P30307 (MPIP3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 18, 2012.
Version 129.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: M-phase inducer phosphatase 3 EC=3.1.3.48 Alternative name(s): Dual specificity phosphatase Cdc25C | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 473 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Functions as a dosage-dependent inducer in mitotic control. It is a tyrosine protein phosphatase required for progression of the cell cycle. It directly dephosphorylates CDK1 and activate its kinase activity. |
| Catalytic activity | Protein tyrosine phosphate + H2O = protein tyrosine + phosphate. |
| Subunit structure | Interacts with HIV-1 Vpr, thereby inactivating CDC25C phosphatase activity. Interacts with MAPK14 and 14-3-3 proteins. Ref.10 Ref.13 |
| Subcellular location | |
| Developmental stage | Expressed predominantly in G2 phase. |
| Post-translational modification | Phosphorylated by CHEK1 and MAPK14 at Ser-216. This phosphorylation creates a binding site for 14-3-3 protein and inhibits the phosphatase. Phosphorylated by PLK4. Phosphorylated by PLK1, leading to activate the phosphatase activity. Phosphorylation by PLK3 at Ser-191 promotes nuclear translocation. Ser-198 is a minor phosphorylation site. Was initially reported to be phosphorylated by PLK3 at Ser-216 (Ref.8). However, such phosphorylation by PLK3 was not confirmed by other groups. Ref.8 Ref.9 Ref.10 Ref.11 Ref.12 Ref.14 Ref.15 Ref.16 Ref.17 Ref.18 |
| Sequence similarities | Belongs to the MPI phosphatase family. Contains 1 rhodanese domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| CDK1 | P06493 | 2 | EBI-974439,EBI-444308 | |
| CHEK1 | O14757 | 2 | EBI-974439,EBI-974488 | |
| LZTS1 | Q9Y250 | 2 | EBI-974439,EBI-1216080 |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P30307-1) Also known as: CDC25C1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P30307-2) Also known as: CDC25C2; The sequence of this isoform differs from the canonical sequence as follows: 124-153: Missing. | ||||||
| Isoform 3 (identifier: P30307-5) Also known as: CDC25C3; The sequence of this isoform is not available. | ||||||
| Isoform 4 (identifier: P30307-3) Also known as: CDC25C4; The sequence of this isoform differs from the canonical sequence as follows: 66-123: GTPKRCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSP → SPGFFRTSGSAFSWD | ||||||
| Isoform 5 (identifier: P30307-4) Also known as: CDC25C5; Cdc25Cdm; The sequence of this isoform differs from the canonical sequence as follows: 66-123: GTPKRCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSP → SPGFFRTSGSAFSWD 124-153: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 473 | 473 | M-phase inducer phosphatase 3 | PRO_0000198647 | |||||||
Regions | |||||||||||
| Domain | 321 – 428 | 108 | Rhodanese | ||||||||
| Region | 334 – 379 | 46 | HIV-1 Vpr binding site | ||||||||
Sites | |||||||||||
| Active site | 377 | 1 | By similarity | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 15 | 1 | Phosphoserine Ref.17 | ||||||||
| Modified residue | 38 | 1 | Phosphoserine Ref.18 | ||||||||
| Modified residue | 48 | 1 | Phosphothreonine Ref.18 | ||||||||
| Modified residue | 57 | 1 | Phosphoserine Ref.18 | ||||||||
| Modified residue | 61 | 1 | Phosphoserine Ref.18 | ||||||||
| Modified residue | 64 | 1 | Phosphoserine Ref.17 Ref.18 | ||||||||
| Modified residue | 67 | 1 | Phosphothreonine Ref.18 | ||||||||
| Modified residue | 168 | 1 | Phosphoserine Ref.15 Ref.17 | ||||||||
| Modified residue | 191 | 1 | Phosphoserine; by PLK3 Ref.12 | ||||||||
| Modified residue | 198 | 1 | Phosphoserine; by PLK3 Ref.12 | ||||||||
| Modified residue | 216 | 1 | Phosphoserine; by CHEK1, CHEK2, BRSK1 and MAPK14 Ref.10 Ref.11 Ref.14 | ||||||||
| Modified residue | 472 | 1 | Phosphoserine Ref.17 | ||||||||
Natural variations | |||||||||||
| Alternative sequence | 66 – 123 | 58 | GTPKR…MKCSP → SPGFFRTSGSAFSWD in isoform 4 and isoform 5. | VSP_000863 | |||||||
| Alternative sequence | 124 – 153 | 30 | Missing in isoform 2 and isoform 5. | VSP_000864 | |||||||
| Natural variant | 14 | 1 | S → N. Corresponds to variant rs11567959 [ dbSNP | Ensembl ]. | VAR_027922 | |||||||
| Natural variant | 70 | 1 | R → C. Ref.1 Ref.5 Ref.6 Corresponds to variant rs3734166 [ dbSNP | Ensembl ]. | VAR_027923 | |||||||
| Natural variant | 78 | 1 | S → N. Corresponds to variant rs11567962 [ dbSNP | Ensembl ]. | VAR_027924 | |||||||
| Natural variant | 297 | 1 | G → R. Corresponds to variant rs11567997 [ dbSNP | Ensembl ]. | VAR_020146 | |||||||
Experimental info | |||||||||||
| Mutagenesis | 191 | 1 | S → A: Facilitates nuclear exclusion. Ref.12 | ||||||||
| Mutagenesis | 191 | 1 | S → D: Mimicks phosphorylation state, leading to enhanced accumulation in the nucleus. Ref.12 | ||||||||
| Mutagenesis | 352 | 1 | E → K: Partial loss of HIV-1 Vpr binding. Ref.13 | ||||||||
| Mutagenesis | 359 | 1 | K → E: No effect on HIV-1 Vpr binding. Ref.13 | ||||||||
Secondary structure | |||||||||||
Helix Strand Turn | |||||||||||
| Beta strand | 127 – 129 | 3 | |||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Human homolog of fission yeast cdc25 mitotic inducer is predominantly expressed in G2." Sadhu K., Reed B.I., Richardson H., Russell P. Proc. Natl. Acad. Sci. U.S.A. 87:5139-5143(1990) [PubMed: 2195549] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT CYS-70. |
| [2] | "An additional transcript of the cdc25C gene from A431 cells encodes a functional protein." Bureik M., Rief N., Drescher R., Jungbluth A., Montenarh M., Wagner P. Int. J. Oncol. 17:1251-1258(2000) [PubMed: 11078813] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5). |
| [3] | NIEHS SNPs program Submitted (DEC-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT CYS-70. Tissue: Skin. |
| [6] | "Alternative splicing in the regulatory region of the human phosphatases CDC25A and CDC25C." Wegener S., Hampe W., Herrmann D., Schaller H.C. Eur. J. Cell Biol. 79:810-815(2000) [PubMed: 11139144] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 32-210 (ISOFORMS 2; 4 AND 5), VARIANT CYS-70. |
| [7] | "Differential expression of cdc25 cell-cycle-activating phosphatases in human colorectal carcinoma." Hernandez S., Bessa X., Bea S., Hernandez L., Nadal A., Mallofre C., Muntane J., Castells A., Fernandez P.L., Cardesa A., Campo E. Lab. Invest. 81:465-473(2001) [PubMed: 11304565] [Abstract] Cited for: PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5). Tissue: Colon carcinoma. |
| [8] | "The physical association and phosphorylation of Cdc25C protein phosphatase by Prk." Ouyang B., Li W., Pan H., Meadows J., Hoffmann I., Dai W. Oncogene 18:6029-6036(1999) [PubMed: 10557092] [Abstract] Cited for: PHOSPHORYLATION BY PLK3. |
| [9] | "The human polo-like kinase, PLK, regulates cdc2/cyclin B through phosphorylation and activation of the cdc25C phosphatase." Roshak A.K., Capper E.A., Imburgia C., Fornwald J., Scott G., Marshall L.A. Cell. Signal. 12:405-411(2000) [PubMed: 11202906] [Abstract] Cited for: PHOSPHORYLATION BY PLK1. |
| [10] | "Initiation of a G2/M checkpoint after ultraviolet radiation requires p38 kinase." Bulavin D.V., Higashimoto Y., Popoff I.J., Gaarde W.A., Basrur V., Potapova O., Appella E., Fornace A.J. Jr. Nature 411:102-107(2001) [PubMed: 11333986] [Abstract] Cited for: PHOSPHORYLATION AT SER-216, INTERACTION WITH MAPK14 AND 14-3-3 PROTEINS. |
| [11] | "Human SAD1 kinase is involved in UV-induced DNA damage checkpoint function." Lu R., Niida H., Nakanishi M. J. Biol. Chem. 279:31164-31170(2004) [PubMed: 15150265] [Abstract] Cited for: PHOSPHORYLATION AT SER-216. Tissue: Testis. |
| [12] | "Cdc25C phosphorylation on serine 191 by Plk3 promotes its nuclear translocation." Bahassi el M., Hennigan R.F., Myer D.L., Stambrook P.J. Oncogene 23:2658-2663(2004) [PubMed: 14968113] [Abstract] Cited for: SUBCELLULAR LOCATION, PHOSPHORYLATION AT SER-191 AND SER-198, MUTAGENESIS OF SER-191. |
| [13] | "The human immunodeficiency virus Vpr protein binds Cdc25C: implications for G2 arrest." Goh W.C., Manel N., Emerman M. Virology 318:337-349(2004) [PubMed: 14972559] [Abstract] Cited for: INTERACTION WITH HIV-1 VPR, MUTAGENESIS OF GLU-352 AND LYS-359. |
| [14] | "MAPKAP kinase-2 is a cell cycle checkpoint kinase that regulates the G2/M transition and S phase progression in response to UV irradiation." Manke I.A., Nguyen A., Lim D., Stewart M.Q., Elia A.E., Yaffe M.B. Mol. Cell 17:37-48(2005) [PubMed: 15629715] [Abstract] Cited for: PHOSPHORYLATION AT SER-216 BY MAPKAPK2. |
| [15] | "A probability-based approach for high-throughput protein phosphorylation analysis and site localization." Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. Nat. Biotechnol. 24:1285-1292(2006) [PubMed: 16964243] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-168, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [16] | "Human Plk4 phosphorylates Cdc25C." Bonni S., Ganuelas M.L., Petrinac S., Hudson J.W. Cell Cycle 7:545-547(2008) [PubMed: 18239451] [Abstract] Cited for: PHOSPHORYLATION BY PLK4. |
| [17] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed: 18691976] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-15; SER-64; SER-168 AND SER-472, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [18] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-38; THR-48; SER-57; SER-61; SER-64 AND THR-67, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | M34065 mRNA. Translation: AAA35666.1. AJ304504 mRNA. Translation: CAC19192.1. AY497474 Genomic DNA. Translation: AAR32098.1. CH471062 Genomic DNA. Translation: EAW62145.1. CH471062 Genomic DNA. Translation: EAW62149.1. BC019089 mRNA. Translation: AAH19089.1. AF277723 mRNA. Translation: AAG41885.1. AF277725 mRNA. Translation: AAG41887.1. AF277726 mRNA. Translation: AAG41888.1. AF312681 mRNA. Translation: AAL26835.1. | ||||||||||||||||||
| IPI | IPI00216684. IPI00216685. IPI00640320. IPI01012097. | ||||||||||||||||||
| PIR | A38874. I59168. | ||||||||||||||||||
| RefSeq | NP_001781.2. NM_001790.3. NP_073720.1. NM_022809.2. | ||||||||||||||||||
| UniGene | Hs.656. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | P30307. | ||||||||||||||||||
| SMR | P30307. Positions 280-448. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| DIP | DIP-24183N. | ||||||||||||||||||
| IntAct | P30307. 5 interactions. | ||||||||||||||||||
| MINT | MINT-86355. | ||||||||||||||||||
| STRING | P30307. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | P30307. | ||||||||||||||||||
Polymorphism databases | |||||||||||||||||||
| DMDM | 116242631. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PRIDE | P30307. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| DNASU | 995. | ||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000323760; ENSP00000321656; ENSG00000158402. | ||||||||||||||||||
| GeneID | 995. | ||||||||||||||||||
| KEGG | hsa:995. | ||||||||||||||||||
| UCSC | uc003lcp.1. human. uc003lcq.1. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 995. | ||||||||||||||||||
| GeneCards | GC05M137648. | ||||||||||||||||||
| H-InvDB | HIX0005209. | ||||||||||||||||||
| HGNC | HGNC:1727. CDC25C. | ||||||||||||||||||
| HPA | CAB003800. | ||||||||||||||||||
| MIM | 157680. gene. | ||||||||||||||||||
| neXtProt | NX_P30307. | ||||||||||||||||||
| PharmGKB | PA100. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | COG5105. | ||||||||||||||||||
| GeneTree | ENSGT00390000018747. | ||||||||||||||||||
| HOVERGEN | HBG052501. | ||||||||||||||||||
| InParanoid | P30307. | ||||||||||||||||||
| KO | K05867. | ||||||||||||||||||
| OMA | ETGHLDS. | ||||||||||||||||||
| OrthoDB | EOG47D9G1. | ||||||||||||||||||
| PhylomeDB | P30307. | ||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||
| BRENDA | 3.1.3.48. 2681. | ||||||||||||||||||
| Reactome | REACT_115566. Cell Cycle. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | P30307. | ||||||||||||||||||
| Bgee | P30307. | ||||||||||||||||||
| CleanEx | HS_CDC25C. | ||||||||||||||||||
| Genevestigator | P30307. | ||||||||||||||||||
| GermOnline | ENSG00000158402. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| Gene3D | G3DSA:3.40.250.10. Rhodanese-like. 1 hit. | ||||||||||||||||||
| InterPro | IPR000751. MPI_Phosphatase. IPR001763. Rhodanese-like. [Graphical view] | ||||||||||||||||||
| PANTHER | PTHR10828. MPI_Phosphatase. 1 hit. | ||||||||||||||||||
| Pfam | PF06617. M-inducer_phosp. 2 hits. PF00581. Rhodanese. 1 hit. [Graphical view] | ||||||||||||||||||
| PRINTS | PR00716. MPIPHPHTASE. | ||||||||||||||||||
| SMART | SM00450. RHOD. 1 hit. [Graphical view] | ||||||||||||||||||
| SUPFAM | SSF52821. Rhodanese-like. 1 hit. | ||||||||||||||||||
| PROSITE | PS50206. RHODANESE_3. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| EvolutionaryTrace | P30307. | ||||||||||||||||||
| NextBio | 4178. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | MPIP3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P30307 Secondary accession number(s): D3DQB8 Q9H2F1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 5 Human chromosome 5: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with