Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

T-cell differentiation antigen CD6

Gene

CD6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Cell adhesion molecule that mediates cell-cell contacts and regulates T-cell responses via its interaction with ALCAM/CD166 (PubMed:15048703, PubMed:15294938, PubMed:16352806, PubMed:16914752, PubMed:24945728, PubMed:24584089). Contributes to signaling cascades triggered by activation of the TCR/CD3 complex (PubMed:24584089). Functions as costimulatory molecule; promotes T-cell activation and proliferation (PubMed:15294938, PubMed:16352806, PubMed:16914752). Contributes to the formation and maturation of the immunological synapse (PubMed:15294938, PubMed:16352806). Functions as calcium-dependent pattern receptor that binds and aggregates both Gram-positive and Gram-negative bacteria. Binds both lipopolysaccharide (LPS) from Gram-negative bacteria and lipoteichoic acid from Gram-positive bacteria (PubMed:17601777). LPS binding leads to the activation of signaling cascades and down-stream MAP kinases (PubMed:17601777). Mediates activation of the inflammatory response and the secretion of pro-inflammatory cytokines in response to LPS (PubMed:17601777).7 Publications

GO - Molecular functioni

  • lipopolysaccharide binding Source: UniProtKB
  • lipoteichoic acid binding Source: UniProtKB
  • scavenger receptor activity Source: InterPro

GO - Biological processi

  • acute inflammatory response to antigenic stimulus Source: UniProtKB
  • adaptive immune response Source: UniProtKB-KW
  • heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules Source: UniProtKB
  • immunological synapse formation Source: UniProtKB
  • innate immune response Source: UniProtKB-KW
  • lipopolysaccharide-mediated signaling pathway Source: UniProtKB
  • positive regulation of cytokine production involved in inflammatory response Source: UniProtKB
  • positive regulation of T cell proliferation Source: UniProtKB
  • response to lipopolysaccharide Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Adaptive immunity, Cell adhesion, Immunity, Innate immunity

Names & Taxonomyi

Protein namesi
Recommended name:
T-cell differentiation antigen CD6
Alternative name(s):
T12
TP120
CD_antigen: CD6
Cleaved into the following chain:
Gene namesi
Name:CD6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:1691. CD6.

Subcellular locationi

Soluble CD6 :

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini18 – 402385ExtracellularSequence analysisAdd
BLAST
Transmembranei403 – 42321HelicalSequence analysisAdd
BLAST
Topological domaini424 – 668245CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

  • extracellular region Source: UniProtKB-SubCell
  • immunological synapse Source: UniProtKB
  • integral component of plasma membrane Source: ProtInc
  • intrinsic component of plasma membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi291 – 2911D → A: Strongly reduces interaction with ALCAM. 1 Publication
Mutagenesisi293 – 2931E → A: Reduces interaction with ALCAM. 1 Publication
Mutagenesisi295 – 2951Y → A: Abolishes interaction with ALCAM. 1 Publication
Mutagenesisi298 – 2981E → A: Nearly abolishes interaction with ALCAM. 1 Publication
Mutagenesisi314 – 3141R → A: Reduces interaction with ALCAM. 1 Publication
Mutagenesisi327 – 3271Y → A: Nearly abolishes interaction with ALCAM. 1 Publication
Mutagenesisi329 – 3291S → A: Reduces interaction with ALCAM. 1 Publication
Mutagenesisi346 – 3461N → A: Strongly reduces interaction with ALCAM. 1 Publication
Mutagenesisi349 – 3491L → A: Reduces interaction with ALCAM. 1 Publication
Mutagenesisi352 – 3521Q → A: Reduces interaction with ALCAM. 1 Publication
Mutagenesisi353 – 3531S → A: Reduces interaction with ALCAM. 1 Publication
Mutagenesisi662 – 6621Y → F: Reduces tyrosine phosphorylation. Reduces affinity for LCP2. Impairs activation of T-cells. 1 Publication

Organism-specific databases

PharmGKBiPA26230.

Polymorphism and mutation databases

BioMutaiCD6.
DMDMi281185506.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1717Sequence analysisAdd
BLAST
Chaini18 – 668651T-cell differentiation antigen CD6PRO_0000033227Add
BLAST
Chaini18 – ?Soluble CD6PRO_0000435133

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi28 – 281N-linked (GlcNAc...)Sequence analysis1 Publication
Glycosylationi49 – 491N-linked (GlcNAc...)Sequence analysis1 Publication
Disulfide bondi54 ↔ 88Combined sources1 Publication
Disulfide bondi70 ↔ 144PROSITE-ProRule annotationCombined sources1 Publication
Disulfide bondi83 ↔ 155PROSITE-ProRule annotationCombined sources1 Publication
Glycosylationi112 – 1121N-linked (GlcNAc...)Sequence analysis
Glycosylationi118 – 1181N-linked (GlcNAc...)Sequence analysis
Disulfide bondi129 ↔ 137PROSITE-ProRule annotationCombined sources1 Publication
Disulfide bondi170 ↔ 204Combined sources1 Publication
Disulfide bondi186 ↔ 249PROSITE-ProRule annotationCombined sources1 Publication
Disulfide bondi199 ↔ 259PROSITE-ProRule annotationCombined sources1 Publication
Glycosylationi229 – 2291N-linked (GlcNAc...)Sequence analysis1 Publication
Disulfide bondi230 ↔ 240PROSITE-ProRule annotationCombined sources1 Publication
Disulfide bondi290 ↔ 350PROSITE-ProRule annotationCombined sources1 Publication
Disulfide bondi303 ↔ 360PROSITE-ProRule annotationCombined sources1 Publication
Disulfide bondi330 ↔ 340PROSITE-ProRule annotationCombined sources1 Publication
Glycosylationi339 – 3391N-linked (GlcNAc...)Sequence analysis
Glycosylationi345 – 3451N-linked (GlcNAc...)Sequence analysis
Glycosylationi368 – 3681N-linked (GlcNAc...)Sequence analysis
Modified residuei662 – 6621Phosphotyrosine1 Publication

Post-translational modificationi

After T-cell activation, becomes hyperphosphorylated on Ser and Thr residues and phosphorylated on Tyr residues.4 Publications
Glycosylated.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiP30203.
PeptideAtlasiP30203.
PRIDEiP30203.

PTM databases

iPTMnetiP30203.
PhosphoSiteiP30203.

Expressioni

Tissue specificityi

Detected on thymocytes (PubMed:15294938). Detected on peripheral blood T-cells (PubMed:15048703, PubMed:16352806). Detected on natural killer (NK) cells (PubMed:16352806). Soluble CD6 is detected in blood serum (at protein level) (PubMed:17601777). Detected in spleen, thymus, appendix, lymph node and peripheral blood leukocytes (PubMed:9013954). Expressed by thymocytes, mature T-cells, a subset of B-cells known as B-1 cells, and by some cells in the brain.5 Publications

Gene expression databases

BgeeiENSG00000013725.
CleanExiHS_CD6.
ExpressionAtlasiP30203. baseline and differential.
GenevisibleiP30203. HS.

Organism-specific databases

HPAiCAB002489.
CAB016252.

Interactioni

Subunit structurei

Interacts (via extracellular domain) with ALCAM/CD166 (via extracellular domain) (PubMed:15048703, PubMed:16352806, PubMed:16914752, PubMed:24945728, PubMed:26146185). Interacts with the TCR/CD3 complex subunit CD3E (PubMed:15294938). Interacts (via tyrosine phosphorylated C-terminus) with LCP2 (via SH2 domain) (PubMed:16914752). Interacts with VAV1 (By similarity). Interacts (via glycosylated extracellular domain) with LGALS1 and LGALS3 (PubMed:24945728). Interaction with LGALS1 or LGALS3 inhibits interaction with ALCAM (PubMed:24945728).By similarity6 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
ALCAMQ137402EBI-2873748,EBI-1188108
LGALS1P093822EBI-2873748,EBI-1048875
LGALS3P179312EBI-2873748,EBI-1170392

Protein-protein interaction databases

BioGridi107361. 6 interactions.
DIPiDIP-43704N.
IntActiP30203. 7 interactions.
MINTiMINT-1351620.
STRINGi9606.ENSP00000323280.

Structurei

Secondary structure

1
668
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi45 – 528Combined sources
Beta strandi55 – 606Combined sources
Helixi76 – 8611Combined sources
Beta strandi90 – 978Combined sources
Beta strandi126 – 1349Combined sources
Beta strandi137 – 1426Combined sources
Beta strandi146 – 1483Combined sources
Beta strandi150 – 1556Combined sources
Beta strandi159 – 16810Combined sources
Beta strandi171 – 18010Combined sources
Beta strandi182 – 1876Combined sources
Helixi192 – 20211Combined sources
Beta strandi206 – 2094Combined sources
Beta strandi223 – 2286Combined sources
Beta strandi235 – 2373Combined sources
Beta strandi247 – 2493Combined sources
Helixi251 – 2533Combined sources
Beta strandi256 – 2594Combined sources
Beta strandi264 – 2729Combined sources
Beta strandi275 – 2828Combined sources
Beta strandi285 – 2917Combined sources
Helixi296 – 30611Combined sources
Beta strandi310 – 3134Combined sources
Beta strandi325 – 3295Combined sources
Helixi337 – 3393Combined sources
Beta strandi340 – 3456Combined sources
Turni347 – 3493Combined sources
Beta strandi350 – 3523Combined sources
Beta strandi357 – 3637Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
5A2EX-ray3.15A1-364[»]
ProteinModelPortaliP30203.
SMRiP30203. Positions 7-364.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini45 – 156112SRCR 1PROSITE-ProRule annotationAdd
BLAST
Domaini161 – 260100SRCR 2PROSITE-ProRule annotationAdd
BLAST
Domaini265 – 36197SRCR 3PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 3 SRCR domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IK9E. Eukaryota.
ENOG410YC2B. LUCA.
GeneTreeiENSGT00840000129699.
HOGENOMiHOG000137917.
HOVERGENiHBG005289.
InParanoidiP30203.
KOiK06456.
OMAiRFQMPPL.
OrthoDBiEOG091G0DF7.
PhylomeDBiP30203.
TreeFamiTF329295.

Family and domain databases

Gene3Di3.10.250.10. 3 hits.
InterProiIPR001190. SRCR.
IPR017448. SRCR-like_dom.
[Graphical view]
PfamiPF00530. SRCR. 3 hits.
[Graphical view]
PRINTSiPR00258. SPERACTRCPTR.
SMARTiSM00202. SR. 3 hits.
[Graphical view]
SUPFAMiSSF56487. SSF56487. 3 hits.
PROSITEiPS00420. SRCR_1. 1 hit.
PS50287. SRCR_2. 3 hits.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform CD6A (identifier: P30203-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MWLFFGITGL LTAALSGHPS PAPPDQLNTS SAESELWEPG ERLPVRLTNG
60 70 80 90 100
SSSCSGTVEV RLEASWEPAC GALWDSRAAE AVCRALGCGG AEAASQLAPP
110 120 130 140 150
TPELPPPPAA GNTSVAANAT LAGAPALLCS GAEWRLCEVV EHACRSDGRR
160 170 180 190 200
ARVTCAENRA LRLVDGGGAC AGRVEMLEHG EWGSVCDDTW DLEDAHVVCR
210 220 230 240 250
QLGCGWAVQA LPGLHFTPGR GPIHRDQVNC SGAEAYLWDC PGLPGQHYCG
260 270 280 290 300
HKEDAGAVCS EHQSWRLTGG ADRCEGQVEV HFRGVWNTVC DSEWYPSEAK
310 320 330 340 350
VLCQSLGCGT AVERPKGLPH SLSGRMYYSC NGEELTLSNC SWRFNNSNLC
360 370 380 390 400
SQSLAARVLC SASRSLHNLS TPEVPASVQT VTIESSVTVK IENKESRELM
410 420 430 440 450
LLIPSIVLGI LLLGSLIFIA FILLRIKGKY ALPVMVNHQH LPTTIPAGSN
460 470 480 490 500
SYQPVPITIP KEVFMLPIQV QAPPPEDSDS GSDSDYEHYD FSAQPPVALT
510 520 530 540 550
TFYNSQRHRV TDEEVQQSRF QMPPLEEGLE ELHASHIPTA NPGHCITDPP
560 570 580 590 600
SLGPQYHPRS NSESSTSSGE DYCNSPKSKL PPWNPQVFSS ERSSFLEQPP
610 620 630 640 650
NLELAGTQPA FSAGPPADDS SSTSSGEWYQ NFQPPPQPPS EEQFGCPGSP
660
SPQPDSTDND DYDDISAA
Length:668
Mass (Da):71,801
Last modified:December 15, 2009 - v3
Checksum:i59E6790E77FFBC42
GO
Isoform CD6B (identifier: P30203-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     431-462: Missing.

Show »
Length:636
Mass (Da):68,368
Checksum:i8EC9117BF4AAD154
GO
Isoform CD6C (identifier: P30203-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     431-462: Missing.
     463-504: VFMLPIQVQAPPPEDSDSGSDSDYEHYDFSAQPPVALTTFYN → D

Show »
Length:595
Mass (Da):63,824
Checksum:i04D85EE0DBB4A885
GO
Isoform CD6D (identifier: P30203-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     431-462: Missing.
     613-647: Missing.

Show »
Length:601
Mass (Da):64,663
Checksum:i0D8DCC42B53BDA2E
GO
Isoform CD6E (identifier: P30203-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     463-504: VFMLPIQVQAPPPEDSDSGSDSDYEHYDFSAQPPVALTTFYN → D
     613-647: Missing.

Show »
Length:592
Mass (Da):63,552
Checksum:i504C102257DA7B3C
GO
Isoform 6 (identifier: P30203-6) [UniParc]FASTAAdd to basket
Also known as: CD6deltaD3Ex6

The sequence of this isoform differs from the canonical sequence as follows:
     261-383: Missing.

Note: Lacks the third SRCR domain and doesn't bind ALCAM/CD166. Doesn't localize to the immunological synapse.
Show »
Length:545
Mass (Da):58,283
Checksum:i54FA60E898D7DF82
GO
Isoform 7 (identifier: P30203-7) [UniParc]FASTAAdd to basket
Also known as: CD6deltaD3

The sequence of this isoform differs from the canonical sequence as follows:
     259-359: Missing.

Note: Lacks the third SRCR domain and doesn't bind ALCAM/CD166. Doesn't localize to the immunological synapse. Constitutes the only expressed species in a small percentage of T-cells.1 Publication
Show »
Length:567
Mass (Da):60,572
Checksum:iC99852C6756B3154
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti47 – 471L → R in ABH04237 (PubMed:17371992).Curated
Sequence conflicti463 – 4686VFMLPI → GPGPAP in CAA43306 (PubMed:1919444).Curated
Sequence conflicti613 – 6131Missing in AAC51162 (PubMed:9013954).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti217 – 2171T → M.1 Publication
Corresponds to variant rs11230562 [ dbSNP | Ensembl ].
VAR_059809
Natural varianti225 – 2251R → W.
Corresponds to variant rs11230563 [ dbSNP | Ensembl ].
VAR_057202
Natural varianti257 – 2571A → V.3 Publications
Corresponds to variant rs2074225 [ dbSNP | Ensembl ].
VAR_060790
Natural varianti271 – 2711A → T.
Corresponds to variant rs12360861 [ dbSNP | Ensembl ].
VAR_057203
Natural varianti351 – 3511S → N Adds an additional glycosylation site and impairs interaction with ALCAM. 1 Publication
Corresponds to variant rs34974368 [ dbSNP | Ensembl ].
VAR_057204
Natural varianti606 – 6061G → S.
Corresponds to variant rs2074233 [ dbSNP | Ensembl ].
VAR_057205

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei259 – 359101Missing in isoform 7. 1 PublicationVSP_054245Add
BLAST
Alternative sequencei261 – 383123Missing in isoform 6. 1 PublicationVSP_054246Add
BLAST
Alternative sequencei431 – 46232Missing in isoform CD6B, isoform CD6C and isoform CD6D. CuratedVSP_006221Add
BLAST
Alternative sequencei463 – 50442VFMLP…TTFYN → D in isoform CD6C and isoform CD6E. CuratedVSP_006222Add
BLAST
Alternative sequencei613 – 64735Missing in isoform CD6D and isoform CD6E. CuratedVSP_006223Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U66142 mRNA. Translation: AAC51161.1.
U66143 Genomic DNA. Translation: AAC51162.1.
U66144 Genomic DNA. Translation: AAC51163.1.
U66145 mRNA. Translation: AAC51164.1.
U66146 mRNA. Translation: AAC51165.1.
AP003721 Genomic DNA. No translation available.
X60992 mRNA. Translation: CAA43306.1.
DQ786329 mRNA. Translation: ABH04237.1.
DQ786330 mRNA. Translation: ABH04238.1.
CCDSiCCDS58137.1. [P30203-5]
CCDS58138.1. [P30203-4]
CCDS7999.1. [P30203-1]
PIRiS26741.
RefSeqiNP_001241679.1. NM_001254750.1. [P30203-4]
NP_001241680.1. NM_001254751.1. [P30203-5]
NP_006716.3. NM_006725.4. [P30203-1]
XP_006718801.1. XM_006718738.1. [P30203-2]
XP_006718804.1. XM_006718741.1. [P30203-3]
XP_011543664.1. XM_011545362.1. [P30203-7]
UniGeneiHs.744366.

Genome annotation databases

EnsembliENST00000313421; ENSP00000323280; ENSG00000013725. [P30203-1]
ENST00000352009; ENSP00000340628; ENSG00000013725. [P30203-4]
ENST00000452451; ENSP00000390676; ENSG00000013725. [P30203-5]
GeneIDi923.
KEGGihsa:923.
UCSCiuc001nqq.4. human. [P30203-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U66142 mRNA. Translation: AAC51161.1.
U66143 Genomic DNA. Translation: AAC51162.1.
U66144 Genomic DNA. Translation: AAC51163.1.
U66145 mRNA. Translation: AAC51164.1.
U66146 mRNA. Translation: AAC51165.1.
AP003721 Genomic DNA. No translation available.
X60992 mRNA. Translation: CAA43306.1.
DQ786329 mRNA. Translation: ABH04237.1.
DQ786330 mRNA. Translation: ABH04238.1.
CCDSiCCDS58137.1. [P30203-5]
CCDS58138.1. [P30203-4]
CCDS7999.1. [P30203-1]
PIRiS26741.
RefSeqiNP_001241679.1. NM_001254750.1. [P30203-4]
NP_001241680.1. NM_001254751.1. [P30203-5]
NP_006716.3. NM_006725.4. [P30203-1]
XP_006718801.1. XM_006718738.1. [P30203-2]
XP_006718804.1. XM_006718741.1. [P30203-3]
XP_011543664.1. XM_011545362.1. [P30203-7]
UniGeneiHs.744366.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
5A2EX-ray3.15A1-364[»]
ProteinModelPortaliP30203.
SMRiP30203. Positions 7-364.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107361. 6 interactions.
DIPiDIP-43704N.
IntActiP30203. 7 interactions.
MINTiMINT-1351620.
STRINGi9606.ENSP00000323280.

PTM databases

iPTMnetiP30203.
PhosphoSiteiP30203.

Polymorphism and mutation databases

BioMutaiCD6.
DMDMi281185506.

Proteomic databases

PaxDbiP30203.
PeptideAtlasiP30203.
PRIDEiP30203.

Protocols and materials databases

DNASUi923.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000313421; ENSP00000323280; ENSG00000013725. [P30203-1]
ENST00000352009; ENSP00000340628; ENSG00000013725. [P30203-4]
ENST00000452451; ENSP00000390676; ENSG00000013725. [P30203-5]
GeneIDi923.
KEGGihsa:923.
UCSCiuc001nqq.4. human. [P30203-1]

Organism-specific databases

CTDi923.
GeneCardsiCD6.
H-InvDBHIX0009678.
HGNCiHGNC:1691. CD6.
HPAiCAB002489.
CAB016252.
MIMi186720. gene.
neXtProtiNX_P30203.
PharmGKBiPA26230.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IK9E. Eukaryota.
ENOG410YC2B. LUCA.
GeneTreeiENSGT00840000129699.
HOGENOMiHOG000137917.
HOVERGENiHBG005289.
InParanoidiP30203.
KOiK06456.
OMAiRFQMPPL.
OrthoDBiEOG091G0DF7.
PhylomeDBiP30203.
TreeFamiTF329295.

Miscellaneous databases

GeneWikiiCD6.
GenomeRNAii923.
PROiP30203.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000013725.
CleanExiHS_CD6.
ExpressionAtlasiP30203. baseline and differential.
GenevisibleiP30203. HS.

Family and domain databases

Gene3Di3.10.250.10. 3 hits.
InterProiIPR001190. SRCR.
IPR017448. SRCR-like_dom.
[Graphical view]
PfamiPF00530. SRCR. 3 hits.
[Graphical view]
PRINTSiPR00258. SPERACTRCPTR.
SMARTiSM00202. SR. 3 hits.
[Graphical view]
SUPFAMiSSF56487. SSF56487. 3 hits.
PROSITEiPS00420. SRCR_1. 1 hit.
PS50287. SRCR_2. 3 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCD6_HUMAN
AccessioniPrimary (citable) accession number: P30203
Secondary accession number(s): A4KAD4
, A4KAD5, Q9UMF2, Q9Y4K7, Q9Y4K8, Q9Y4K9, Q9Y4L0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 1, 1993
Last sequence update: December 15, 2009
Last modified: September 7, 2016
This is version 142 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.