Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Prostaglandin E2 receptor EP3 subtype

Gene

Ptger3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Receptor for prostaglandin E2 (PGE2); the EP3 receptor may be involved in inhibition of gastric acid secretion, modulation of neurotransmitter release in central and peripheral neurons, inhibition of sodium and water reabsorption in kidney tubulus and contraction in uterine smooth muscle. The activity of this receptor can couple to both the inhibition of adenylate cyclase mediated by G(i) proteins, and to an elevation of intracellular calcium. The various forms can interact with different second messenger systems.

GO - Molecular functioni

  • prostaglandin E receptor activity Source: MGI

GO - Biological processi

  • adenylate cyclase-modulating G-protein coupled receptor signaling pathway Source: MGI
  • bicarbonate transport Source: MGI
  • fever generation Source: MGI
  • phospholipase C-activating G-protein coupled receptor signaling pathway Source: MGI
  • positive regulation of cytosolic calcium ion concentration Source: MGI
  • positive regulation of fever generation Source: BHF-UCL
  • positive regulation of urine volume Source: MGI
  • response to lipopolysaccharide Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Names & Taxonomyi

Protein namesi
Recommended name:
Prostaglandin E2 receptor EP3 subtype
Short name:
PGE receptor EP3 subtype
Short name:
PGE2 receptor EP3 subtype
Alternative name(s):
Prostanoid EP3 receptor
Gene namesi
Name:Ptger3
Synonyms:Ptgerep3
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:97795. Ptger3.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 3030ExtracellularSequence analysisAdd
BLAST
Transmembranei31 – 5525Helical; Name=1Sequence analysisAdd
BLAST
Topological domaini56 – 6813CytoplasmicSequence analysisAdd
BLAST
Transmembranei69 – 8921Helical; Name=2Sequence analysisAdd
BLAST
Topological domaini90 – 10819ExtracellularSequence analysisAdd
BLAST
Transmembranei109 – 13022Helical; Name=3Sequence analysisAdd
BLAST
Topological domaini131 – 15121CytoplasmicSequence analysisAdd
BLAST
Transmembranei152 – 17322Helical; Name=4Sequence analysisAdd
BLAST
Topological domaini174 – 20330ExtracellularSequence analysisAdd
BLAST
Transmembranei204 – 22926Helical; Name=5Sequence analysisAdd
BLAST
Topological domaini230 – 25930CytoplasmicSequence analysisAdd
BLAST
Transmembranei260 – 28324Helical; Name=6Sequence analysisAdd
BLAST
Topological domaini284 – 30320ExtracellularSequence analysisAdd
BLAST
Transmembranei304 – 32522Helical; Name=7Sequence analysisAdd
BLAST
Topological domaini326 – 36540CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

  • integral component of membrane Source: UniProtKB-KW
  • plasma membrane Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Chemistry

ChEMBLiCHEMBL4336.
GuidetoPHARMACOLOGYi342.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 365365Prostaglandin E2 receptor EP3 subtypePRO_0000070059Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi16 – 161N-linked (GlcNAc...)Sequence analysis
Disulfide bondi107 ↔ 184PROSITE-ProRule annotation
Glycosylationi193 – 1931N-linked (GlcNAc...)Sequence analysis

Post-translational modificationi

Ligand binding is affected by cAMP-dependent phosphorylation in brain membranes.

Keywords - PTMi

Disulfide bond, Glycoprotein, Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

PaxDbiP30557.
PRIDEiP30557.

Expressioni

Tissue specificityi

Kidney, uterus, and mastocytoma cells, and in a lesser amount in brain, thymus, lung, heart, stomach and spleen.

Gene expression databases

CleanExiMM_PTGER3.

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000043302.

Chemistry

BindingDBiP30557.

Structurei

3D structure databases

ProteinModelPortaliP30557.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3656. Eukaryota.
ENOG410XRW9. LUCA.
HOGENOMiHOG000015238.
HOVERGENiHBG052720.
InParanoidiP30557.
PhylomeDBiP30557.

Family and domain databases

InterProiIPR000154. EP3_rcpt_3.
IPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
IPR008365. Prostanoid_rcpt.
IPR001244. Prostglndn_DP_rcpt.
IPR000265. Prostglndn_EP3_rcpt.
[Graphical view]
PANTHERiPTHR11866. PTHR11866. 1 hit.
PTHR11866:SF10. PTHR11866:SF10. 1 hit.
PfamiPF00001. 7tm_1. 1 hit.
[Graphical view]
PRINTSiPR00237. GPCRRHODOPSN.
PR00428. PROSTAGLNDNR.
PR01788. PROSTANOIDR.
PR00585. PRSTNOIDE33R.
PR00582. PRSTNOIDEP3R.
PROSITEiPS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist. Isoforms have identical ligand binding properties but different coupling properties with G proteins: isoform Alpha and isoform Beta couple to G(i) proteins, whereas isoform Gamma couples to multiple G proteins, G(i) and G(s). Isoform Alpha shows high agonist-independent constitutive inhibition of adenylate cyclase, while isoform Beta has no agonist independent inhibition.

Isoform Alpha (identifier: P30557-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASMWAPEHS AEAHSNLSST TDDCGSVSVA FPITMMVTGF VGNALAMLLV
60 70 80 90 100
SRSYRRRESK RKKSFLLCIG WLALTDLVGQ LLTSPVVILV YLSQRRWEQL
110 120 130 140 150
DPSGRLCTFF GLTMTVFGLS SLLVASAMAV ERALAIRAPH WYASHMKTRA
160 170 180 190 200
TPVLLGVWLS VLAFALLPVL GVGRYSVQWP GTWCFISTGP AGNETDPARE
210 220 230 240 250
PGSVAFASAF ACLGLLALVV TFACNLATIK ALVSRCRAKA AVSQSSAQWG
260 270 280 290 300
RITTETAIQL MGIMCVLSVC WSPLLIMMLK MIFNQMSVEQ CKTQMGKEKE
310 320 330 340 350
CNSFLIAVRL ASLNQILDPW VYLLLRKILL RKFCQIRDHT NYASSSTSLP
360
CPGSSALMWS DQLER
Length:365
Mass (Da):40,077
Last modified:April 1, 1993 - v1
Checksum:i1FEBEBB30C5EA67E
GO
Isoform Beta (identifier: P30557-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     336-365: IRDHTNYASSSTSLPCPGSSALMWSDQLER → MMNNLKWTFIAVPVSLGLRISSPREG

Show »
Length:361
Mass (Da):39,684
Checksum:iFB1B5310C28320CE
GO
Isoform Gamma (identifier: P30557-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     336-365: IRDHTNYASSSTSLPCPGSSALMWSDQLER → VANAVSSCSSDGQKGQAISLSNEVVQPGP

Show »
Length:364
Mass (Da):39,597
Checksum:iF14BDBA15F055FD3
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei336 – 36530IRDHT…DQLER → MMNNLKWTFIAVPVSLGLRI SSPREG in isoform Beta. 1 PublicationVSP_001940Add
BLAST
Alternative sequencei336 – 36530IRDHT…DQLER → VANAVSSCSSDGQKGQAISL SNEVVQPGP in isoform Gamma. 1 PublicationVSP_001941Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D10204 mRNA. Translation: BAA01051.1.
D13321 mRNA. Translation: BAA02578.1.
D17406 mRNA. Translation: BAA04229.1.
PIRiA42414.
A45211.
S65009.
UniGeneiMm.30424.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D10204 mRNA. Translation: BAA01051.1.
D13321 mRNA. Translation: BAA02578.1.
D17406 mRNA. Translation: BAA04229.1.
PIRiA42414.
A45211.
S65009.
UniGeneiMm.30424.

3D structure databases

ProteinModelPortaliP30557.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000043302.

Chemistry

BindingDBiP30557.
ChEMBLiCHEMBL4336.
GuidetoPHARMACOLOGYi342.

Protein family/group databases

GPCRDBiSearch...

Proteomic databases

PaxDbiP30557.
PRIDEiP30557.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Organism-specific databases

MGIiMGI:97795. Ptger3.

Phylogenomic databases

eggNOGiKOG3656. Eukaryota.
ENOG410XRW9. LUCA.
HOGENOMiHOG000015238.
HOVERGENiHBG052720.
InParanoidiP30557.
PhylomeDBiP30557.

Miscellaneous databases

PROiP30557.
SOURCEiSearch...

Gene expression databases

CleanExiMM_PTGER3.

Family and domain databases

InterProiIPR000154. EP3_rcpt_3.
IPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
IPR008365. Prostanoid_rcpt.
IPR001244. Prostglndn_DP_rcpt.
IPR000265. Prostglndn_EP3_rcpt.
[Graphical view]
PANTHERiPTHR11866. PTHR11866. 1 hit.
PTHR11866:SF10. PTHR11866:SF10. 1 hit.
PfamiPF00001. 7tm_1. 1 hit.
[Graphical view]
PRINTSiPR00237. GPCRRHODOPSN.
PR00428. PROSTAGLNDNR.
PR01788. PROSTANOIDR.
PR00585. PRSTNOIDE33R.
PR00582. PRSTNOIDEP3R.
PROSITEiPS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Cloning and expression of a cDNA for mouse prostaglandin E receptor EP3 subtype."
    Sugimoto Y., Namba T., Honda A., Hayashi Y., Negishi M., Ichikawa A., Narumiya S.
    J. Biol. Chem. 267:6463-6466(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA).
    Strain: BDF1.
  2. "Two isoforms of the EP3 receptor with different carboxyl-terminal domains. Identical ligand binding properties and different coupling properties with Gi proteins."
    Sugimoto Y., Negishi M., Hayashi Y., Namba T., Honda A., Watabe A., Hirata M., Narumiya S., Ichikawa A.
    J. Biol. Chem. 268:2712-2718(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM BETA).
  3. "Third isoform of the prostaglandin-E-receptor EP3 subtype with different C-terminal tail coupling to both stimulation and inhibition of adenylate cyclase."
    Irie A., Sugimoto Y., Namba T., Harazono A., Honda A., Watabe A., Negishi M., Narumiya S., Ichikawa A.
    Eur. J. Biochem. 217:313-318(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM GAMMA).
  4. "Two isoforms of the prostaglandin E receptor EP3 subtype different in agonist-independent constitutive activity."
    Hasegawa H., Negishi M., Ichikawa A.
    J. Biol. Chem. 271:1857-1860(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: CHARACTERIZATION (ISOFORMS ALPHA AND BETA).

Entry informationi

Entry nameiPE2R3_MOUSE
AccessioniPrimary (citable) accession number: P30557
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 1, 1993
Last sequence update: April 1, 1993
Last modified: May 11, 2016
This is version 131 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.