Reviewed,
UniProtKB/Swiss-Prot P30203 (CD6_HUMAN)
Last modified
November 24, 2009.
Version 85.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: T-cell differentiation antigen CD6 Alternative name(s): T12 TP120 CD_antigen=CD6 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Complete proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 668 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Involved in cell adhesion. Binds to CD166. |
| Subcellular location | |
| Tissue specificity | Expressed by thymocytes, mature T-cells, a subset of B-cells known as B-1 cells, and by some cells in the brain. |
| Post-translational modification | After T-cell activation, becomes hyperphosphorylated on Ser and Thr residues and phosphorylated on Tyr residues. Ref.3 Ref.4 Contains intrachain disulfide bond(s). |
| Sequence similarities | Contains 3 SRCR domains. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Cell adhesion |
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat Signal Transmembrane |
| PTM | Disulfide bond Glycoprotein Phosphoprotein |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | cell adhesion Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | integral to plasma membrane Ref.1 Traceable author statement. Source: ProtInc |
| Molecular function | scavenger receptor activity Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform CD6A (identifier: P30203-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform CD6B (identifier: P30203-2) The sequence of this isoform differs from the canonical sequence as follows: 431-462: Missing. | ||||||
| Isoform CD6C (identifier: P30203-3) The sequence of this isoform differs from the canonical sequence as follows: 431-462: Missing. 463-504: VFMLPIQVQAPPPEDSDSGSDSDYEHYDFSAQPPVALTTFYN → D | ||||||
| Isoform CD6D (identifier: P30203-4) The sequence of this isoform differs from the canonical sequence as follows: 431-462: Missing. 613-647: Missing. | ||||||
| Isoform CD6E (identifier: P30203-5) The sequence of this isoform differs from the canonical sequence as follows: 463-504: VFMLPIQVQAPPPEDSDSGSDSDYEHYDFSAQPPVALTTFYN → D 613-647: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 17 | 17 | Potential | ||||||||
| Chain | 18 – 668 | 651 | T-cell differentiation antigen CD6 | PRO_0000033227 | |||||||
Regions | |||||||||||
| Topological domain | 18 – 402 | 385 | Extracellular Potential | ||||||||
| Transmembrane | 403 – 423 | 21 | Potential | ||||||||
| Topological domain | 424 – 668 | 245 | Cytoplasmic Potential | ||||||||
| Domain | 45 – 156 | 112 | SRCR 1 | ||||||||
| Domain | 161 – 260 | 100 | SRCR 2 | ||||||||
| Domain | 265 – 361 | 97 | SRCR 3 | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 28 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 49 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 112 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 118 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 229 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 339 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 345 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 368 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 70 ↔ 144 | By similarity | |||||||||
| Disulfide bond | 83 ↔ 155 | By similarity | |||||||||
| Disulfide bond | 129 ↔ 137 | By similarity | |||||||||
| Disulfide bond | 186 ↔ 249 | By similarity | |||||||||
| Disulfide bond | 199 ↔ 259 | By similarity | |||||||||
| Disulfide bond | 230 ↔ 240 | By similarity | |||||||||
| Disulfide bond | 290 ↔ 350 | By similarity | |||||||||
| Disulfide bond | 303 ↔ 360 | By similarity | |||||||||
| Disulfide bond | 330 ↔ 340 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 431 – 462 | 32 | Missing in isoform CD6B, isoform CD6C and isoform CD6D. | VSP_006221 | |||||||
| Alternative sequence | 463 – 504 | 42 | VFMLP…TTFYN → D in isoform CD6C and isoform CD6E. | VSP_006222 | |||||||
| Alternative sequence | 613 – 647 | 35 | Missing in isoform CD6D and isoform CD6E. | VSP_006223 | |||||||
| Natural variant | 217 | 1 | T → M: dbSNP rs11230562. | VAR_059809 | |||||||
| Natural variant | 225 | 1 | R → W: dbSNP rs11230563. | VAR_057202 | |||||||
| Natural variant | 271 | 1 | A → T: dbSNP rs12360861. | VAR_057203 | |||||||
| Natural variant | 351 | 1 | S → N: dbSNP rs34974368. | VAR_057204 | |||||||
| Natural variant | 606 | 1 | G → S: dbSNP rs2074233. | VAR_057205 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 463 – 468 | 6 | VFMLPI → GPGPAP in CAA43306. Ref.1 | ||||||||
| Sequence conflict | 613 | 1 | Missing in AAC51162. Ref.2 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| [1] | "The lymphocyte glycoprotein CD6 contains a repeated domain structure characteristic of a new family of cell surface and secreted proteins." Aruffo A., Melnick M.B., Linsley P.S., Seed B. J. Exp. Med. 174:949-952(1991) [PubMed: 1919444] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-468. |
| [2] | "Structure and chromosomal location of the human CD6 gene: detection of five human CD6 isoforms." Bowen M.A., Whitney G.S., Neubauer M., Starling G.C., Palmer D., Zhang J., Nowak N.J., Shows T.B., Aruffo A. J. Immunol. 158:1149-1156(1997) [PubMed: 9013954] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA], ALTERNATIVE SPLICING. |
| [3] | "Biosynthesis and post-translational modification of CD6, a T cell signal-transducing molecule." Swack J.A., Mier J.W., Romain P.L., Hull S.R., Rudd C.E. J. Biol. Chem. 266:7137-7143(1991) [PubMed: 2016320] [Abstract] Cited for: PHOSPHORYLATION AT SERINE RESIDUES, DISULFIDE BONDS, GLYCOSYLATION. |
| [4] | "Tyrosine phosphorylation of CD6 by stimulation of CD3: augmentation by the CD4 and CD2 coreceptors." Wee S., Schieven G.L., Kirihara J.M., Tsu T.T., Ledbetter J.A., Aruffo A. J. Exp. Med. 177:219-223(1993) [PubMed: 7678115] [Abstract] Cited for: PHOSPHORYLATION AT TYROSINE RESIDUES. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| X60992 mRNA. Translation: CAA43306.1. U66142 mRNA. Translation: AAC51161.1. U66143 Genomic DNA. Translation: AAC51162.1. U66144 Genomic DNA. Translation: AAC51163.1. U66145 mRNA. Translation: AAC51164.1. U66146 mRNA. Translation: AAC51165.1. | |
| IPI | IPI00025700. IPI00218871. IPI00218872. IPI00218873. IPI00374647. |
| PIR | S26741. |
| UniGene | Hs.712554 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | P30203. |
PTM databases | |
| PhosphoSite | P30203. |
Proteomic databases | |
| PRIDE | P30203. |
Genome annotation databases | |
| Ensembl | ENST00000313421; ENSP00000323280; ENSG00000013725; Homo sapiens. [Genome view] |
| UCSC | uc001nqq.1. human. uc001nqr.1. human. uc001nqt.1. human. |
Organism-specific databases | |
| GeneCards | GC11P060495. |
| H-InvDB | HIX0009678. |
| HGNC | HGNC:1691. CD6. |
| HPA | CAB002489. CAB016252. |
| MIM | 186720. gene. |
| PharmGKB | PA26230. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOGENOM | P30203. |
| HOVERGEN | P30203. |
Gene expression databases | |
| ArrayExpress | P30203. |
| Bgee | P30203. |
| CleanEx | HS_CD6. |
| Genevestigator | P30203. |
| GermOnline | ENSG00000013725. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR001190. Srcr_rcpt. IPR017448. Srcr_rcpt-rel. [Graphical view] |
| Pfam | PF00530. SRCR. 3 hits. [Graphical view] |
| PRINTS | PR00258. SPERACTRCPTR. |
| SMART | SM00202. SR. 3 hits. [Graphical view] |
| PROSITE | PS00420. SRCR_1. 1 hit. PS50287. SRCR_2. 3 hits. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| SOURCE | Search... |
Entry information
| Entry name | CD6_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P30203 Secondary accession number(s): Q9UMF2 Q9Y4L0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human cell differentiation molecules CD nomenclature of surface proteins of human leucocytes and list of entries |
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


