Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P30203

- CD6_HUMAN

UniProt

P30203 - CD6_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

T-cell differentiation antigen CD6

Gene

CD6

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Involved in cell adhesion. Binds to CD166.

GO - Molecular functioni

  1. scavenger receptor activity Source: InterPro

GO - Biological processi

  1. cell adhesion Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Names & Taxonomyi

Protein namesi
Recommended name:
T-cell differentiation antigen CD6
Alternative name(s):
T12
TP120
CD_antigen: CD6
Gene namesi
Name:CD6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 11

Organism-specific databases

HGNCiHGNC:1691. CD6.

Subcellular locationi

Cell membrane 1 Publication; Single-pass type I membrane protein 1 Publication

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini18 – 402385ExtracellularSequence AnalysisAdd
BLAST
Transmembranei403 – 42321HelicalSequence AnalysisAdd
BLAST
Topological domaini424 – 668245CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. integral component of plasma membrane Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA26230.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1717Sequence AnalysisAdd
BLAST
Chaini18 – 668651T-cell differentiation antigen CD6PRO_0000033227Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi28 – 281N-linked (GlcNAc...)Sequence Analysis
Glycosylationi49 – 491N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi70 ↔ 144PROSITE-ProRule annotation
Disulfide bondi83 ↔ 155PROSITE-ProRule annotation
Glycosylationi112 – 1121N-linked (GlcNAc...)Sequence Analysis
Glycosylationi118 – 1181N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi129 ↔ 137PROSITE-ProRule annotation
Disulfide bondi186 ↔ 249PROSITE-ProRule annotation
Disulfide bondi199 ↔ 259PROSITE-ProRule annotation
Glycosylationi229 – 2291N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi230 ↔ 240PROSITE-ProRule annotation
Disulfide bondi290 ↔ 350PROSITE-ProRule annotation
Disulfide bondi303 ↔ 360PROSITE-ProRule annotation
Disulfide bondi330 ↔ 340PROSITE-ProRule annotation
Glycosylationi339 – 3391N-linked (GlcNAc...)Sequence Analysis
Glycosylationi345 – 3451N-linked (GlcNAc...)Sequence Analysis
Glycosylationi368 – 3681N-linked (GlcNAc...)Sequence Analysis

Post-translational modificationi

After T-cell activation, becomes hyperphosphorylated on Ser and Thr residues and phosphorylated on Tyr residues.2 Publications

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiP30203.
PRIDEiP30203.

PTM databases

PhosphoSiteiP30203.

Expressioni

Tissue specificityi

Expressed by thymocytes, mature T-cells, a subset of B-cells known as B-1 cells, and by some cells in the brain.

Gene expression databases

BgeeiP30203.
CleanExiHS_CD6.
ExpressionAtlasiP30203. baseline and differential.
GenevestigatoriP30203.

Organism-specific databases

HPAiCAB002489.
CAB016252.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
ALCAMQ137402EBI-2873748,EBI-1188108
LGALS1P093822EBI-2873748,EBI-1048875
LGALS3P179312EBI-2873748,EBI-1170392

Protein-protein interaction databases

BioGridi107361. 6 interactions.
IntActiP30203. 7 interactions.
MINTiMINT-1351620.
STRINGi9606.ENSP00000323280.

Structurei

3D structure databases

ProteinModelPortaliP30203.
SMRiP30203. Positions 161-361.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini45 – 156112SRCR 1PROSITE-ProRule annotationAdd
BLAST
Domaini161 – 260100SRCR 2PROSITE-ProRule annotationAdd
BLAST
Domaini265 – 36197SRCR 3PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 3 SRCR domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG76003.
GeneTreeiENSGT00760000118953.
HOGENOMiHOG000137917.
HOVERGENiHBG005289.
InParanoidiP30203.
KOiK06456.
OMAiGEDYCNS.
OrthoDBiEOG7DRJ2P.
PhylomeDBiP30203.
TreeFamiTF329295.

Family and domain databases

Gene3Di3.10.250.10. 3 hits.
InterProiIPR001190. SRCR.
IPR017448. SRCR-like_dom.
[Graphical view]
PfamiPF00530. SRCR. 3 hits.
[Graphical view]
PRINTSiPR00258. SPERACTRCPTR.
SMARTiSM00202. SR. 3 hits.
[Graphical view]
SUPFAMiSSF56487. SSF56487. 3 hits.
PROSITEiPS00420. SRCR_1. 1 hit.
PS50287. SRCR_2. 3 hits.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 isoformsi produced by alternative splicing. Align

Isoform CD6A (identifier: P30203-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MWLFFGITGL LTAALSGHPS PAPPDQLNTS SAESELWEPG ERLPVRLTNG
60 70 80 90 100
SSSCSGTVEV RLEASWEPAC GALWDSRAAE AVCRALGCGG AEAASQLAPP
110 120 130 140 150
TPELPPPPAA GNTSVAANAT LAGAPALLCS GAEWRLCEVV EHACRSDGRR
160 170 180 190 200
ARVTCAENRA LRLVDGGGAC AGRVEMLEHG EWGSVCDDTW DLEDAHVVCR
210 220 230 240 250
QLGCGWAVQA LPGLHFTPGR GPIHRDQVNC SGAEAYLWDC PGLPGQHYCG
260 270 280 290 300
HKEDAGAVCS EHQSWRLTGG ADRCEGQVEV HFRGVWNTVC DSEWYPSEAK
310 320 330 340 350
VLCQSLGCGT AVERPKGLPH SLSGRMYYSC NGEELTLSNC SWRFNNSNLC
360 370 380 390 400
SQSLAARVLC SASRSLHNLS TPEVPASVQT VTIESSVTVK IENKESRELM
410 420 430 440 450
LLIPSIVLGI LLLGSLIFIA FILLRIKGKY ALPVMVNHQH LPTTIPAGSN
460 470 480 490 500
SYQPVPITIP KEVFMLPIQV QAPPPEDSDS GSDSDYEHYD FSAQPPVALT
510 520 530 540 550
TFYNSQRHRV TDEEVQQSRF QMPPLEEGLE ELHASHIPTA NPGHCITDPP
560 570 580 590 600
SLGPQYHPRS NSESSTSSGE DYCNSPKSKL PPWNPQVFSS ERSSFLEQPP
610 620 630 640 650
NLELAGTQPA FSAGPPADDS SSTSSGEWYQ NFQPPPQPPS EEQFGCPGSP
660
SPQPDSTDND DYDDISAA
Length:668
Mass (Da):71,801
Last modified:December 15, 2009 - v3
Checksum:i59E6790E77FFBC42
GO
Isoform CD6B (identifier: P30203-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     431-462: Missing.

Show »
Length:636
Mass (Da):68,368
Checksum:i8EC9117BF4AAD154
GO
Isoform CD6C (identifier: P30203-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     431-462: Missing.
     463-504: VFMLPIQVQAPPPEDSDSGSDSDYEHYDFSAQPPVALTTFYN → D

Show »
Length:595
Mass (Da):63,824
Checksum:i04D85EE0DBB4A885
GO
Isoform CD6D (identifier: P30203-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     431-462: Missing.
     613-647: Missing.

Show »
Length:601
Mass (Da):64,663
Checksum:i0D8DCC42B53BDA2E
GO
Isoform CD6E (identifier: P30203-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     463-504: VFMLPIQVQAPPPEDSDSGSDSDYEHYDFSAQPPVALTTFYN → D
     613-647: Missing.

Show »
Length:592
Mass (Da):63,552
Checksum:i504C102257DA7B3C
GO
Isoform 6 (identifier: P30203-6) [UniParc]FASTAAdd to Basket

Also known as: CD6deltaD3Ex6

The sequence of this isoform differs from the canonical sequence as follows:
     261-383: Missing.

Note: Lacks the third SRCR domain and doesn't bind CD166. Doesn't localize to the immunological synapse.

Show »
Length:545
Mass (Da):58,283
Checksum:i54FA60E898D7DF82
GO
Isoform 7 (identifier: P30203-7) [UniParc]FASTAAdd to Basket

Also known as: CD6deltaD3

The sequence of this isoform differs from the canonical sequence as follows:
     259-359: Missing.

Note: Lacks the third SRCR domain and doesn't bind CD166. Doesn't localize to the immunological synapse. Constitutes the only expressed species in a small percentage of T-cells.

Show »
Length:567
Mass (Da):60,572
Checksum:iC99852C6756B3154
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti47 – 471L → R in ABH04237. (PubMed:17371992)Curated
Sequence conflicti463 – 4686VFMLPI → GPGPAP in CAA43306. (PubMed:1919444)Curated
Sequence conflicti613 – 6131Missing in AAC51162. (PubMed:9013954)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti217 – 2171T → M.1 Publication
Corresponds to variant rs11230562 [ dbSNP | Ensembl ].
VAR_059809
Natural varianti225 – 2251R → W.
Corresponds to variant rs11230563 [ dbSNP | Ensembl ].
VAR_057202
Natural varianti257 – 2571A → V.3 Publications
Corresponds to variant rs2074225 [ dbSNP | Ensembl ].
VAR_060790
Natural varianti271 – 2711A → T.
Corresponds to variant rs12360861 [ dbSNP | Ensembl ].
VAR_057203
Natural varianti351 – 3511S → N.
Corresponds to variant rs34974368 [ dbSNP | Ensembl ].
VAR_057204
Natural varianti606 – 6061G → S.
Corresponds to variant rs2074233 [ dbSNP | Ensembl ].
VAR_057205

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei259 – 359101Missing in isoform 7. 1 PublicationVSP_054245Add
BLAST
Alternative sequencei261 – 383123Missing in isoform 6. 1 PublicationVSP_054246Add
BLAST
Alternative sequencei431 – 46232Missing in isoform CD6B, isoform CD6C and isoform CD6D. CuratedVSP_006221Add
BLAST
Alternative sequencei463 – 50442VFMLP…TTFYN → D in isoform CD6C and isoform CD6E. CuratedVSP_006222Add
BLAST
Alternative sequencei613 – 64735Missing in isoform CD6D and isoform CD6E. CuratedVSP_006223Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U66142 mRNA. Translation: AAC51161.1.
U66143 Genomic DNA. Translation: AAC51162.1.
U66144 Genomic DNA. Translation: AAC51163.1.
U66145 mRNA. Translation: AAC51164.1.
U66146 mRNA. Translation: AAC51165.1.
AP003721 Genomic DNA. No translation available.
X60992 mRNA. Translation: CAA43306.1.
DQ786329 mRNA. Translation: ABH04237.1.
DQ786330 mRNA. Translation: ABH04238.1.
CCDSiCCDS58137.1. [P30203-5]
CCDS58138.1. [P30203-4]
CCDS7999.1. [P30203-1]
PIRiS26741.
RefSeqiNP_001241679.1. NM_001254750.1. [P30203-4]
NP_001241680.1. NM_001254751.1. [P30203-5]
NP_006716.3. NM_006725.4. [P30203-1]
XP_006718801.1. XM_006718738.1. [P30203-2]
XP_006718804.1. XM_006718741.1. [P30203-3]
UniGeneiHs.744366.

Genome annotation databases

EnsembliENST00000313421; ENSP00000323280; ENSG00000013725. [P30203-1]
ENST00000352009; ENSP00000340628; ENSG00000013725. [P30203-4]
ENST00000452451; ENSP00000390676; ENSG00000013725. [P30203-5]
GeneIDi923.
KEGGihsa:923.
UCSCiuc001nqq.3. human. [P30203-1]
uc001nqr.3. human. [P30203-4]
uc001nqt.3. human. [P30203-5]

Polymorphism databases

DMDMi281185506.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U66142 mRNA. Translation: AAC51161.1 .
U66143 Genomic DNA. Translation: AAC51162.1 .
U66144 Genomic DNA. Translation: AAC51163.1 .
U66145 mRNA. Translation: AAC51164.1 .
U66146 mRNA. Translation: AAC51165.1 .
AP003721 Genomic DNA. No translation available.
X60992 mRNA. Translation: CAA43306.1 .
DQ786329 mRNA. Translation: ABH04237.1 .
DQ786330 mRNA. Translation: ABH04238.1 .
CCDSi CCDS58137.1. [P30203-5 ]
CCDS58138.1. [P30203-4 ]
CCDS7999.1. [P30203-1 ]
PIRi S26741.
RefSeqi NP_001241679.1. NM_001254750.1. [P30203-4 ]
NP_001241680.1. NM_001254751.1. [P30203-5 ]
NP_006716.3. NM_006725.4. [P30203-1 ]
XP_006718801.1. XM_006718738.1. [P30203-2 ]
XP_006718804.1. XM_006718741.1. [P30203-3 ]
UniGenei Hs.744366.

3D structure databases

ProteinModelPortali P30203.
SMRi P30203. Positions 161-361.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 107361. 6 interactions.
IntActi P30203. 7 interactions.
MINTi MINT-1351620.
STRINGi 9606.ENSP00000323280.

PTM databases

PhosphoSitei P30203.

Polymorphism databases

DMDMi 281185506.

Proteomic databases

PaxDbi P30203.
PRIDEi P30203.

Protocols and materials databases

DNASUi 923.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000313421 ; ENSP00000323280 ; ENSG00000013725 . [P30203-1 ]
ENST00000352009 ; ENSP00000340628 ; ENSG00000013725 . [P30203-4 ]
ENST00000452451 ; ENSP00000390676 ; ENSG00000013725 . [P30203-5 ]
GeneIDi 923.
KEGGi hsa:923.
UCSCi uc001nqq.3. human. [P30203-1 ]
uc001nqr.3. human. [P30203-4 ]
uc001nqt.3. human. [P30203-5 ]

Organism-specific databases

CTDi 923.
GeneCardsi GC11P060743.
H-InvDB HIX0009678.
HGNCi HGNC:1691. CD6.
HPAi CAB002489.
CAB016252.
MIMi 186720. gene.
neXtProti NX_P30203.
PharmGKBi PA26230.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG76003.
GeneTreei ENSGT00760000118953.
HOGENOMi HOG000137917.
HOVERGENi HBG005289.
InParanoidi P30203.
KOi K06456.
OMAi GEDYCNS.
OrthoDBi EOG7DRJ2P.
PhylomeDBi P30203.
TreeFami TF329295.

Miscellaneous databases

GeneWikii CD6.
GenomeRNAii 923.
NextBioi 35461816.
PROi P30203.
SOURCEi Search...

Gene expression databases

Bgeei P30203.
CleanExi HS_CD6.
ExpressionAtlasi P30203. baseline and differential.
Genevestigatori P30203.

Family and domain databases

Gene3Di 3.10.250.10. 3 hits.
InterProi IPR001190. SRCR.
IPR017448. SRCR-like_dom.
[Graphical view ]
Pfami PF00530. SRCR. 3 hits.
[Graphical view ]
PRINTSi PR00258. SPERACTRCPTR.
SMARTi SM00202. SR. 3 hits.
[Graphical view ]
SUPFAMi SSF56487. SSF56487. 3 hits.
PROSITEi PS00420. SRCR_1. 1 hit.
PS50287. SRCR_2. 3 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Structure and chromosomal location of the human CD6 gene: detection of five human CD6 isoforms."
    Bowen M.A., Whitney G.S., Neubauer M., Starling G.C., Palmer D., Zhang J., Nowak N.J., Shows T.B., Aruffo A.
    J. Immunol. 158:1149-1156(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA], ALTERNATIVE SPLICING, VARIANT VAL-257.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The lymphocyte glycoprotein CD6 contains a repeated domain structure characteristic of a new family of cell surface and secreted proteins."
    Aruffo A., Melnick M.B., Linsley P.S., Seed B.
    J. Exp. Med. 174:949-952(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-468, VARIANT VAL-257.
  4. "Extracellular isoforms of CD6 generated by alternative splicing regulate targeting of CD6 to the immunological synapse."
    Castro M.A., Oliveira M.I., Nunes R.J., Fabre S., Barbosa R., Peixoto A., Brown M.H., Parnes J.R., Bismuth G., Moreira A., Rocha B., Carmo A.M.
    J. Immunol. 178:4351-4361(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-278 (ISOFORM 6), NUCLEOTIDE SEQUENCE [MRNA] OF 1-300 (ISOFORM 7), SUBCELLULAR LOCATION, VARIANTS MET-217 AND VAL-257, ALTERNATIVE SPLICING.
  5. "Biosynthesis and post-translational modification of CD6, a T cell signal-transducing molecule."
    Swack J.A., Mier J.W., Romain P.L., Hull S.R., Rudd C.E.
    J. Biol. Chem. 266:7137-7143(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION AT SERINE RESIDUES, DISULFIDE BONDS, GLYCOSYLATION.
  6. "Tyrosine phosphorylation of CD6 by stimulation of CD3: augmentation by the CD4 and CD2 coreceptors."
    Wee S., Schieven G.L., Kirihara J.M., Tsu T.T., Ledbetter J.A., Aruffo A.
    J. Exp. Med. 177:219-223(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION AT TYROSINE RESIDUES.

Entry informationi

Entry nameiCD6_HUMAN
AccessioniPrimary (citable) accession number: P30203
Secondary accession number(s): A4KAD4
, A4KAD5, Q9UMF2, Q9Y4K7, Q9Y4K8, Q9Y4K9, Q9Y4L0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 1, 1993
Last sequence update: December 15, 2009
Last modified: October 29, 2014
This is version 127 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3