Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P30203 (CD6_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 122. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
T-cell differentiation antigen CD6
Alternative name(s):
T12
TP120
CD_antigen=CD6
Gene names
Name:CD6
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length668 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Involved in cell adhesion. Binds to CD166.

Subcellular location

Cell membrane; Single-pass type I membrane protein Ref.4.

Tissue specificity

Expressed by thymocytes, mature T-cells, a subset of B-cells known as B-1 cells, and by some cells in the brain.

Post-translational modification

After T-cell activation, becomes hyperphosphorylated on Ser and Thr residues and phosphorylated on Tyr residues. Ref.5 Ref.6

Sequence similarities

Contains 3 SRCR domains.

Ontologies

Keywords
   Biological processCell adhesion
   Cellular componentCell membrane
Membrane
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainRepeat
Signal
Transmembrane
Transmembrane helix
   PTMDisulfide bond
Glycoprotein
Phosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processcell adhesion

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentintegral component of plasma membrane

Traceable author statement Ref.3. Source: ProtInc

   Molecular_functionscavenger receptor activity

Inferred from electronic annotation. Source: InterPro

Complete GO annotation...

Alternative products

This entry describes 7 isoforms produced by alternative splicing. [Align] [Select]
Isoform CD6A (identifier: P30203-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform CD6B (identifier: P30203-2)

The sequence of this isoform differs from the canonical sequence as follows:
     431-462: Missing.
Isoform CD6C (identifier: P30203-3)

The sequence of this isoform differs from the canonical sequence as follows:
     431-462: Missing.
     463-504: VFMLPIQVQAPPPEDSDSGSDSDYEHYDFSAQPPVALTTFYN → D
Isoform CD6D (identifier: P30203-4)

The sequence of this isoform differs from the canonical sequence as follows:
     431-462: Missing.
     613-647: Missing.
Isoform CD6E (identifier: P30203-5)

The sequence of this isoform differs from the canonical sequence as follows:
     463-504: VFMLPIQVQAPPPEDSDSGSDSDYEHYDFSAQPPVALTTFYN → D
     613-647: Missing.
Isoform 6 (identifier: P30203-6)

Also known as: CD6deltaD3Ex6;

The sequence of this isoform differs from the canonical sequence as follows:
     261-383: Missing.
Note: Lacks the third SRCR domain and doesn't bind CD166. Doesn't localize to the immunological synapse.
Isoform 7 (identifier: P30203-7)

Also known as: CD6deltaD3;

The sequence of this isoform differs from the canonical sequence as follows:
     259-359: Missing.
Note: Lacks the third SRCR domain and doesn't bind CD166. Doesn't localize to the immunological synapse. Constitutes the only expressed species in a small percentage of T-cells.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 1717 Potential
Chain18 – 668651T-cell differentiation antigen CD6
PRO_0000033227

Regions

Topological domain18 – 402385Extracellular Potential
Transmembrane403 – 42321Helical; Potential
Topological domain424 – 668245Cytoplasmic Potential
Domain45 – 156112SRCR 1
Domain161 – 260100SRCR 2
Domain265 – 36197SRCR 3

Amino acid modifications

Glycosylation281N-linked (GlcNAc...) Potential
Glycosylation491N-linked (GlcNAc...) Potential
Glycosylation1121N-linked (GlcNAc...) Potential
Glycosylation1181N-linked (GlcNAc...) Potential
Glycosylation2291N-linked (GlcNAc...) Potential
Glycosylation3391N-linked (GlcNAc...) Potential
Glycosylation3451N-linked (GlcNAc...) Potential
Glycosylation3681N-linked (GlcNAc...) Potential
Disulfide bond70 ↔ 144 By similarity
Disulfide bond83 ↔ 155 By similarity
Disulfide bond129 ↔ 137 By similarity
Disulfide bond186 ↔ 249 By similarity
Disulfide bond199 ↔ 259 By similarity
Disulfide bond230 ↔ 240 By similarity
Disulfide bond290 ↔ 350 By similarity
Disulfide bond303 ↔ 360 By similarity
Disulfide bond330 ↔ 340 By similarity

Natural variations

Alternative sequence259 – 359101Missing in isoform 7.
VSP_054245
Alternative sequence261 – 383123Missing in isoform 6.
VSP_054246
Alternative sequence431 – 46232Missing in isoform CD6B, isoform CD6C and isoform CD6D.
VSP_006221
Alternative sequence463 – 50442VFMLP…TTFYN → D in isoform CD6C and isoform CD6E.
VSP_006222
Alternative sequence613 – 64735Missing in isoform CD6D and isoform CD6E.
VSP_006223
Natural variant2171T → M. Ref.4
Corresponds to variant rs11230562 [ dbSNP | Ensembl ].
VAR_059809
Natural variant2251R → W.
Corresponds to variant rs11230563 [ dbSNP | Ensembl ].
VAR_057202
Natural variant2571A → V. Ref.1 Ref.3 Ref.4
Corresponds to variant rs2074225 [ dbSNP | Ensembl ].
VAR_060790
Natural variant2711A → T.
Corresponds to variant rs12360861 [ dbSNP | Ensembl ].
VAR_057203
Natural variant3511S → N.
Corresponds to variant rs34974368 [ dbSNP | Ensembl ].
VAR_057204
Natural variant6061G → S.
Corresponds to variant rs2074233 [ dbSNP | Ensembl ].
VAR_057205

Experimental info

Sequence conflict471L → R in ABH04237. Ref.4
Sequence conflict463 – 4686VFMLPI → GPGPAP in CAA43306. Ref.3
Sequence conflict6131Missing in AAC51162. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform CD6A [UniParc].

Last modified December 15, 2009. Version 3.
Checksum: 59E6790E77FFBC42

FASTA66871,801
        10         20         30         40         50         60 
MWLFFGITGL LTAALSGHPS PAPPDQLNTS SAESELWEPG ERLPVRLTNG SSSCSGTVEV 

        70         80         90        100        110        120 
RLEASWEPAC GALWDSRAAE AVCRALGCGG AEAASQLAPP TPELPPPPAA GNTSVAANAT 

       130        140        150        160        170        180 
LAGAPALLCS GAEWRLCEVV EHACRSDGRR ARVTCAENRA LRLVDGGGAC AGRVEMLEHG 

       190        200        210        220        230        240 
EWGSVCDDTW DLEDAHVVCR QLGCGWAVQA LPGLHFTPGR GPIHRDQVNC SGAEAYLWDC 

       250        260        270        280        290        300 
PGLPGQHYCG HKEDAGAVCS EHQSWRLTGG ADRCEGQVEV HFRGVWNTVC DSEWYPSEAK 

       310        320        330        340        350        360 
VLCQSLGCGT AVERPKGLPH SLSGRMYYSC NGEELTLSNC SWRFNNSNLC SQSLAARVLC 

       370        380        390        400        410        420 
SASRSLHNLS TPEVPASVQT VTIESSVTVK IENKESRELM LLIPSIVLGI LLLGSLIFIA 

       430        440        450        460        470        480 
FILLRIKGKY ALPVMVNHQH LPTTIPAGSN SYQPVPITIP KEVFMLPIQV QAPPPEDSDS 

       490        500        510        520        530        540 
GSDSDYEHYD FSAQPPVALT TFYNSQRHRV TDEEVQQSRF QMPPLEEGLE ELHASHIPTA 

       550        560        570        580        590        600 
NPGHCITDPP SLGPQYHPRS NSESSTSSGE DYCNSPKSKL PPWNPQVFSS ERSSFLEQPP 

       610        620        630        640        650        660 
NLELAGTQPA FSAGPPADDS SSTSSGEWYQ NFQPPPQPPS EEQFGCPGSP SPQPDSTDND 


DYDDISAA 

« Hide

Isoform CD6B [UniParc].

Checksum: 8EC9117BF4AAD154
Show »

FASTA63668,368
Isoform CD6C [UniParc].

Checksum: 04D85EE0DBB4A885
Show »

FASTA59563,824
Isoform CD6D [UniParc].

Checksum: 0D8DCC42B53BDA2E
Show »

FASTA60164,663
Isoform CD6E [UniParc].

Checksum: 504C102257DA7B3C
Show »

FASTA59263,552
Isoform 6 (CD6deltaD3Ex6) [UniParc].

Checksum: 54FA60E898D7DF82
Show »

FASTA54558,283
Isoform 7 (CD6deltaD3) [UniParc].

Checksum: C99852C6756B3154
Show »

FASTA56760,572

References

« Hide 'large scale' references
[1]"Structure and chromosomal location of the human CD6 gene: detection of five human CD6 isoforms."
Bowen M.A., Whitney G.S., Neubauer M., Starling G.C., Palmer D., Zhang J., Nowak N.J., Shows T.B., Aruffo A.
J. Immunol. 158:1149-1156(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA], ALTERNATIVE SPLICING, VARIANT VAL-257.
[2]"Human chromosome 11 DNA sequence and analysis including novel gene identification."
Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. expand/collapse author list , Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.
Nature 440:497-500(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]"The lymphocyte glycoprotein CD6 contains a repeated domain structure characteristic of a new family of cell surface and secreted proteins."
Aruffo A., Melnick M.B., Linsley P.S., Seed B.
J. Exp. Med. 174:949-952(1991) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-468, VARIANT VAL-257.
[4]"Extracellular isoforms of CD6 generated by alternative splicing regulate targeting of CD6 to the immunological synapse."
Castro M.A., Oliveira M.I., Nunes R.J., Fabre S., Barbosa R., Peixoto A., Brown M.H., Parnes J.R., Bismuth G., Moreira A., Rocha B., Carmo A.M.
J. Immunol. 178:4351-4361(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-278 (ISOFORM 6), NUCLEOTIDE SEQUENCE [MRNA] OF 1-300 (ISOFORM 7), SUBCELLULAR LOCATION, VARIANTS MET-217 AND VAL-257, ALTERNATIVE SPLICING.
[5]"Biosynthesis and post-translational modification of CD6, a T cell signal-transducing molecule."
Swack J.A., Mier J.W., Romain P.L., Hull S.R., Rudd C.E.
J. Biol. Chem. 266:7137-7143(1991) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION AT SERINE RESIDUES, DISULFIDE BONDS, GLYCOSYLATION.
[6]"Tyrosine phosphorylation of CD6 by stimulation of CD3: augmentation by the CD4 and CD2 coreceptors."
Wee S., Schieven G.L., Kirihara J.M., Tsu T.T., Ledbetter J.A., Aruffo A.
J. Exp. Med. 177:219-223(1993) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION AT TYROSINE RESIDUES.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U66142 mRNA. Translation: AAC51161.1.
U66143 Genomic DNA. Translation: AAC51162.1.
U66144 Genomic DNA. Translation: AAC51163.1.
U66145 mRNA. Translation: AAC51164.1.
U66146 mRNA. Translation: AAC51165.1.
AP003721 Genomic DNA. No translation available.
X60992 mRNA. Translation: CAA43306.1.
DQ786329 mRNA. Translation: ABH04237.1.
DQ786330 mRNA. Translation: ABH04238.1.
PIRS26741.
RefSeqNP_001241679.1. NM_001254750.1.
NP_001241680.1. NM_001254751.1.
NP_006716.3. NM_006725.4.
UniGeneHs.744366.

3D structure databases

ProteinModelPortalP30203.
SMRP30203. Positions 42-157, 161-361.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid107361. 6 interactions.
IntActP30203. 4 interactions.
MINTMINT-1351620.
STRING9606.ENSP00000323280.

PTM databases

PhosphoSiteP30203.

Polymorphism databases

DMDM281185506.

Proteomic databases

PaxDbP30203.
PRIDEP30203.

Protocols and materials databases

DNASU923.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000313421; ENSP00000323280; ENSG00000013725. [P30203-1]
ENST00000344028; ENSP00000344108; ENSG00000013725. [P30203-2]
ENST00000346437; ENSP00000345566; ENSG00000013725. [P30203-3]
ENST00000352009; ENSP00000340628; ENSG00000013725. [P30203-4]
ENST00000452451; ENSP00000390676; ENSG00000013725. [P30203-5]
GeneID923.
KEGGhsa:923.
UCSCuc001nqq.3. human. [P30203-1]
uc001nqr.3. human. [P30203-4]
uc001nqt.3. human. [P30203-5]

Organism-specific databases

CTD923.
GeneCardsGC11P060743.
H-InvDBHIX0009678.
HGNCHGNC:1691. CD6.
HPACAB002489.
CAB016252.
MIM186720. gene.
neXtProtNX_P30203.
PharmGKBPA26230.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG76003.
HOGENOMHOG000137917.
HOVERGENHBG005289.
InParanoidP30203.
KOK06456.
OMAGEDYCNS.
OrthoDBEOG7DRJ2P.
PhylomeDBP30203.
TreeFamTF329295.

Gene expression databases

ArrayExpressP30203.
BgeeP30203.
CleanExHS_CD6.
GenevestigatorP30203.

Family and domain databases

Gene3D3.10.250.10. 3 hits.
InterProIPR001190. SRCR.
IPR017448. SRCR-like_dom.
[Graphical view]
PfamPF00530. SRCR. 3 hits.
[Graphical view]
PRINTSPR00258. SPERACTRCPTR.
SMARTSM00202. SR. 3 hits.
[Graphical view]
SUPFAMSSF56487. SSF56487. 3 hits.
PROSITEPS00420. SRCR_1. 1 hit.
PS50287. SRCR_2. 3 hits.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiCD6.
GenomeRNAi923.
NextBio3818.
PROP30203.
SOURCESearch...

Entry information

Entry nameCD6_HUMAN
AccessionPrimary (citable) accession number: P30203
Secondary accession number(s): A4KAD4 expand/collapse secondary AC list , A4KAD5, Q9UMF2, Q9Y4K7, Q9Y4K8, Q9Y4K9, Q9Y4L0
Entry history
Integrated into UniProtKB/Swiss-Prot: April 1, 1993
Last sequence update: December 15, 2009
Last modified: April 16, 2014
This is version 122 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 11

Human chromosome 11: entries, gene names and cross-references to MIM

Human cell differentiation molecules

CD nomenclature of surface proteins of human leucocytes and list of entries