti341 – 3411G → A in PKRD. 2 Publications
VAR_004045
Natural varianti341 – 3411G → D in PKRD.
VAR_011454
Natural varianti342 – 3421I → F in PKRD.
VAR_011455
Natural varianti348 – 3481K → N in PKRD; Kamata.
VAR_011456
Natural varianti348 – 3481Missing in PKRD; Brescia. 1 Publication
VAR_011457
Natural varianti352 – 3521A → D in PKRD.
VAR_011477
Natural varianti354 – 3541Missing in PKRD. 1 Publication
VAR_004046
Natural varianti357 – 3571I → T in PKRD. 1 Publication
Corresponds to variant rs779152555 [ dbSNP | Ensembl ].
VAR_004047
Natural varianti358 – 3581G → E in PKRD. 1 Publication
VAR_058475
Natural varianti359 – 3591R → C in PKRD; Aomori.
Corresponds to variant rs138871700 [ dbSNP | Ensembl ].
VAR_004048
Natural varianti359 – 3591R → H in PKRD. 1 Publication
VAR_004049
Natural varianti361 – 3611N → D in PKRD. 1 Publication
Corresponds to variant rs765903674 [ dbSNP | Ensembl ].
VAR_004050
Natural varianti364 – 3641G → D in PKRD; Tjaereborg; unstability of the protein and decrease in catalytic activity. 1 Publication
VAR_011458
Natural varianti368 – 3681V → F in PKRD; Osaka. 1 Publication
VAR_004051
Natural varianti374 – 3741L → P in PKRD. 1 Publication
VAR_058476
Natural varianti376 – 3761S → I in PKRD.
VAR_011459
Natural varianti384 – 3841T → M in PKRD; Tokyo/Beirut; most common mutation in Japanese population; no conformational change. 3 Publications
Corresponds to variant rs74315362 [ dbSNP | Ensembl ].
VAR_004052
Natural varianti385 – 3851R → W in PKRD.
VAR_011478
Natural varianti387 – 3871E → G in PKRD. 1 Publication
VAR_011460
Natural varianti390 – 3901D → N in PKRD; Mantova; almost complete inactivation. 1 Publication
Corresponds to variant rs147034239 [ dbSNP | Ensembl ].
VAR_011461
Natural varianti392 – 3921A → T in PKRD. 1 Publication
VAR_004053
Natural varianti393 – 3931N → K in PKRD. 1 Publication
VAR_004054
Natural varianti393 – 3931N → S in PKRD; Paris. 1 Publication
Corresponds to variant rs776594413 [ dbSNP | Ensembl ].
VAR_004055
Natural varianti394 – 3941A → D in PKRD. 1 Publication
VAR_011462
Natural varianti394 – 3941A → V in PKRD. 1 Publication
VAR_011463
Natural varianti401 – 4011C → CS in PKRD.
VAR_004056
Natural varianti408 – 4081T → A in PKRD; Hirosaki.
VAR_011464
Natural varianti408 – 4081T → I in PKRD. 1 Publication
VAR_004057
Natural varianti421 – 4211Q → K in PKRD; Fukushima/Maebashi/Sendai. 1 Publication
Corresponds to variant rs118204084 [ dbSNP | Ensembl ].
VAR_004058
Natural varianti426 – 4261R → Q in PKRD; Sapporo. 1 Publication
Corresponds to variant rs768002493 [ dbSNP | Ensembl ].
VAR_004059
Natural varianti426 – 4261R → W in PKRD; Naniwa.
VAR_004060
Natural varianti427 – 4271E → A in PKRD.
VAR_011465
Natural varianti427 – 4271E → D in PKRD.
VAR_011466
Natural varianti431 – 4311A → T in PKRD. 1 Publication
Corresponds to variant rs762591322 [ dbSNP | Ensembl ].
VAR_004061
Natural varianti458 – 4581G → D in PKRD. 1 Publication
Corresponds to variant rs755522396 [ dbSNP | Ensembl ].
VAR_004062
Natural varianti459 – 4591A → V in PKRD.
VAR_004063
Natural varianti460 – 4601V → M in PKRD. 1 Publication
Corresponds to variant rs752034960 [ dbSNP | Ensembl ].
VAR_004064
Natural varianti468 – 4681A → G in PKRD.
Corresponds to variant rs750540943 [ dbSNP | Ensembl ].
VAR_011479
Natural varianti468 – 4681A → V in PKRD; Hadano.
VAR_004065
Natural varianti477 – 4771T → A in PKRD.
Corresponds to variant rs759466273 [ dbSNP | Ensembl ].
VAR_011467
Natural varianti479 – 4791R → H in PKRD; Amish; no conformational change. 2 Publications
Corresponds to variant rs118204085 [ dbSNP | Ensembl ].
VAR_011480
Natural varianti485 – 4851S → F in PKRD.
VAR_011468
Natural varianti486 – 4861R → W in PKRD; frequent mutation; no conformational change. 4 Publications
Corresponds to variant rs116100695 [ dbSNP | Ensembl ].
VAR_004066
Natural varianti488 – 4881R → Q in PKRD.
Corresponds to variant rs369183199 [ dbSNP | Ensembl ].
VAR_011469
Natural varianti490 – 4901R → W in PKRD.
Corresponds to variant rs200133000 [ dbSNP | Ensembl ].
VAR_004067
Natural varianti495 – 4951A → T in PKRD.
VAR_011470
Natural varianti495 – 4951A → V in PKRD. 1 Publication
Corresponds to variant rs141560532 [ dbSNP | Ensembl ].
VAR_004068
Natural varianti498 – 4981R → C in PKRD. 1 Publication
Corresponds to variant rs551883218 [ dbSNP | Ensembl ].
VAR_004069
Natural varianti498 – 4981R → H in PKRD. 2 Publications
Corresponds to variant rs758327704 [ dbSNP | Ensembl ].
VAR_004070
Natural varianti504 – 5041R → L in PKRD; instability of the protein. 1 Publication
Corresponds to variant rs185753709 [ dbSNP | Ensembl ].
VAR_011471
Natural varianti510 – 5101R → Q in PKRD; the most common mutation in European population. 3 Publications
Corresponds to variant rs113403872 [ dbSNP | Ensembl ].
VAR_004071
Natural varianti511 – 5111G → R in PKRD.
VAR_011472
Natural varianti531 – 5311R → C in PKRD.
VAR_011473
Natural varianti532 – 5321R → Q in PKRD. 1 Publication
Corresponds to variant rs758278200 [ dbSNP | Ensembl ].
VAR_004072
Natural varianti532 – 5321R → W in PKRD; Complete loss in the responsiveness to fructose 1,6-bisphosphate, FBP. 2 Publications
Corresponds to variant rs201255024 [ dbSNP | Ensembl ].
VAR_004073
Natural varianti552 – 5521V → M in PKRD.
Corresponds to variant rs370316462 [ dbSNP | Ensembl ].
VAR_004074
Natural varianti557 – 5571G → A in PKRD.
VAR_011481
Natural varianti559 – 5591R → G in PKRD.
VAR_004075
Natural varianti566 – 5661N → K in PKRD.
VAR_004076
Natural varianti569 – 5691R → Q in PKRD. 1 Publication
Corresponds to variant rs61755431 [ dbSNP | Ensembl ].
VAR_011482

Keywords - Diseasei

Disease mutation, Hereditary hemolytic anemia

Organism-specific databases

MalaCardsiPKLR.
MIMi102900. phenotype.
266200. phenotype.
Orphaneti766. Hemolytic anemia due to red cell pyruvate kinase deficiency.
PharmGKBiPA33352.

Chemistry

ChEMBLiCHEMBL1075126.
DrugBankiDB00119. Pyruvic acid.

Polymorphism and mutation databases

BioMutaiPKLR.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 574574Pyruvate kinase PKLRPRO_0000112094Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21PhosphoserineCombined sources
Modified residuei19 – 191PhosphoserineCombined sources
Modified residuei26 – 261PhosphoserineCombined sources
Modified residuei43 – 431PhosphoserineCombined sources
Modified residuei105 – 1051N6-acetyllysineBy similarity
Modified residuei109 – 1091N6-succinyllysineBy similarity
Modified residuei140 – 1401PhosphoserineBy similarity
Modified residuei148 – 1481PhosphotyrosineBy similarity
Modified residuei292 – 2921PhosphoserineCombined sources
Modified residuei313 – 3131N6-acetyllysineBy similarity
Modified residuei365 – 3651N6-acetyllysine; alternateBy similarity
Modified residuei365 – 3651N6-succinyllysine; alternateBy similarity
Modified residuei541 – 5411N6-succinyllysineBy similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiP30613.
MaxQBiP30613.
PaxDbiP30613.
PeptideAtlasiP30613.
PRIDEiP30613.

2D gel databases

REPRODUCTION-2DPAGEP30613.
SWISS-2DPAGEP30613.

PTM databases

iPTMnetiP30613.
PhosphoSiteiP30613.
SwissPalmiP30613.

Miscellaneous databases

PMAP-CutDBP30613.

Expressioni

Gene expression databases

BgeeiENSG00000143627.
CleanExiHS_PKLR.
ExpressionAtlasiP30613. baseline and differential.
GenevisibleiP30613. HS.

Organism-specific databases

HPAiCAB034376.
CAB034378.
HPA006653.

Interactioni

Subunit structurei

Homotetramer.1 Publication

Protein-protein interaction databases

BioGridi111330. 15 interactions.
IntActiP30613. 5 interactions.
STRINGi9606.ENSP00000339933.

Chemistry

BindingDBiP30613.

Structurei

Secondary structure

1
574
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Turni49 – 513Combined sources
Helixi55 – 573Combined sources
Helixi61 – 644Combined sources
Helixi69 – 746Combined sources
Beta strandi88 – 936Combined sources
Turni96 – 983Combined sources
Helixi101 – 11010Combined sources
Beta strandi112 – 1187Combined sources
Helixi124 – 13916Combined sources
Turni140 – 1434Combined sources
Helixi145 – 1473Combined sources
Beta strandi152 – 1565Combined sources
Beta strandi162 – 1643Combined sources
Beta strandi170 – 1723Combined sources
Beta strandi175 – 1773Combined sources
Beta strandi182 – 1865Combined sources
Helixi189 – 1913Combined sources
Beta strandi199 – 2035Combined sources
Helixi207 – 2104Combined sources
Beta strandi216 – 2194Combined sources
Turni220 – 2234Combined sources
Beta strandi224 – 2329Combined sources
Beta strandi235 – 2428Combined sources
Beta strandi244 – 2463Combined sources
Beta strandi251 – 2533Combined sources
Helixi266 – 27712Combined sources
Beta strandi281 – 2855Combined sources
Helixi291 – 30111Combined sources
Helixi303 – 3053Combined sources
Beta strandi309 – 3146Combined sources
Helixi317 – 3215Combined sources
Helixi323 – 3297Combined sources
Beta strandi330 – 3367Combined sources
Helixi337 – 3437Combined sources
Helixi346 – 3483Combined sources
Helixi349 – 36315Combined sources
Beta strandi367 – 3726Combined sources
Helixi375 – 3784Combined sources
Helixi385 – 39713Combined sources
Beta strandi400 – 4056Combined sources
Helixi406 – 4094Combined sources
Helixi414 – 43017Combined sources
Helixi434 – 4429Combined sources
Helixi451 – 46616Combined sources
Beta strandi469 – 4746Combined sources
Beta strandi476 – 4783Combined sources
Helixi479 – 4857Combined sources
Beta strandi490 – 4989Combined sources
Helixi500 – 5056Combined sources
Helixi506 – 5083Combined sources
Beta strandi512 – 5165Combined sources
Helixi525 – 54218Combined sources
Beta strandi551 – 56111Combined sources
Beta strandi565 – 5728Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2VGBX-ray2.73A/B/C/D47-574[»]
2VGFX-ray2.75A/B/C/D47-574[»]
2VGGX-ray2.74A/B/C/D47-574[»]
2VGIX-ray2.87A/B/C/D47-574[»]
4IMAX-ray1.95A/B/C/D34-574[»]
4IP7X-ray1.80A/B/C/D34-574[»]
ProteinModelPortaliP30613.
SMRiP30613. Positions 57-573.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP30613.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni475 – 4806Allosteric activator bindingCombined sources1 Publication
Regioni559 – 5646Allosteric activator bindingCombined sources1 Publication

Sequence similaritiesi

Belongs to the pyruvate kinase family.Curated

Phylogenomic databases

eggNOGiKOG2323. Eukaryota.
COG0469. LUCA.
GeneTreeiENSGT00390000008859.
HOGENOMiHOG000021559.
HOVERGENiHBG000941.
InParanoidiP30613.
KOiK12406.
OMAiPFERSED.
OrthoDBiEOG091G0597.
PhylomeDBiP30613.
TreeFamiTF300390.

Family and domain databases

Gene3Di2.40.33.10. 1 hit.
3.20.20.60. 2 hits.
3.40.1380.20. 1 hit.
InterProiIPR001697. Pyr_Knase.
IPR015813. Pyrv/PenolPyrv_Kinase-like_dom.
IPR011037. Pyrv_Knase-like_insert_dom.
IPR015794. Pyrv_Knase_a/b.
IPR018209. Pyrv_Knase_AS.
IPR015793. Pyrv_Knase_brl.
IPR015795. Pyrv_Knase_C.
IPR015806. Pyrv_Knase_insert_dom.
[Graphical view]
PANTHERiPTHR11817. PTHR11817. 1 hit.
PfamiPF00224. PK. 1 hit.
PF02887. PK_C. 1 hit.
[Graphical view]
PRINTSiPR01050. PYRUVTKNASE.
SUPFAMiSSF50800. SSF50800. 1 hit.
SSF51621. SSF51621. 2 hits.
SSF52935. SSF52935. 1 hit.
TIGRFAMsiTIGR01064. pyruv_kin. 1 hit.
PROSITEiPS00110. PYRUVATE_KINASE. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform R-type (identifier: P30613-1) [UniParc]FASTAAdd to basket
Also known as: PKR

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSIQENISSL QLRSWVSKSQ RDLAKSILIG APGGPAGYLR RASVAQLTQE
60 70 80 90 100
LGTAFFQQQQ LPAAMADTFL EHLCLLDIDS EPVAARSTSI IATIGPASRS
110 120 130 140 150
VERLKEMIKA GMNIARLNFS HGSHEYHAES IANVREAVES FAGSPLSYRP
160 170 180 190 200
VAIALDTKGP EIRTGILQGG PESEVELVKG SQVLVTVDPA FRTRGNANTV
210 220 230 240 250
WVDYPNIVRV VPVGGRIYID DGLISLVVQK IGPEGLVTQV ENGGVLGSRK
260 270 280 290 300
GVNLPGAQVD LPGLSEQDVR DLRFGVEHGV DIVFASFVRK ASDVAAVRAA
310 320 330 340 350
LGPEGHGIKI ISKIENHEGV KRFDEILEVS DGIMVARGDL GIEIPAEKVF
360 370 380 390 400
LAQKMMIGRC NLAGKPVVCA TQMLESMITK PRPTRAETSD VANAVLDGAD
410 420 430 440 450
CIMLSGETAK GNFPVEAVKM QHAIAREAEA AVYHRQLFEE LRRAAPLSRD
460 470 480 490 500
PTEVTAIGAV EAAFKCCAAA IIVLTTTGRS AQLLSRYRPR AAVIAVTRSA
510 520 530 540 550
QAARQVHLCR GVFPLLYREP PEAIWADDVD RRVQFGIESG KLRGFLRVGD
560 570
LVIVVTGWRP GSGYTNIMRV LSIS
Length:574
Mass (Da):61,830
Last modified:May 30, 2000 - v2
Checksum:i3B430896832032F5
GO
Isoform L-type (identifier: P30613-2) [UniParc]FASTAAdd to basket
Also known as: PKL

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MSIQENISSLQLRSWVSKSQRDLAKSILIGAPG → ME

Show »
Length:543
Mass (Da):58,494
Checksum:iCA16D3984B868D9E
GO

Sequence cautioni

The sequence BAA02515 differs from that shown. Reason: Erroneous gene model prediction. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti381 – 3811P → A in BAA02515 (Ref. 3) Curated
Sequence conflicti423 – 4231A → R in AAA60104 (PubMed:3126495).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti37 – 371G → E in PKHYP. 1 Publication
Corresponds to variant rs118204087 [ dbSNP | Ensembl ].
VAR_011435
Natural varianti40 – 401R → W in PKRD. 1 Publication
VAR_058467
Natural varianti48 – 536Missing in PKRD. 1 Publication
VAR_058468
Natural varianti73 – 731L → P in PKRD. 1 Publication
VAR_058469
Natural varianti80 – 801S → P in PKRD.
VAR_011436
Natural varianti86 – 861R → P in PKRD.
VAR_011437
Natural varianti90 – 901I → N in PKRD. 1 Publication
VAR_011438
Natural varianti95 – 951G → R in PKRD.
Corresponds to variant rs750857114 [ dbSNP | Ensembl ].
VAR_011439
Natural varianti107 – 1071M → T in PKRD.
VAR_004028
Natural varianti111 – 1111G → R in PKRD. 1 Publication
VAR_011440
Natural varianti115 – 1151A → P in PKRD; Val de Marne.
VAR_011441
Natural varianti120 – 1201S → F in PKRD; Beaujon.
VAR_011442
Natural varianti130 – 1301S → Y in PKRD; Conakry. 1 Publication
Corresponds to variant rs118204089 [ dbSNP | Ensembl ].
VAR_011443
Natural varianti131 – 1311Missing in PKRD.
VAR_004029
Natural varianti134 – 1341V → D in PKRD. 1 Publication
Corresponds to variant rs574051756 [ dbSNP | Ensembl ].
VAR_004030
Natural varianti153 – 1531I → T in PKRD.
VAR_011474
Natural varianti154 – 1541A → T in PKRD. 1 Publication
Corresponds to variant rs780192373 [ dbSNP | Ensembl ].
VAR_058470
Natural varianti155 – 1551L → P in PKRD. 1 Publication
VAR_004031
Natural varianti159 – 1591G → V in PKRD.
VAR_011444
Natural varianti163 – 1631R → C in PKRD; Linz. 1 Publication
Corresponds to variant rs118204083 [ dbSNP | Ensembl ].
VAR_004033
Natural varianti163 – 1631R → L in PKRD. 1 Publication
VAR_058471
Natural varianti165 – 1651G → V in PKRD. 1 Publication
VAR_058472
Natural varianti172 – 1721E → Q in PKRD; Sassari. 1 Publication
Corresponds to variant rs757359024 [ dbSNP | Ensembl ].
VAR_004032
Natural varianti219 – 2191I → T in PKRD.
Corresponds to variant rs200572803 [ dbSNP | Ensembl ].
VAR_011475
Natural varianti221 – 2211D → DD in PKRD.
VAR_004034
Natural varianti222 – 2221G → A in PKRD; Katsushika.
VAR_011445
Natural varianti263 – 2631G → R in PKRD.
VAR_011447
Natural varianti263 – 2631G → W in PKRD.
VAR_011448
Natural varianti272 – 2721L → V in PKRD. 1 Publication
Corresponds to variant rs147659527 [ dbSNP | Ensembl ].
VAR_058473
Natural varianti275 – 2751G → R in PKRD.
Corresponds to variant rs747549978 [ dbSNP | Ensembl ].
VAR_004035
Natural varianti281 – 2811D → N in PKRD.
VAR_004036
Natural varianti287 – 2871F → V in PKRD.
VAR_004037
Natural varianti288 – 2881V → L in PKRD; Moriguchi.
VAR_011449
Natural varianti293 – 2931D → N in PKRD.
VAR_011446
Natural varianti295 – 2951A → V in PKRD.
Corresponds to variant rs766353400 [ dbSNP | Ensembl ].
VAR_011450
Natural varianti310 – 3101I → N in PKRD; Dordrecht. 1 Publication
VAR_011451
Natural varianti314 – 3141I → T in PKRD; Hong Kong.
VAR_004038
Natural varianti315 – 3151E → K in PKRD.
VAR_011452
Natural varianti320 – 3201V → L in PKRD. 1 Publication
Corresponds to variant rs549295725 [ dbSNP | Ensembl ].
VAR_058474
Natural varianti331 – 3311D → E in PKRD; Parma. 1 Publication
Corresponds to variant rs138476691 [ dbSNP | Ensembl ].
VAR_004039
Natural varianti331 – 3311D → N in PKRD.
Corresponds to variant rs773893686 [ dbSNP | Ensembl ].
VAR_011453
Natural varianti332 – 3321G → S in PKRD; loss of catalytical activity. 3 Publications
Corresponds to variant rs773626254 [ dbSNP | Ensembl ].
VAR_004040
Natural varianti335 – 3351V → M in PKRD. 1 Publication
VAR_011476
Natural varianti336 – 3361A → S in PKRD. 1 Publication
VAR_004041
Natural varianti337 – 3371R → P in PKRD. 1 Publication
VAR_004042
Natural varianti337 – 3371R → Q in PKRD. 1 Publication
VAR_004043
Natural varianti339 – 3391D → H in PKRD. 1 Publication
VAR_004044
Natural varianti341 – 3411G → A in PKRD. 2 Publications
VAR_004045
Natural varianti341 – 3411G → D in PKRD.
VAR_011454
Natural varianti342 – 3421I → F in PKRD.
VAR_011455
Natural varianti348 – 3481K → N in PKRD; Kamata.
VAR_011456
Natural varianti348 – 3481Missing in PKRD; Brescia. 1 Publication
VAR_011457
Natural varianti352 – 3521A → D in PKRD.
VAR_011477
Natural varianti354 – 3541Missing in PKRD. 1 Publication
VAR_004046
Natural varianti357 – 3571I → T in PKRD. 1 Publication
Corresponds to variant rs779152555 [ dbSNP | Ensembl ].
VAR_004047
Natural varianti358 – 3581G → E in PKRD. 1 Publication
VAR_058475
Natural varianti359 – 3591R → C in PKRD; Aomori.
Corresponds to variant rs138871700 [ dbSNP | Ensembl ].
VAR_004048
Natural varianti359 – 3591R → H in PKRD. 1 Publication
VAR_004049
Natural varianti361 – 3611N → D in PKRD. 1 Publication
Corresponds to variant rs765903674 [ dbSNP | Ensembl ].
VAR_004050
Natural varianti364 – 3641G → D in PKRD; Tjaereborg; unstability of the protein and decrease in catalytic activity. 1 Publication
VAR_011458
Natural varianti368 – 3681V → F in PKRD; Osaka. 1 Publication
VAR_004051
Natural varianti374 – 3741L → P in PKRD. 1 Publication
VAR_058476
Natural varianti376 – 3761S → I in PKRD.
VAR_011459
Natural varianti384 – 3841T → M in PKRD; Tokyo/Beirut; most common mutation in Japanese population; no conformational change. 3 Publications
Corresponds to variant rs74315362 [ dbSNP | Ensembl ].
VAR_004052
Natural varianti385 – 3851R → W in PKRD.
VAR_011478
Natural varianti387 – 3871E → G in PKRD. 1 Publication
VAR_011460
Natural varianti390 – 3901D → N in PKRD; Mantova; almost complete inactivation. 1 Publication
Corresponds to variant rs147034239 [ dbSNP | Ensembl ].
VAR_011461
Natural varianti392 – 3921A → T in PKRD. 1 Publication
VAR_004053
Natural varianti393 – 3931N → K in PKRD. 1 Publication
VAR_004054
Natural varianti393 – 3931N → S in PKRD; Paris. 1 Publication
Corresponds to variant rs776594413 [ dbSNP | Ensembl ].
VAR_004055
Natural varianti394 – 3941A → D in PKRD. 1 Publication
VAR_011462
Natural varianti394 – 3941A → V in PKRD. 1 Publication
VAR_011463
Natural varianti401 – 4011C → CS in PKRD.
VAR_004056
Natural varianti408 – 4081T → A in PKRD; Hirosaki.
VAR_011464
Natural varianti408 – 4081T → I in PKRD. 1 Publication
VAR_004057
Natural varianti421 – 4211Q → K in PKRD; Fukushima/Maebashi/Sendai. 1 Publication
Corresponds to variant rs118204084 [ dbSNP | Ensembl ].
VAR_004058
Natural varianti426 – 4261R → Q in PKRD; Sapporo. 1 Publication
Corresponds to variant rs768002493 [ dbSNP | Ensembl ].
VAR_004059
Natural varianti426 – 4261R → W in PKRD; Naniwa.
VAR_004060
Natural varianti427 – 4271E → A in PKRD.
VAR_011465
Natural varianti427 – 4271E → D in PKRD.
VAR_011466
Natural varianti431 – 4311A → T in PKRD. 1 Publication
Corresponds to variant rs762591322 [ dbSNP | Ensembl ].
VAR_004061
Natural varianti458 – 4581G → D in PKRD. 1 Publication
Corresponds to variant rs755522396 [ dbSNP | Ensembl ].
VAR_004062
Natural varianti459 – 4591A → V in PKRD.
VAR_004063
Natural varianti460 – 4601V → M in PKRD. 1 Publication
Corresponds to variant rs752034960 [ dbSNP | Ensembl ].
VAR_004064
Natural varianti468 – 4681A → G in PKRD.
Corresponds to variant rs750540943 [ dbSNP | Ensembl ].
VAR_011479
Natural varianti468 – 4681A → V in PKRD; Hadano.
VAR_004065
Natural varianti477 – 4771T → A in PKRD.
Corresponds to variant rs759466273 [ dbSNP | Ensembl ].
VAR_011467
Natural varianti479 – 4791R → H in PKRD; Amish; no conformational change. 2 Publications
Corresponds to variant rs118204085 [ dbSNP | Ensembl ].
VAR_011480
Natural varianti485 – 4851S → F in PKRD.
VAR_011468
Natural varianti486 – 4861R → W in PKRD; frequent mutation; no conformational change. 4 Publications
Corresponds to variant rs116100695 [ dbSNP | Ensembl ].
VAR_004066
Natural varianti488 – 4881R → Q in PKRD.
Corresponds to variant rs369183199 [ dbSNP | Ensembl ].
VAR_011469
Natural varianti490 – 4901R → W in PKRD.
Corresponds to variant rs200133000 [ dbSNP | Ensembl ].
VAR_004067
Natural varianti495 – 4951A → T in PKRD.
VAR_011470
Natural varianti495 – 4951A → V in PKRD. 1 Publication
Corresponds to variant rs141560532 [ dbSNP | Ensembl ].
VAR_004068
Natural varianti498 – 4981R → C in PKRD. 1 Publication
Corresponds to variant rs551883218 [ dbSNP | Ensembl ].
VAR_004069
Natural varianti498 – 4981R → H in PKRD. 2 Publications
Corresponds to variant rs758327704 [ dbSNP | Ensembl ].
VAR_004070
Natural varianti504 – 5041R → L in PKRD; instability of the protein. 1 Publication
Corresponds to variant rs185753709 [ dbSNP | Ensembl ].
VAR_011471
Natural varianti506 – 5061V → I.1 Publication
Corresponds to variant rs8177988 [ dbSNP | Ensembl ].
VAR_018848
Natural varianti510 – 5101R → Q in PKRD; the most common mutation in European population. 3 Publications
Corresponds to variant rs113403872 [ dbSNP | Ensembl ].
VAR_004071
Natural varianti511 – 5111G → R in PKRD.
VAR_011472
Natural varianti531 – 5311R → C in PKRD.
VAR_011473
Natural varianti532 – 5321R → Q in PKRD. 1 Publication
Corresponds to variant rs758278200 [ dbSNP | Ensembl ].
VAR_004072
Natural varianti532 – 5321R → W in PKRD; Complete loss in the responsiveness to fructose 1,6-bisphosphate, FBP. 2 Publications
Corresponds to variant rs201255024 [ dbSNP | Ensembl ].
VAR_004073
Natural varianti552 – 5521V → M in PKRD.
Corresponds to variant rs370316462 [ dbSNP | Ensembl ].
VAR_004074
Natural varianti557 – 5571G → A in PKRD.
VAR_011481
Natural varianti559 – 5591R → G in PKRD.
VAR_004075
Natural varianti566 – 5661N → K in PKRD.
VAR_004076
Natural varianti569 – 5691R → Q in PKRD. 1 Publication
Corresponds to variant rs61755431 [ dbSNP | Ensembl ].
VAR_011482

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3333MSIQE…IGAPG → ME in isoform L-type. CuratedVSP_002883Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB015983 mRNA. Translation: BAA31706.1.
M15465 mRNA. Translation: AAA60104.1.
D13243 Genomic DNA. Translation: BAA02515.1. Sequence problems.
AY316591 Genomic DNA. Translation: AAP69527.1.
BC025737 mRNA. Translation: AAH25737.1.
S60712 mRNA. Translation: AAB26262.1.
CCDSiCCDS1109.1. [P30613-1]
CCDS44240.1. [P30613-2]
PIRiI52269. KIHUPR.
RefSeqiNP_000289.1. NM_000298.5. [P30613-1]
NP_870986.1. NM_181871.3. [P30613-2]
UniGeneiHs.95990.

Genome annotation databases

EnsembliENST00000342741; ENSP00000339933; ENSG00000143627. [P30613-1]
ENST00000392414; ENSP00000376214; ENSG00000143627. [P30613-2]
ENST00000571194; ENSP00000461487; ENSG00000262785. [P30613-2]
ENST00000572740; ENSP00000459921; ENSG00000262785. [P30613-1]
GeneIDi5313.
KEGGihsa:5313.
UCSCiuc001fka.5. human. [P30613-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

NIEHS-SNPs
Wikipedia

Pyruvate kinase entry

PKLR Mutation Database

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB015983 mRNA. Translation: BAA31706.1.
M15465 mRNA. Translation: AAA60104.1.
D13243 Genomic DNA. Translation: BAA02515.1. Sequence problems.
AY316591 Genomic DNA. Translation: AAP69527.1.
BC025737 mRNA. Translation: AAH25737.1.
S60712 mRNA. Translation: AAB26262.1.
CCDSiCCDS1109.1. [P30613-1]
CCDS44240.1. [P30613-2]
PIRiI52269. KIHUPR.
RefSeqiNP_000289.1. NM_000298.5. [P30613-1]
NP_870986.1. NM_181871.3. [P30613-2]
UniGeneiHs.95990.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2VGBX-ray2.73A/B/C/D47-574[»]
2VGFX-ray2.75A/B/C/D47-574[»]
2VGGX-ray2.74A/B/C/D47-574[»]
2VGIX-ray2.87A/B/C/D47-574[»]
4IMAX-ray1.95A/B/C/D34-574[»]
4IP7X-ray1.80A/B/C/D34-574[»]
ProteinModelPortaliP30613.
SMRiP30613. Positions 57-573.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111330. 15 interactions.
IntActiP30613. 5 interactions.
STRINGi9606.ENSP00000339933.

Chemistry

BindingDBiP30613.
ChEMBLiCHEMBL1075126.
DrugBankiDB00119. Pyruvic acid.

PTM databases

iPTMnetiP30613.
PhosphoSiteiP30613.
SwissPalmiP30613.

Polymorphism and mutation databases

BioMutaiPKLR.

2D gel databases

REPRODUCTION-2DPAGEP30613.
SWISS-2DPAGEP30613.

Proteomic databases

EPDiP30613.
MaxQBiP30613.
PaxDbiP30613.
PeptideAtlasiP30613.
PRIDEiP30613.

Protocols and materials databases

DNASUi5313.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000342741; ENSP00000339933; ENSG00000143627. [P30613-1]
ENST00000392414; ENSP00000376214; ENSG00000143627. [P30613-2]
ENST00000571194; ENSP00000461487; ENSG00000262785. [P30613-2]
ENST00000572740; ENSP00000459921; ENSG00000262785. [P30613-1]
GeneIDi5313.
KEGGihsa:5313.
UCSCiuc001fka.5. human. [P30613-1]

Organism-specific databases

CTDi5313.
GeneCardsiPKLR.
HGNCiHGNC:9020. PKLR.
HPAiCAB034376.
CAB034378.
HPA006653.
MalaCardsiPKLR.
MIMi102900. phenotype.
266200. phenotype.
609712. gene.
neXtProtiNX_P30613.
Orphaneti766. Hemolytic anemia due to red cell pyruvate kinase deficiency.
PharmGKBiPA33352.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2323. Eukaryota.
COG0469. LUCA.
GeneTreeiENSGT00390000008859.
HOGENOMiHOG000021559.
HOVERGENiHBG000941.
InParanoidiP30613.
KOiK12406.
OMAiPFERSED.
OrthoDBiEOG091G0597.
PhylomeDBiP30613.
TreeFamiTF300390.

Enzyme and pathway databases

UniPathwayiUPA00109; UER00188.
BioCyciMetaCyc:HS07088-MONOMER.
BRENDAi2.7.1.40. 2681.
ReactomeiR-HSA-163765. ChREBP activates metabolic gene expression.
R-HSA-210745. Regulation of gene expression in beta cells.
R-HSA-70171. Glycolysis.
SABIO-RKP30613.

Miscellaneous databases

EvolutionaryTraceiP30613.
GeneWikiiPKLR.
GenomeRNAii5313.
PMAP-CutDBP30613.
PROiP30613.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000143627.
CleanExiHS_PKLR.
ExpressionAtlasiP30613. baseline and differential.
GenevisibleiP30613. HS.

Family and domain databases

Gene3Di2.40.33.10. 1 hit.
3.20.20.60. 2 hits.
3.40.1380.20. 1 hit.
InterProiIPR001697. Pyr_Knase.
IPR015813. Pyrv/PenolPyrv_Kinase-like_dom.
IPR011037. Pyrv_Knase-like_insert_dom.
IPR015794. Pyrv_Knase_a/b.
IPR018209. Pyrv_Knase_AS.
IPR015793. Pyrv_Knase_brl.
IPR015795. Pyrv_Knase_C.
IPR015806. Pyrv_Knase_insert_dom.
[Graphical view]
PANTHERiPTHR11817. PTHR11817. 1 hit.
PfamiPF00224. PK. 1 hit.
PF02887. PK_C. 1 hit.
[Graphical view]
PRINTSiPR01050. PYRUVTKNASE.
SUPFAMiSSF50800. SSF50800. 1 hit.
SSF51621. SSF51621. 2 hits.
SSF52935. SSF52935. 1 hit.
TIGRFAMsiTIGR01064. pyruv_kin. 1 hit.
PROSITEiPS00110. PYRUVATE_KINASE. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiKPYR_HUMAN
AccessioniPrimary (citable) accession number: P30613
Secondary accession number(s): O75758, P11973
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 1, 1993
Last sequence update: May 30, 2000
Last modified: September 7, 2016
This is version 196 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

There are 4 isozymes of pyruvate kinase in mammals: L, R, M1 and M2. L type is major isozyme in the liver, R is found in red cells, M1 is the main form in muscle, heart and brain, and M2 is found in early fetal tissues.

Keywords - Technical termi

3D-structure, Allosteric enzyme, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.