Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

T-cell differentiation antigen CD6

Gene

CD6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Cell adhesion molecule that mediates cell-cell contacts and regulates T-cell responses via its interaction with ALCAM/CD166 (PubMed:15048703, PubMed:15294938, PubMed:16352806, PubMed:16914752, PubMed:24945728, PubMed:24584089). Contributes to signaling cascades triggered by activation of the TCR/CD3 complex (PubMed:24584089). Functions as costimulatory molecule; promotes T-cell activation and proliferation (PubMed:15294938, PubMed:16352806, PubMed:16914752). Contributes to the formation and maturation of the immunological synapse (PubMed:15294938, PubMed:16352806). Functions as calcium-dependent pattern receptor that binds and aggregates both Gram-positive and Gram-negative bacteria. Binds both lipopolysaccharide (LPS) from Gram-negative bacteria and lipoteichoic acid from Gram-positive bacteria (PubMed:17601777). LPS binding leads to the activation of signaling cascades and down-stream MAP kinases (PubMed:17601777). Mediates activation of the inflammatory response and the secretion of pro-inflammatory cytokines in response to LPS (PubMed:17601777).7 Publications

GO - Molecular functioni

  • lipopolysaccharide binding Source: UniProtKB
  • lipoteichoic acid binding Source: UniProtKB
  • scavenger receptor activity Source: InterPro

GO - Biological processi

  • acute inflammatory response to antigenic stimulus Source: UniProtKB
  • adaptive immune response Source: UniProtKB-KW
  • heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules Source: UniProtKB
  • immunological synapse formation Source: UniProtKB
  • innate immune response Source: UniProtKB-KW
  • lipopolysaccharide-mediated signaling pathway Source: UniProtKB
  • positive regulation of cytokine production involved in inflammatory response Source: UniProtKB
  • positive regulation of T cell proliferation Source: UniProtKB
  • response to lipopolysaccharide Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Adaptive immunity, Cell adhesion, Immunity, Innate immunity

Enzyme and pathway databases

BioCyciZFISH:ENSG00000013725-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
T-cell differentiation antigen CD6
Alternative name(s):
T12
TP120
CD_antigen: CD6
Cleaved into the following chain:
Gene namesi
Name:CD6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:1691. CD6.

Subcellular locationi

Soluble CD6 :

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini18 – 402ExtracellularSequence analysisAdd BLAST385
Transmembranei403 – 423HelicalSequence analysisAdd BLAST21
Topological domaini424 – 668CytoplasmicSequence analysisAdd BLAST245

GO - Cellular componenti

  • extracellular region Source: UniProtKB-SubCell
  • immunological synapse Source: UniProtKB
  • integral component of plasma membrane Source: ProtInc
  • intrinsic component of plasma membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi291D → A: Strongly reduces interaction with ALCAM. 1 Publication1
Mutagenesisi293E → A: Reduces interaction with ALCAM. 1 Publication1
Mutagenesisi295Y → A: Abolishes interaction with ALCAM. 1 Publication1
Mutagenesisi298E → A: Nearly abolishes interaction with ALCAM. 1 Publication1
Mutagenesisi314R → A: Reduces interaction with ALCAM. 1 Publication1
Mutagenesisi327Y → A: Nearly abolishes interaction with ALCAM. 1 Publication1
Mutagenesisi329S → A: Reduces interaction with ALCAM. 1 Publication1
Mutagenesisi346N → A: Strongly reduces interaction with ALCAM. 1 Publication1
Mutagenesisi349L → A: Reduces interaction with ALCAM. 1 Publication1
Mutagenesisi352Q → A: Reduces interaction with ALCAM. 1 Publication1
Mutagenesisi353S → A: Reduces interaction with ALCAM. 1 Publication1
Mutagenesisi662Y → F: Reduces tyrosine phosphorylation. Reduces affinity for LCP2. Impairs activation of T-cells. 1 Publication1

Organism-specific databases

DisGeNETi923.
OpenTargetsiENSG00000013725.
PharmGKBiPA26230.

Polymorphism and mutation databases

BioMutaiCD6.
DMDMi281185506.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 17Sequence analysisAdd BLAST17
ChainiPRO_000003322718 – 668T-cell differentiation antigen CD6Add BLAST651
ChainiPRO_000043513318 – ?Soluble CD6

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi28N-linked (GlcNAc...)Sequence analysis1 Publication1
Glycosylationi49N-linked (GlcNAc...)Sequence analysis1 Publication1
Disulfide bondi54 ↔ 88Combined sources1 Publication
Disulfide bondi70 ↔ 144PROSITE-ProRule annotationCombined sources1 Publication
Disulfide bondi83 ↔ 155PROSITE-ProRule annotationCombined sources1 Publication
Glycosylationi112N-linked (GlcNAc...)Sequence analysis1
Glycosylationi118N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi129 ↔ 137PROSITE-ProRule annotationCombined sources1 Publication
Disulfide bondi170 ↔ 204Combined sources1 Publication
Disulfide bondi186 ↔ 249PROSITE-ProRule annotationCombined sources1 Publication
Disulfide bondi199 ↔ 259PROSITE-ProRule annotationCombined sources1 Publication
Glycosylationi229N-linked (GlcNAc...)Sequence analysis1 Publication1
Disulfide bondi230 ↔ 240PROSITE-ProRule annotationCombined sources1 Publication
Disulfide bondi290 ↔ 350PROSITE-ProRule annotationCombined sources1 Publication
Disulfide bondi303 ↔ 360PROSITE-ProRule annotationCombined sources1 Publication
Disulfide bondi330 ↔ 340PROSITE-ProRule annotationCombined sources1 Publication
Glycosylationi339N-linked (GlcNAc...)Sequence analysis1
Glycosylationi345N-linked (GlcNAc...)Sequence analysis1
Glycosylationi368N-linked (GlcNAc...)Sequence analysis1
Modified residuei662Phosphotyrosine1 Publication1

Post-translational modificationi

After T-cell activation, becomes hyperphosphorylated on Ser and Thr residues and phosphorylated on Tyr residues.4 Publications
Glycosylated.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiP30203.
PeptideAtlasiP30203.
PRIDEiP30203.

PTM databases

iPTMnetiP30203.
PhosphoSitePlusiP30203.

Expressioni

Tissue specificityi

Detected on thymocytes (PubMed:15294938). Detected on peripheral blood T-cells (PubMed:15048703, PubMed:16352806). Detected on natural killer (NK) cells (PubMed:16352806). Soluble CD6 is detected in blood serum (at protein level) (PubMed:17601777). Detected in spleen, thymus, appendix, lymph node and peripheral blood leukocytes (PubMed:9013954). Expressed by thymocytes, mature T-cells, a subset of B-cells known as B-1 cells, and by some cells in the brain.5 Publications

Gene expression databases

BgeeiENSG00000013725.
CleanExiHS_CD6.
ExpressionAtlasiP30203. baseline and differential.
GenevisibleiP30203. HS.

Organism-specific databases

HPAiCAB002489.
CAB016252.

Interactioni

Subunit structurei

Interacts (via extracellular domain) with ALCAM/CD166 (via extracellular domain) (PubMed:15048703, PubMed:16352806, PubMed:16914752, PubMed:24945728, PubMed:26146185). Interacts with the TCR/CD3 complex subunit CD3E (PubMed:15294938). Interacts (via tyrosine phosphorylated C-terminus) with LCP2 (via SH2 domain) (PubMed:16914752). Interacts with VAV1 (By similarity). Interacts (via glycosylated extracellular domain) with LGALS1 and LGALS3 (PubMed:24945728). Interaction with LGALS1 or LGALS3 inhibits interaction with ALCAM (PubMed:24945728).By similarity6 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
ALCAMQ137402EBI-2873748,EBI-1188108
LGALS1P093822EBI-2873748,EBI-1048875
LGALS3P179312EBI-2873748,EBI-1170392

Protein-protein interaction databases

BioGridi107361. 6 interactors.
DIPiDIP-43704N.
IntActiP30203. 7 interactors.
MINTiMINT-1351620.
STRINGi9606.ENSP00000323280.

Structurei

Secondary structure

1668
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi45 – 52Combined sources8
Beta strandi55 – 60Combined sources6
Helixi76 – 86Combined sources11
Beta strandi90 – 97Combined sources8
Beta strandi126 – 134Combined sources9
Beta strandi137 – 142Combined sources6
Beta strandi146 – 148Combined sources3
Beta strandi150 – 155Combined sources6
Beta strandi159 – 168Combined sources10
Beta strandi171 – 180Combined sources10
Beta strandi182 – 187Combined sources6
Helixi192 – 202Combined sources11
Beta strandi206 – 209Combined sources4
Beta strandi223 – 228Combined sources6
Beta strandi235 – 237Combined sources3
Beta strandi247 – 249Combined sources3
Helixi251 – 253Combined sources3
Beta strandi256 – 259Combined sources4
Beta strandi264 – 272Combined sources9
Beta strandi275 – 282Combined sources8
Beta strandi285 – 291Combined sources7
Helixi296 – 306Combined sources11
Beta strandi310 – 313Combined sources4
Beta strandi325 – 329Combined sources5
Helixi337 – 339Combined sources3
Beta strandi340 – 345Combined sources6
Turni347 – 349Combined sources3
Beta strandi350 – 352Combined sources3
Beta strandi357 – 363Combined sources7

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5A2EX-ray3.15A1-364[»]
ProteinModelPortaliP30203.
SMRiP30203.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini45 – 156SRCR 1PROSITE-ProRule annotationAdd BLAST112
Domaini161 – 260SRCR 2PROSITE-ProRule annotationAdd BLAST100
Domaini265 – 361SRCR 3PROSITE-ProRule annotationAdd BLAST97

Sequence similaritiesi

Contains 3 SRCR domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IK9E. Eukaryota.
ENOG410YC2B. LUCA.
GeneTreeiENSGT00840000129699.
HOGENOMiHOG000137917.
HOVERGENiHBG005289.
InParanoidiP30203.
KOiK06456.
OMAiRFQMPPL.
OrthoDBiEOG091G0DF7.
PhylomeDBiP30203.
TreeFamiTF329295.

Family and domain databases

Gene3Di3.10.250.10. 3 hits.
InterProiIPR001190. SRCR.
IPR017448. SRCR-like_dom.
[Graphical view]
PfamiPF00530. SRCR. 3 hits.
[Graphical view]
PRINTSiPR00258. SPERACTRCPTR.
SMARTiSM00202. SR. 3 hits.
[Graphical view]
SUPFAMiSSF56487. SSF56487. 3 hits.
PROSITEiPS00420. SRCR_1. 1 hit.
PS50287. SRCR_2. 3 hits.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform CD6A (identifier: P30203-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MWLFFGITGL LTAALSGHPS PAPPDQLNTS SAESELWEPG ERLPVRLTNG
60 70 80 90 100
SSSCSGTVEV RLEASWEPAC GALWDSRAAE AVCRALGCGG AEAASQLAPP
110 120 130 140 150
TPELPPPPAA GNTSVAANAT LAGAPALLCS GAEWRLCEVV EHACRSDGRR
160 170 180 190 200
ARVTCAENRA LRLVDGGGAC AGRVEMLEHG EWGSVCDDTW DLEDAHVVCR
210 220 230 240 250
QLGCGWAVQA LPGLHFTPGR GPIHRDQVNC SGAEAYLWDC PGLPGQHYCG
260 270 280 290 300
HKEDAGAVCS EHQSWRLTGG ADRCEGQVEV HFRGVWNTVC DSEWYPSEAK
310 320 330 340 350
VLCQSLGCGT AVERPKGLPH SLSGRMYYSC NGEELTLSNC SWRFNNSNLC
360 370 380 390 400
SQSLAARVLC SASRSLHNLS TPEVPASVQT VTIESSVTVK IENKESRELM
410 420 430 440 450
LLIPSIVLGI LLLGSLIFIA FILLRIKGKY ALPVMVNHQH LPTTIPAGSN
460 470 480 490 500
SYQPVPITIP KEVFMLPIQV QAPPPEDSDS GSDSDYEHYD FSAQPPVALT
510 520 530 540 550
TFYNSQRHRV TDEEVQQSRF QMPPLEEGLE ELHASHIPTA NPGHCITDPP
560 570 580 590 600
SLGPQYHPRS NSESSTSSGE DYCNSPKSKL PPWNPQVFSS ERSSFLEQPP
610 620 630 640 650
NLELAGTQPA FSAGPPADDS SSTSSGEWYQ NFQPPPQPPS EEQFGCPGSP
660
SPQPDSTDND DYDDISAA
Length:668
Mass (Da):71,801
Last modified:December 15, 2009 - v3
Checksum:i59E6790E77FFBC42
GO
Isoform CD6B (identifier: P30203-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     431-462: Missing.

Show »
Length:636
Mass (Da):68,368
Checksum:i8EC9117BF4AAD154
GO
Isoform CD6C (identifier: P30203-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     431-462: Missing.
     463-504: VFMLPIQVQAPPPEDSDSGSDSDYEHYDFSAQPPVALTTFYN → D

Show »
Length:595
Mass (Da):63,824
Checksum:i04D85EE0DBB4A885
GO
Isoform CD6D (identifier: P30203-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     431-462: Missing.
     613-647: Missing.

Show »
Length:601
Mass (Da):64,663
Checksum:i0D8DCC42B53BDA2E
GO
Isoform CD6E (identifier: P30203-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     463-504: VFMLPIQVQAPPPEDSDSGSDSDYEHYDFSAQPPVALTTFYN → D
     613-647: Missing.

Show »
Length:592
Mass (Da):63,552
Checksum:i504C102257DA7B3C
GO
Isoform 6 (identifier: P30203-6) [UniParc]FASTAAdd to basket
Also known as: CD6deltaD3Ex6

The sequence of this isoform differs from the canonical sequence as follows:
     261-383: Missing.

Note: Lacks the third SRCR domain and doesn't bind ALCAM/CD166. Doesn't localize to the immunological synapse.
Show »
Length:545
Mass (Da):58,283
Checksum:i54FA60E898D7DF82
GO
Isoform 7 (identifier: P30203-7) [UniParc]FASTAAdd to basket
Also known as: CD6deltaD3

The sequence of this isoform differs from the canonical sequence as follows:
     259-359: Missing.

Note: Lacks the third SRCR domain and doesn't bind ALCAM/CD166. Doesn't localize to the immunological synapse. Constitutes the only expressed species in a small percentage of T-cells.1 Publication
Show »
Length:567
Mass (Da):60,572
Checksum:iC99852C6756B3154
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti47L → R in ABH04237 (PubMed:17371992).Curated1
Sequence conflicti463 – 468VFMLPI → GPGPAP in CAA43306 (PubMed:1919444).Curated6
Sequence conflicti613Missing in AAC51162 (PubMed:9013954).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_059809217T → M.1 PublicationCorresponds to variant rs11230562dbSNPEnsembl.1
Natural variantiVAR_057202225R → W.Corresponds to variant rs11230563dbSNPEnsembl.1
Natural variantiVAR_060790257A → V.3 PublicationsCorresponds to variant rs2074225dbSNPEnsembl.1
Natural variantiVAR_057203271A → T.Corresponds to variant rs12360861dbSNPEnsembl.1
Natural variantiVAR_057204351S → N Adds an additional glycosylation site and impairs interaction with ALCAM. 1 PublicationCorresponds to variant rs34974368dbSNPEnsembl.1
Natural variantiVAR_057205606G → S.Corresponds to variant rs2074233dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_054245259 – 359Missing in isoform 7. 1 PublicationAdd BLAST101
Alternative sequenceiVSP_054246261 – 383Missing in isoform 6. 1 PublicationAdd BLAST123
Alternative sequenceiVSP_006221431 – 462Missing in isoform CD6B, isoform CD6C and isoform CD6D. CuratedAdd BLAST32
Alternative sequenceiVSP_006222463 – 504VFMLP…TTFYN → D in isoform CD6C and isoform CD6E. CuratedAdd BLAST42
Alternative sequenceiVSP_006223613 – 647Missing in isoform CD6D and isoform CD6E. CuratedAdd BLAST35

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U66142 mRNA. Translation: AAC51161.1.
U66143 Genomic DNA. Translation: AAC51162.1.
U66144 Genomic DNA. Translation: AAC51163.1.
U66145 mRNA. Translation: AAC51164.1.
U66146 mRNA. Translation: AAC51165.1.
AP003721 Genomic DNA. No translation available.
X60992 mRNA. Translation: CAA43306.1.
DQ786329 mRNA. Translation: ABH04237.1.
DQ786330 mRNA. Translation: ABH04238.1.
CCDSiCCDS58137.1. [P30203-5]
CCDS58138.1. [P30203-4]
CCDS7999.1. [P30203-1]
PIRiS26741.
RefSeqiNP_001241679.1. NM_001254750.1. [P30203-4]
NP_001241680.1. NM_001254751.1. [P30203-5]
NP_006716.3. NM_006725.4. [P30203-1]
XP_006718801.1. XM_006718738.1. [P30203-2]
XP_006718804.1. XM_006718741.1. [P30203-3]
XP_011543664.1. XM_011545362.1. [P30203-7]
UniGeneiHs.744366.

Genome annotation databases

EnsembliENST00000313421; ENSP00000323280; ENSG00000013725. [P30203-1]
ENST00000352009; ENSP00000340628; ENSG00000013725. [P30203-4]
ENST00000452451; ENSP00000390676; ENSG00000013725. [P30203-5]
GeneIDi923.
KEGGihsa:923.
UCSCiuc001nqq.4. human. [P30203-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U66142 mRNA. Translation: AAC51161.1.
U66143 Genomic DNA. Translation: AAC51162.1.
U66144 Genomic DNA. Translation: AAC51163.1.
U66145 mRNA. Translation: AAC51164.1.
U66146 mRNA. Translation: AAC51165.1.
AP003721 Genomic DNA. No translation available.
X60992 mRNA. Translation: CAA43306.1.
DQ786329 mRNA. Translation: ABH04237.1.
DQ786330 mRNA. Translation: ABH04238.1.
CCDSiCCDS58137.1. [P30203-5]
CCDS58138.1. [P30203-4]
CCDS7999.1. [P30203-1]
PIRiS26741.
RefSeqiNP_001241679.1. NM_001254750.1. [P30203-4]
NP_001241680.1. NM_001254751.1. [P30203-5]
NP_006716.3. NM_006725.4. [P30203-1]
XP_006718801.1. XM_006718738.1. [P30203-2]
XP_006718804.1. XM_006718741.1. [P30203-3]
XP_011543664.1. XM_011545362.1. [P30203-7]
UniGeneiHs.744366.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5A2EX-ray3.15A1-364[»]
ProteinModelPortaliP30203.
SMRiP30203.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107361. 6 interactors.
DIPiDIP-43704N.
IntActiP30203. 7 interactors.
MINTiMINT-1351620.
STRINGi9606.ENSP00000323280.

PTM databases

iPTMnetiP30203.
PhosphoSitePlusiP30203.

Polymorphism and mutation databases

BioMutaiCD6.
DMDMi281185506.

Proteomic databases

PaxDbiP30203.
PeptideAtlasiP30203.
PRIDEiP30203.

Protocols and materials databases

DNASUi923.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000313421; ENSP00000323280; ENSG00000013725. [P30203-1]
ENST00000352009; ENSP00000340628; ENSG00000013725. [P30203-4]
ENST00000452451; ENSP00000390676; ENSG00000013725. [P30203-5]
GeneIDi923.
KEGGihsa:923.
UCSCiuc001nqq.4. human. [P30203-1]

Organism-specific databases

CTDi923.
DisGeNETi923.
GeneCardsiCD6.
H-InvDBHIX0009678.
HGNCiHGNC:1691. CD6.
HPAiCAB002489.
CAB016252.
MIMi186720. gene.
neXtProtiNX_P30203.
OpenTargetsiENSG00000013725.
PharmGKBiPA26230.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IK9E. Eukaryota.
ENOG410YC2B. LUCA.
GeneTreeiENSGT00840000129699.
HOGENOMiHOG000137917.
HOVERGENiHBG005289.
InParanoidiP30203.
KOiK06456.
OMAiRFQMPPL.
OrthoDBiEOG091G0DF7.
PhylomeDBiP30203.
TreeFamiTF329295.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000013725-MONOMER.

Miscellaneous databases

GeneWikiiCD6.
GenomeRNAii923.
PROiP30203.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000013725.
CleanExiHS_CD6.
ExpressionAtlasiP30203. baseline and differential.
GenevisibleiP30203. HS.

Family and domain databases

Gene3Di3.10.250.10. 3 hits.
InterProiIPR001190. SRCR.
IPR017448. SRCR-like_dom.
[Graphical view]
PfamiPF00530. SRCR. 3 hits.
[Graphical view]
PRINTSiPR00258. SPERACTRCPTR.
SMARTiSM00202. SR. 3 hits.
[Graphical view]
SUPFAMiSSF56487. SSF56487. 3 hits.
PROSITEiPS00420. SRCR_1. 1 hit.
PS50287. SRCR_2. 3 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCD6_HUMAN
AccessioniPrimary (citable) accession number: P30203
Secondary accession number(s): A4KAD4
, A4KAD5, Q9UMF2, Q9Y4K7, Q9Y4K8, Q9Y4K9, Q9Y4L0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 1, 1993
Last sequence update: December 15, 2009
Last modified: November 2, 2016
This is version 144 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.