P30203 (CD6_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 113.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: T-cell differentiation antigen CD6 Alternative name(s): T12 TP120 CD_antigen=CD6 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 668 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Involved in cell adhesion. Binds to CD166. |
| Subcellular location | |
| Tissue specificity | Expressed by thymocytes, mature T-cells, a subset of B-cells known as B-1 cells, and by some cells in the brain. |
| Post-translational modification | After T-cell activation, becomes hyperphosphorylated on Ser and Thr residues and phosphorylated on Tyr residues. Ref.4 Ref.5 Contains intrachain disulfide bond(s). |
| Sequence similarities | Contains 3 SRCR domains. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Cell adhesion |
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat Signal Transmembrane Transmembrane helix |
| PTM | Disulfide bond Glycoprotein Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cell adhesion Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | cell surface Inferred from direct assay PubMed 12493773. Source: UniProtKB integral to plasma membraneTraceable author statement Ref.3. Source: ProtInc |
| Molecular_function | scavenger receptor activity Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform CD6A (identifier: P30203-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform CD6B (identifier: P30203-2) The sequence of this isoform differs from the canonical sequence as follows: 431-462: Missing. | ||||||
| Isoform CD6C (identifier: P30203-3) The sequence of this isoform differs from the canonical sequence as follows: 431-462: Missing. 463-504: VFMLPIQVQAPPPEDSDSGSDSDYEHYDFSAQPPVALTTFYN → D | ||||||
| Isoform CD6D (identifier: P30203-4) The sequence of this isoform differs from the canonical sequence as follows: 431-462: Missing. 613-647: Missing. | ||||||
| Isoform CD6E (identifier: P30203-5) The sequence of this isoform differs from the canonical sequence as follows: 463-504: VFMLPIQVQAPPPEDSDSGSDSDYEHYDFSAQPPVALTTFYN → D 613-647: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 17 | 17 | Potential | ||||||||
| Chain | 18 – 668 | 651 | T-cell differentiation antigen CD6 | PRO_0000033227 | |||||||
Regions | |||||||||||
| Topological domain | 18 – 402 | 385 | Extracellular Potential | ||||||||
| Transmembrane | 403 – 423 | 21 | Helical; Potential | ||||||||
| Topological domain | 424 – 668 | 245 | Cytoplasmic Potential | ||||||||
| Domain | 45 – 156 | 112 | SRCR 1 | ||||||||
| Domain | 161 – 260 | 100 | SRCR 2 | ||||||||
| Domain | 265 – 361 | 97 | SRCR 3 | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 28 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 49 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 112 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 118 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 229 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 339 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 345 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 368 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 70 ↔ 144 | By similarity | |||||||||
| Disulfide bond | 83 ↔ 155 | By similarity | |||||||||
| Disulfide bond | 129 ↔ 137 | By similarity | |||||||||
| Disulfide bond | 186 ↔ 249 | By similarity | |||||||||
| Disulfide bond | 199 ↔ 259 | By similarity | |||||||||
| Disulfide bond | 230 ↔ 240 | By similarity | |||||||||
| Disulfide bond | 290 ↔ 350 | By similarity | |||||||||
| Disulfide bond | 303 ↔ 360 | By similarity | |||||||||
| Disulfide bond | 330 ↔ 340 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 431 – 462 | 32 | Missing in isoform CD6B, isoform CD6C and isoform CD6D. | VSP_006221 | |||||||
| Alternative sequence | 463 – 504 | 42 | VFMLP…TTFYN → D in isoform CD6C and isoform CD6E. | VSP_006222 | |||||||
| Alternative sequence | 613 – 647 | 35 | Missing in isoform CD6D and isoform CD6E. | VSP_006223 | |||||||
| Natural variant | 217 | 1 | T → M. Corresponds to variant rs11230562 [ dbSNP | Ensembl ]. | VAR_059809 | |||||||
| Natural variant | 225 | 1 | R → W. Corresponds to variant rs11230563 [ dbSNP | Ensembl ]. | VAR_057202 | |||||||
| Natural variant | 257 | 1 | A → V. Ref.1 Ref.3 Corresponds to variant rs2074225 [ dbSNP | Ensembl ]. | VAR_060790 | |||||||
| Natural variant | 271 | 1 | A → T. Corresponds to variant rs12360861 [ dbSNP | Ensembl ]. | VAR_057203 | |||||||
| Natural variant | 351 | 1 | S → N. Corresponds to variant rs34974368 [ dbSNP | Ensembl ]. | VAR_057204 | |||||||
| Natural variant | 606 | 1 | G → S. Corresponds to variant rs2074233 [ dbSNP | Ensembl ]. | VAR_057205 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 463 – 468 | 6 | VFMLPI → GPGPAP in CAA43306. Ref.3 | ||||||||
| Sequence conflict | 613 | 1 | Missing in AAC51162. Ref.1 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Structure and chromosomal location of the human CD6 gene: detection of five human CD6 isoforms." Bowen M.A., Whitney G.S., Neubauer M., Starling G.C., Palmer D., Zhang J., Nowak N.J., Shows T.B., Aruffo A. J. Immunol. 158:1149-1156(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA], ALTERNATIVE SPLICING, VARIANT VAL-257. |
| [2] | "Human chromosome 11 DNA sequence and analysis including novel gene identification." Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. Sakaki Y.Nature 440:497-500(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The lymphocyte glycoprotein CD6 contains a repeated domain structure characteristic of a new family of cell surface and secreted proteins." Aruffo A., Melnick M.B., Linsley P.S., Seed B. J. Exp. Med. 174:949-952(1991) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-468, VARIANT VAL-257. |
| [4] | "Biosynthesis and post-translational modification of CD6, a T cell signal-transducing molecule." Swack J.A., Mier J.W., Romain P.L., Hull S.R., Rudd C.E. J. Biol. Chem. 266:7137-7143(1991) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT SERINE RESIDUES, DISULFIDE BONDS, GLYCOSYLATION. |
| [5] | "Tyrosine phosphorylation of CD6 by stimulation of CD3: augmentation by the CD4 and CD2 coreceptors." Wee S., Schieven G.L., Kirihara J.M., Tsu T.T., Ledbetter J.A., Aruffo A. J. Exp. Med. 177:219-223(1993) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT TYROSINE RESIDUES. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U66142 mRNA. Translation: AAC51161.1. U66143 Genomic DNA. Translation: AAC51162.1. U66144 Genomic DNA. Translation: AAC51163.1. U66145 mRNA. Translation: AAC51164.1. U66146 mRNA. Translation: AAC51165.1. AP003721 Genomic DNA. No translation available. X60992 mRNA. Translation: CAA43306.1. |
| IPI | IPI00025700. IPI00218871. IPI00218872. IPI00218873. IPI00374647. |
| PIR | S26741. |
| RefSeq | NP_001241679.1. NM_001254750.1. NP_001241680.1. NM_001254751.1. NP_006716.3. NM_006725.4. |
| UniGene | Hs.643167. |
3D structure databases | |
| ProteinModelPortal | P30203. |
| SMR | P30203. Positions 161-361. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P30203. 3 interactions. |
| MINT | MINT-1351620. |
| STRING | 9606.ENSP00000323280. |
PTM databases | |
| PhosphoSite | P30203. |
Polymorphism databases | |
| DMDM | 281185506. |
Proteomic databases | |
| PaxDb | P30203. |
| PRIDE | P30203. |
Protocols and materials databases | |
| DNASU | 923. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000313421; ENSP00000323280; ENSG00000013725. ENST00000344028; ENSP00000344108; ENSG00000013725. ENST00000346437; ENSP00000345566; ENSG00000013725. ENST00000352009; ENSP00000340628; ENSG00000013725. ENST00000452451; ENSP00000390676; ENSG00000013725. |
| GeneID | 923. |
| KEGG | hsa:923. |
| UCSC | uc001nqq.3. human. uc001nqr.3. human. uc001nqt.3. human. |
Organism-specific databases | |
| CTD | 923. |
| GeneCards | GC11P060743. |
| H-InvDB | HIX0009678. |
| HGNC | HGNC:1691. CD6. |
| HPA | CAB002489. CAB016252. |
| MIM | 186720. gene. |
| neXtProt | NX_P30203. |
| PharmGKB | PA26230. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG76003. |
| HOGENOM | HOG000137917. |
| HOVERGEN | HBG005289. |
| InParanoid | P30203. |
| KO | K06456. |
| OMA | TCAENRA. |
| PhylomeDB | P30203. |
Gene expression databases | |
| ArrayExpress | P30203. |
| Bgee | P30203. |
| CleanEx | HS_CD6. |
| Genevestigator | P30203. |
| GermOnline | ENSG00000013725. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR001190. Srcr_rcpt. IPR017448. Srcr_rcpt-rel. [Graphical view] |
| Pfam | PF00530. SRCR. 3 hits. [Graphical view] |
| PRINTS | PR00258. SPERACTRCPTR. |
| SMART | SM00202. SR. 3 hits. [Graphical view] |
| SUPFAM | SSF56487. Srcr_receptor. 3 hits. |
| PROSITE | PS00420. SRCR_1. 1 hit. PS50287. SRCR_2. 3 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 923. |
| NextBio | 3818. |
| SOURCE | Search... |
Entry information
| Entry name | CD6_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P30203 Secondary accession number(s): Q9UMF2 Q9Y4L0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human cell differentiation molecules CD nomenclature of surface proteins of human leucocytes and list of entries |
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
