ID V1AR_RAT Reviewed; 424 AA. AC P30560; Q5M8D1; Q62874; Q9QW18; DT 01-APR-1993, integrated into UniProtKB/Swiss-Prot. DT 13-JUN-2006, sequence version 4. DT 24-JAN-2024, entry version 176. DE RecName: Full=Vasopressin V1a receptor; DE Short=V1aR; DE AltName: Full=AVPR V1a; DE AltName: Full=Antidiuretic hormone receptor 1a; DE AltName: Full=Vascular/hepatic-type arginine vasopressin receptor; GN Name=Avpr1a; OS Rattus norvegicus (Rat). OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; OC Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; OC Murinae; Rattus. OX NCBI_TaxID=10116; RN [1] RP NUCLEOTIDE SEQUENCE [MRNA]. RC STRAIN=Sprague-Dawley; TISSUE=Liver; RX PubMed=1560825; DOI=10.1038/356523a0; RA Morel A., O'Carroll A.-M., Brownstein M.J., Lolait S.J.; RT "Molecular cloning and expression of a rat V1a arginine vasopressin RT receptor."; RL Nature 356:523-526(1992). RN [2] RP SEQUENCE REVISION TO 112-117. RX PubMed=8257445; DOI=10.1042/bj2960519; RA Wheatley M., Howl J., Morel A., Davis A.R.L.; RT "Homology between neurohypophyseal hormone receptors."; RL Biochem. J. 296:519-519(1993). RN [3] RP NUCLEOTIDE SEQUENCE [GENOMIC DNA]. RC TISSUE=Liver; RX PubMed=8670090; RA Innamorati G., Lolait S.J., Birnbaumer M.; RT "Sequence identity between the rat and human vasopressin V1a receptors."; RL Biochem. J. 314:710-711(1996). RN [4] RP NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. RC TISSUE=Liver; RX PubMed=15489334; DOI=10.1101/gr.2596504; RG The MGC Project Team; RT "The status, quality, and expansion of the NIH full-length cDNA project: RT the Mammalian Gene Collection (MGC)."; RL Genome Res. 14:2121-2127(2004). RN [5] RP NUCLEOTIDE SEQUENCE [MRNA] OF 1-395. RX PubMed=8511367; DOI=10.1016/0167-0115(93)90182-8; RA Morel A., Lolait S.J., Brownstein M.J.; RT "Molecular cloning and expression of rat V1a and V2 arginine vasopressin RT receptors."; RL Regul. Pept. 45:53-59(1993). RN [6] RP MUTAGENESIS OF TYR-115. RX PubMed=7774575; DOI=10.1002/j.1460-2075.1995.tb07211.x; RA Chini B., Mouillac B., Ala Y., Balestre M.-N., Trumpp-Kallmeyer S., RA Hoflack J., Elands J., Hibert M., Manning M., Jard S., Barberis C.; RT "Tyr115 is the key residue for determining agonist selectivity in the V1a RT vasopressin receptor."; RL EMBO J. 14:2176-2182(1995). RN [7] RP TISSUE SPECIFICITY. RX PubMed=9105680; DOI=10.1016/s0169-328x(96)00285-9; RA Yamazaki R.S., Chen Q., Schreiber S.S., Brinton R.D.; RT "Localization of V1a vasopressin receptor mRNA expression in cultured RT neurons, astroglia, and oligodendroglia of rat cerebral cortex."; RL Brain Res. Mol. Brain Res. 45:138-140(1997). RN [8] RP MUTAGENESIS OF ASN-14 AND ASN-27, AND SUBCELLULAR LOCATION. RX PubMed=11520055; DOI=10.1006/bbrc.2001.5456; RA Lee K.-H., Ahn J., Yu D.-H., Jeong H.-S., Lee S.-H., Kim K.-S., RA Chung I.-Y., Kim J.-H., Lee Y.-S.; RT "Effect of N-glycosylation on ligand binding affinity of rat V1a RT vasopressin receptor."; RL Biochem. Biophys. Res. Commun. 286:707-713(2001). RN [9] RP PALMITOYLATION AT CYS-371 AND CYS-372, AND MUTAGENESIS OF CYS-371 AND RP CYS-372. RX PubMed=11466323; DOI=10.1074/jbc.m106142200; RA Hawtin S.R., Tobin A.B., Patel S., Wheatley M.; RT "Palmitoylation of the vasopressin V1a receptor reveals different RT conformational requirements for signaling, agonist-induced receptor RT phosphorylation, and sequestration."; RL J. Biol. Chem. 276:38139-38146(2001). RN [10] RP SUBCELLULAR LOCATION, AND TISSUE SPECIFICITY. RX PubMed=12399435; DOI=10.1210/en.2002-220603; RA Orcel H., Tobin V.A., Alonso G., Rabie A.; RT "Immunocytochemical localization of vasopressin v1a receptors in the rat RT pituitary gonadotropes."; RL Endocrinology 143:4385-4388(2002). RN [11] RP ROLE IN SOCIAL BEHAVIOR. RX PubMed=12887422; DOI=10.1046/j.1460-9568.2003.02750.x; RA Landgraf R., Frank E., Aldag J.M., Neumann I.D., Sharer C.A., Ren X., RA Terwilliger E.F., Niwa M., Wigger A., Young L.J.; RT "Viral vector-mediated gene transfer of the vole V1a vasopressin receptor RT in the rat septum: improved social discrimination and active social RT behaviour."; RL Eur. J. Neurosci. 18:403-411(2003). CC -!- FUNCTION: Receptor for arginine vasopressin. The activity of this CC receptor is mediated by G proteins which activate a phosphatidyl- CC inositol-calcium second messenger system. Involved in social memory CC formation. {ECO:0000269|PubMed:12887422}. CC -!- SUBCELLULAR LOCATION: Cell membrane; Multi-pass membrane protein. CC Cytoplasmic vesicle membrane; Multi-pass membrane protein. Note=Located CC in cytoplasmic vesicles dispersed throughout the cell cytoplasm and to CC the plasma membrane. CC -!- TISSUE SPECIFICITY: Localized within gonadotropes of the anterior CC pituitary of the brain. Broadly distributed throughout the cerebral CC cortex. {ECO:0000269|PubMed:12399435, ECO:0000269|PubMed:9105680}. CC -!- PTM: Palmitoylated on three cysteine residues, of which only two are CC identified. {ECO:0000269|PubMed:11466323}. CC -!- MISCELLANEOUS: Overexpression of AVPR1A in the brain increases the CC duration of social memory. CC -!- SIMILARITY: Belongs to the G-protein coupled receptor 1 family. CC Vasopressin/oxytocin receptor subfamily. {ECO:0000255|PROSITE- CC ProRule:PRU00521}. CC -!- SEQUENCE CAUTION: CC Sequence=CAA77748.1; Type=Erroneous initiation; Evidence={ECO:0000305}; CC --------------------------------------------------------------------------- CC Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms CC Distributed under the Creative Commons Attribution (CC BY 4.0) License CC --------------------------------------------------------------------------- DR EMBL; Z11690; CAA77748.1; ALT_INIT; mRNA. DR EMBL; U39450; AAC52507.1; -; Genomic_DNA. DR EMBL; BC088095; AAH88095.1; -; Genomic_DNA. DR PIR; S71837; S71837. DR RefSeq; NP_444178.2; NM_053019.2. DR AlphaFoldDB; P30560; -. DR SMR; P30560; -. DR IntAct; P30560; 2. DR STRING; 10116.ENSRNOP00000005829; -. DR BindingDB; P30560; -. DR ChEMBL; CHEMBL2868; -. DR DrugCentral; P30560; -. DR GuidetoPHARMACOLOGY; 366; -. DR GlyCosmos; P30560; 1 site, No reported glycans. DR GlyGen; P30560; 1 site. DR PhosphoSitePlus; P30560; -. DR SwissPalm; P30560; -. DR PaxDb; 10116-ENSRNOP00000005829; -. DR Ensembl; ENSRNOT00000005829.6; ENSRNOP00000005829.3; ENSRNOG00000004400.6. DR Ensembl; ENSRNOT00055045304; ENSRNOP00055037135; ENSRNOG00055026240. DR Ensembl; ENSRNOT00060014217; ENSRNOP00060010913; ENSRNOG00060008510. DR Ensembl; ENSRNOT00065028008; ENSRNOP00065022125; ENSRNOG00065016788. DR GeneID; 25107; -. DR KEGG; rno:25107; -. DR AGR; RGD:2185; -. DR CTD; 552; -. DR RGD; 2185; Avpr1a. DR eggNOG; KOG3656; Eukaryota. DR GeneTree; ENSGT01050000244882; -. DR InParanoid; P30560; -. DR OMA; FSMVEVN; -. DR OrthoDB; 2879183at2759; -. DR PhylomeDB; P30560; -. DR TreeFam; TF106499; -. DR Reactome; R-RNO-388479; Vasopressin-like receptors. DR Reactome; R-RNO-416476; G alpha (q) signalling events. DR PRO; PR:P30560; -. DR Proteomes; UP000002494; Chromosome 7. DR Bgee; ENSRNOG00000004400; Expressed in liver and 17 other cell types or tissues. DR ExpressionAtlas; P30560; baseline and differential. DR GO; GO:0030659; C:cytoplasmic vesicle membrane; IEA:UniProtKB-SubCell. DR GO; GO:0030139; C:endocytic vesicle; ISO:RGD. DR GO; GO:0005768; C:endosome; ISO:RGD. DR GO; GO:0016020; C:membrane; NAS:UniProtKB. DR GO; GO:0005886; C:plasma membrane; ISO:RGD. DR GO; GO:0042277; F:peptide binding; IBA:GO_Central. DR GO; GO:0017046; F:peptide hormone binding; IMP:RGD. DR GO; GO:0031894; F:V1A vasopressin receptor binding; IDA:UniProtKB. DR GO; GO:0005000; F:vasopressin receptor activity; IDA:RGD. DR GO; GO:0019722; P:calcium-mediated signaling; IMP:RGD. DR GO; GO:0032870; P:cellular response to hormone stimulus; IBA:GO_Central. DR GO; GO:0042631; P:cellular response to water deprivation; IEP:RGD. DR GO; GO:0007186; P:G protein-coupled receptor signaling pathway; IBA:GO_Central. DR GO; GO:0007625; P:grooming behavior; IMP:RGD. DR GO; GO:0002125; P:maternal aggressive behavior; IMP:RGD. DR GO; GO:0042711; P:maternal behavior; IMP:RGD. DR GO; GO:0014902; P:myotube differentiation; IEP:RGD. DR GO; GO:0007621; P:negative regulation of female receptivity; IMP:RGD. DR GO; GO:0051970; P:negative regulation of transmission of nerve impulse; IMP:RGD. DR GO; GO:0045777; P:positive regulation of blood pressure; IMP:RGD. DR GO; GO:0030307; P:positive regulation of cell growth; IMP:RGD. DR GO; GO:0008284; P:positive regulation of cell population proliferation; IMP:RGD. DR GO; GO:0032849; P:positive regulation of cellular pH reduction; IMP:RGD. DR GO; GO:0007204; P:positive regulation of cytosolic calcium ion concentration; IMP:RGD. DR GO; GO:0014049; P:positive regulation of glutamate secretion; IMP:RGD. DR GO; GO:0045819; P:positive regulation of glycogen catabolic process; NAS:UniProtKB. DR GO; GO:0010460; P:positive regulation of heart rate; IMP:RGD. DR GO; GO:0031394; P:positive regulation of prostaglandin biosynthetic process; IMP:RGD. DR GO; GO:0003084; P:positive regulation of systemic arterial blood pressure; IMP:RGD. DR GO; GO:0035810; P:positive regulation of urine volume; NAS:UniProtKB. DR GO; GO:0045907; P:positive regulation of vasoconstriction; IMP:RGD. DR GO; GO:0008217; P:regulation of blood pressure; ISO:RGD. DR GO; GO:0051459; P:regulation of corticotropin secretion; NAS:UniProtKB. DR GO; GO:0001992; P:regulation of systemic arterial blood pressure by vasopressin; ISO:RGD. DR GO; GO:0051412; P:response to corticosterone; IEP:RGD. DR GO; GO:0010035; P:response to inorganic substance; IMP:RGD. DR GO; GO:0010033; P:response to organic substance; IMP:RGD. DR GO; GO:0035176; P:social behavior; IDA:UniProtKB. DR GO; GO:0042713; P:sperm ejaculation; IMP:RGD. DR GO; GO:0021537; P:telencephalon development; IEP:RGD. DR CDD; cd15385; 7tmA_V1aR; 1. DR Gene3D; 1.20.1070.10; Rhodopsin 7-helix transmembrane proteins; 1. DR InterPro; IPR000276; GPCR_Rhodpsn. DR InterPro; IPR017452; GPCR_Rhodpsn_7TM. DR InterPro; IPR015076; V1R_C. DR InterPro; IPR001817; Vasoprsn_rcpt. DR InterPro; IPR001224; Vprs_V1A_rcpt. DR PANTHER; PTHR24241; NEUROPEPTIDE RECEPTOR-RELATED G-PROTEIN COUPLED RECEPTOR; 1. DR PANTHER; PTHR24241:SF17; VASOPRESSIN V1A RECEPTOR; 1. DR Pfam; PF00001; 7tm_1; 1. DR Pfam; PF08983; V1R_C; 1. DR PRINTS; PR00237; GPCRRHODOPSN. DR PRINTS; PR00896; VASOPRESSINR. DR PRINTS; PR00752; VASOPRSNV1AR. DR SMART; SM01164; DUF1856; 1. DR SUPFAM; SSF81321; Family A G protein-coupled receptor-like; 1. DR PROSITE; PS00237; G_PROTEIN_RECEP_F1_1; 1. DR PROSITE; PS50262; G_PROTEIN_RECEP_F1_2; 1. DR Genevisible; P30560; RN. PE 1: Evidence at protein level; KW Cell membrane; Cytoplasmic vesicle; Disulfide bond; KW G-protein coupled receptor; Glycoprotein; Lipoprotein; Membrane; Palmitate; KW Phosphoprotein; Receptor; Reference proteome; Transducer; Transmembrane; KW Transmembrane helix. FT CHAIN 1..424 FT /note="Vasopressin V1a receptor" FT /id="PRO_0000070201" FT TOPO_DOM 1..52 FT /note="Extracellular" FT /evidence="ECO:0000255" FT TRANSMEM 53..76 FT /note="Helical; Name=1" FT /evidence="ECO:0000255" FT TOPO_DOM 77..88 FT /note="Cytoplasmic" FT /evidence="ECO:0000255" FT TRANSMEM 89..110 FT /note="Helical; Name=2" FT /evidence="ECO:0000255" FT TOPO_DOM 111..125 FT /note="Extracellular" FT /evidence="ECO:0000255" FT TRANSMEM 126..147 FT /note="Helical; Name=3" FT /evidence="ECO:0000255" FT TOPO_DOM 148..168 FT /note="Cytoplasmic" FT /evidence="ECO:0000255" FT TRANSMEM 169..190 FT /note="Helical; Name=4" FT /evidence="ECO:0000255" FT TOPO_DOM 191..220 FT /note="Extracellular" FT /evidence="ECO:0000255" FT TRANSMEM 221..241 FT /note="Helical; Name=5" FT /evidence="ECO:0000255" FT TOPO_DOM 242..299 FT /note="Cytoplasmic" FT /evidence="ECO:0000255" FT TRANSMEM 300..319 FT /note="Helical; Name=6" FT /evidence="ECO:0000255" FT TOPO_DOM 320..337 FT /note="Extracellular" FT /evidence="ECO:0000255" FT TRANSMEM 338..357 FT /note="Helical; Name=7" FT /evidence="ECO:0000255" FT TOPO_DOM 358..424 FT /note="Cytoplasmic" FT /evidence="ECO:0000255" FT REGION 1..40 FT /note="Disordered" FT /evidence="ECO:0000256|SAM:MobiDB-lite" FT REGION 383..416 FT /note="Disordered" FT /evidence="ECO:0000256|SAM:MobiDB-lite" FT COMPBIAS 1..30 FT /note="Polar residues" FT /evidence="ECO:0000256|SAM:MobiDB-lite" FT COMPBIAS 389..416 FT /note="Polar residues" FT /evidence="ECO:0000256|SAM:MobiDB-lite" FT MOD_RES 410 FT /note="Phosphoserine" FT /evidence="ECO:0000250|UniProtKB:Q62463" FT LIPID 371 FT /note="S-palmitoyl cysteine" FT /evidence="ECO:0000269|PubMed:11466323" FT LIPID 372 FT /note="S-palmitoyl cysteine" FT /evidence="ECO:0000269|PubMed:11466323" FT CARBOHYD 27 FT /note="N-linked (GlcNAc...) asparagine" FT /evidence="ECO:0000255" FT DISULFID 124..205 FT /evidence="ECO:0000255|PROSITE-ProRule:PRU00521" FT MUTAGEN 14 FT /note="N->Q: Reduced ligand binding affinity." FT /evidence="ECO:0000269|PubMed:11520055" FT MUTAGEN 27 FT /note="N->Q: Reduced ligand binding affinity." FT /evidence="ECO:0000269|PubMed:11520055" FT MUTAGEN 115 FT /note="Y->D: No significant change in affinity for arginine FT vasopressin or oxytocin. Increased affinity for 1-deamino, FT D-Arg8-vasopressin." FT /evidence="ECO:0000269|PubMed:7774575" FT MUTAGEN 115 FT /note="Y->F: 17-fold increase in affinity for oxytocin. No FT change in affinity for arginine vasopressin or 1-deamino, FT D-Arg8-vasopressin." FT /evidence="ECO:0000269|PubMed:7774575" FT MUTAGEN 115 FT /note="Y->L: 50-fold decrease in affinity for arginine FT vasopressin. Little affect on affinity for oxytocin or FT 1-deamino, D-Arg8-vasopressin." FT /evidence="ECO:0000269|PubMed:7774575" FT MUTAGEN 371 FT /note="C->G: Reduced palmitoylation, coupling to G protein FT unaffected. Abolished isoprenylation, coupling to G protein FT unaffected; when associated with G-372." FT /evidence="ECO:0000269|PubMed:11466323" FT MUTAGEN 372 FT /note="C->G: Reduced palmitoylation, coupling to G protein FT unaffected. Abolished isoprenylation, coupling to G protein FT unaffected; when associated with G-371." FT /evidence="ECO:0000269|PubMed:11466323" FT CONFLICT 115..116 FT /note="YR -> SS (in Ref. 3 and 5)" FT /evidence="ECO:0000305" FT CONFLICT 390..424 FT /note="RQTSYSNNRSPTNSTGMWKDSPKSSKSIRFIPVST -> KTDFLF (in FT Ref. 1; CAA77748)" FT /evidence="ECO:0000305" SQ SEQUENCE 424 AA; 47655 MW; 4F452C8DF7B4C900 CRC64; MSFPRGSQDR SVGNSSPWWP LTTEGSNGSQ EAARLGEGDS PLGDVRNEEL AKLEIAVLAV IFVVAVLGNS SVLLALHRTP RKTSRMHLFI RHLSLADLAV AFFQVLPQLC WDITYRFRGP DWLCRVVKHL QVFAMFASAY MLVVMTADRY IAVCHPLKTL QQPARRSRLM IATSWVLSFI LSTPQYFIFS VIEIEVNNGT KTQDCWATFI QPWGTRAYVT WMTSGVFVAP VVVLGTCYGF ICYHIWRNIR GKTASSRHSK GDKGSGEAVG PFHKGLLVTP CVSSVKSISR AKIRTVKMTF VIVSAYILCW APFFIVQMWS VWDENFIWTD SENPSITITA LLASLNSCCN PWIYMFFSGH LLQDCVQSFP CCHSMAQKFA KDDSDSMSRR QTSYSNNRSP TNSTGMWKDS PKSSKSIRFI PVST //