P30154 (2AAB_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 127.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform Alternative name(s): PP2A subunit A isoform PR65-beta PP2A subunit A isoform R1-beta | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 601 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | The PR65 subunit of protein phosphatase 2A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit. |
| Subunit structure | PP2A consists of a common heterodimeric core enzyme, composed of a 36 kDa catalytic subunit (subunit C) and a 65 kDa constant regulatory subunit (PR65 or subunit A), that associates with a variety of regulatory subunits. Proteins that associate with the core dimer include three families of regulatory subunits B (the R2/B/PR55/B55, R3/B''/PR72/PR130/PR59 and R5/B'/B56 families), the 48 kDa variable regulatory subunit, viral proteins, and cell signaling molecules. Interacts with IPO9. Interacts with SGOL1. Interacts with RAF1. Ref.10 Ref.11 Ref.12 |
| Domain | Each HEAT repeat appears to consist of two alpha helices joined by a hydrophilic region, the intrarepeat loop. The repeat units may be arranged laterally to form a rod-like structure. |
| Sequence similarities | Belongs to the phosphatase 2A regulatory subunit A family. Contains 15 HEAT repeats. |
| Sequence caution | The sequence AAA59983.1 differs from that shown. Reason: Contaminating sequence. Sequence of unknown origin in the N-terminal part. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | positive regulation of extrinsic apoptotic signaling pathway in absence of ligand Inferred from mutant phenotype PubMed 21172653. Source: UniProtKB |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| Clock | O08785 | 2 | EBI-357094,EBI-79859 | From a different organism. |
| PPP2CA | P67775 | 6 | EBI-357094,EBI-712311 | |
| PPP2R2A | P63151 | 2 | EBI-357094,EBI-1048931 | |
| PPP2R5A | Q15172 | 2 | EBI-357094,EBI-641666 | |
| PPP2R5D | Q14738 | 2 | EBI-357094,EBI-396563 | |
| PPP2R5E | Q16537 | 3 | EBI-357094,EBI-968374 | |
| RALA | P11233 | 6 | EBI-357094,EBI-1036803 | |
| Unc5b | O08722 | 4 | EBI-357094,EBI-4404185 | From a different organism. |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P30154-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P30154-2) The sequence of this isoform differs from the canonical sequence as follows: 598-601: LALA → VAQRLRKLEFPVKDSGEPSVPRADKNHFPRPTVPGEDMGKGPVYQLRGDTRDTLAQLGIAELVHFSQSTD | ||||||
| Isoform 3 (identifier: P30154-3) The sequence of this isoform differs from the canonical sequence as follows: 39-102: Missing. 598-601: LALA → VAQRLRKLEFPVKDSGEPSVPRADKNHFPRPTVPGEDMGKGPVYQLRGDTRDTLAQLGIAELVHFSQSTD | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: P30154-4) The sequence of this isoform differs from the canonical sequence as follows: 344-388: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 601 | 601 | Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform | PRO_0000071403 | |||||
Regions | |||||||||
| Repeat | 20 – 58 | 39 | HEAT 1 | ||||||
| Repeat | 59 – 96 | 38 | HEAT 2 | ||||||
| Repeat | 97 – 135 | 39 | HEAT 3 | ||||||
| Repeat | 136 – 173 | 38 | HEAT 4 | ||||||
| Repeat | 174 – 212 | 39 | HEAT 5 | ||||||
| Repeat | 213 – 251 | 39 | HEAT 6 | ||||||
| Repeat | 252 – 290 | 39 | HEAT 7 | ||||||
| Repeat | 291 – 333 | 43 | HEAT 8 | ||||||
| Repeat | 334 – 372 | 39 | HEAT 9 | ||||||
| Repeat | 373 – 411 | 39 | HEAT 10 | ||||||
| Repeat | 412 – 450 | 39 | HEAT 11 | ||||||
| Repeat | 451 – 489 | 39 | HEAT 12 | ||||||
| Repeat | 490 – 528 | 39 | HEAT 13 | ||||||
| Repeat | 529 – 567 | 39 | HEAT 14 | ||||||
| Repeat | 568 – 601 | 34 | HEAT 15 | ||||||
Natural variations | |||||||||
| Alternative sequence | 39 – 102 | 64 | Missing in isoform 3. | VSP_043379 | |||||
| Alternative sequence | 344 – 388 | 45 | Missing in isoform 4. | VSP_045275 | |||||
| Alternative sequence | 598 – 601 | 4 | LALA → VAQRLRKLEFPVKDSGEPSV PRADKNHFPRPTVPGEDMGK GPVYQLRGDTRDTLAQLGIA ELVHFSQSTD in isoform 2 and isoform 3. | VSP_036460 | |||||
| Natural variant | 8 | 1 | G → R in a lung cancer patient. Ref.2 | VAR_022895 | |||||
| Natural variant | 15 | 1 | G → A in a colorectal cancer patient. Ref.15 | VAR_022896 | |||||
| Natural variant | 65 | 1 | P → S in a lung cancer patient. Ref.2 | VAR_022897 | |||||
| Natural variant | 90 | 1 | G → D in a lung cancer patient. Ref.2 Ref.14 Ref.16 Corresponds to variant rs1805076 [ dbSNP | Ensembl ]. | VAR_006384 | |||||
| Natural variant | 101 | 1 | L → P in a colon adenocarcinoma. Ref.2 | VAR_022898 | |||||
| Natural variant | 343 | 1 | K → E in a lung cancer patient. Ref.2 | VAR_022899 | |||||
| Natural variant | 365 | 1 | S → P in a colorectal cancer patient. Ref.15 | VAR_022900 | |||||
| Natural variant | 448 | 1 | V → A in a colon adenocarcinoma. Ref.2 | VAR_022901 | |||||
| Natural variant | 498 | 1 | V → E in a colorectal cancer patient. Ref.15 | VAR_022902 | |||||
| Natural variant | 499 | 1 | L → I in a colorectal cancer patient. Ref.15 | VAR_022903 | |||||
| Natural variant | 500 | 1 | V → G in a colorectal cancer patient. Ref.15 | VAR_022904 | |||||
| Natural variant | 504 | 1 | D → G in a lung cancer patient. Ref.2 | VAR_022905 | |||||
| Natural variant | 545 | 1 | V → A in a colon adenocarcinoma. Ref.2 | VAR_022906 | |||||
Experimental info | |||||||||
| Sequence conflict | 74 | 1 | E → V in AAA59983. Ref.9 | ||||||
| Sequence conflict | 178 | 1 | I → T in AAC63525. Ref.1 | ||||||
| Sequence conflict | 178 | 1 | I → T in AAG39644. Ref.3 | ||||||
| Sequence conflict | 178 | 1 | I → T in AAA59983. Ref.9 | ||||||
| Sequence conflict | 211 | 1 | D → G in BAG57867. Ref.4 | ||||||
| Sequence conflict | 411 | 1 | Q → R in AAA59983. Ref.9 | ||||||
| Sequence conflict | 503 | 1 | N → S in BAG57867. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Genomic organization and precise physical location of protein phosphatase 2A regulatory subunit A beta isoform gene on chromosome band 11q23." Baysal B.E., Farr J.E., Goss J.R., Devlin B., Richard C.W. III Gene 217:107-116(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [2] | "Alterations of the PPP2R1B gene in human lung and colon cancer." Wang S.S., Esplin E.D., Li J.L., Huang L., Gazdar A., Minna J., Evans G.A. Science 282:284-287(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS ARG-8; SER-65; ASP-90; PRO-101; GLU-343; ALA-448; GLY-504 AND ALA-545. |
| [3] | "A high-resolution integrated map spanning the SDHD gene at 11q23: a 1.1-Mb BAC contig, a partial transcript map and 15 new repeat polymorphisms in a tumour-suppressor region." Baysal B.E., Willett-Brozick J.E., Taschner P.E.M., Dauwerse J.G., Devilee P., Devlin B. Eur. J. Hum. Genet. 9:121-129(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4). Tissue: Brain and Testis. |
| [5] | NHLBI resequencing and genotyping service (RS&G) Submitted (FEB-2007) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [6] | "Human chromosome 11 DNA sequence and analysis including novel gene identification." Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. Sakaki Y.Nature 440:497-500(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Testis. |
| [9] | "Alpha- and beta-forms of the 65-kDa subunit of protein phosphatase 2A have a similar 39 amino acid repeating structure." Hemmings B.A., Adams-Pearson C., Maurer F., Mueller P., Goris J., Merlevede W., Hofsteenge J., Stone S.R. Biochemistry 29:3166-3173(1990) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 31-601 (ISOFORM 1). |
| [10] | "Raf-1-associated protein phosphatase 2A as a positive regulator of kinase activation." Abraham D., Podar K., Pacher M., Kubicek M., Welzel N., Hemmings B.A., Dilworth S.M., Mischak H., Kolch W., Baccarini M. J. Biol. Chem. 275:22300-22304(2000) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH RAF1. |
| [11] | "Interaction between protein phosphatase 2A and members of the importin beta superfamily." Lubert E.J., Sarge K.D. Biochem. Biophys. Res. Commun. 303:908-913(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH IPO9. |
| [12] | "Shugoshin collaborates with protein phosphatase 2A to protect cohesin." Kitajima T.S., Sakuno T., Ishiguro K., Iemura S., Natsume T., Kawashima S.A., Watanabe Y. Nature 441:46-52(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SGOL1. |
| [13] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [14] | "Absence of PPP2R1B gene alterations in primary ovarian cancers." Campbell I.G., Manolitsas T. Oncogene 18:6367-6369(1999) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT ASP-90. |
| [15] | "Alterations of the PPP2R1B gene located at 11q23 in human colorectal cancers." Takagi Y., Futamura M., Yamaguchi K., Aoki S., Takahashi T., Saji S. Gut 47:268-271(2000) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS ALA-15; PRO-365; GLU-498; ILE-499 AND GLY-500. |
| [16] | "Alterations in the suppressor gene PPP2R1B in parathyroid hyperplasias and adenomas." Hemmer S., Wasenius V.M., Haglund C., Zhu Y., Knuutila S., Franssila K., Joensuu H. Cancer Genet. Cytogenet. 134:13-17(2002) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT ASP-90. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF083439 AF083438 Genomic DNA. Translation: AAC63525.1.AF087438 mRNA. Translation: AAC69624.1. AF163473 mRNA. Translation: AAG39644.1. AK294716 mRNA. Translation: BAG57867.1. AK301705 mRNA. Translation: BAG63177.1. EF445011 Genomic DNA. Translation: ACA06046.1. EF445011 Genomic DNA. Translation: ACA06047.1. AP000925 Genomic DNA. No translation available. AP001781 Genomic DNA. No translation available. CH471065 Genomic DNA. Translation: EAW67150.1. CH471065 Genomic DNA. Translation: EAW67151.1. BC027596 mRNA. Translation: AAH27596.1. M65254 mRNA. Translation: AAA59983.1. Sequence problems. |
| IPI | IPI00294178. IPI00335449. IPI00910814. IPI00939356. |
| PIR | B34541. |
| RefSeq | NP_001171033.1. NM_001177562.1. NP_001171034.1. NM_001177563.1. NP_002707.3. NM_002716.4. NP_859050.1. NM_181699.2. NP_859051.1. NM_181700.1. |
| UniGene | Hs.584790. |
3D structure databases | |
| ProteinModelPortal | P30154. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P30154. 60 interactions. |
| MINT | MINT-1150161. |
| STRING | 9606.ENSP00000311344. |
PTM databases | |
| PhosphoSite | P30154. |
Polymorphism databases | |
| DMDM | 116241236. |
Proteomic databases | |
| PaxDb | P30154. |
| PRIDE | P30154. |
Protocols and materials databases | |
| DNASU | 5519. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000311129; ENSP00000311344; ENSG00000137713. ENST00000341980; ENSP00000343317; ENSG00000137713. ENST00000426998; ENSP00000410671; ENSG00000137713. ENST00000527614; ENSP00000437193; ENSG00000137713. ENST00000571902; ENSP00000459644; ENSG00000262764. ENST00000571959; ENSP00000459838; ENSG00000262764. ENST00000575443; ENSP00000459827; ENSG00000262764. ENST00000576276; ENSP00000461254; ENSG00000262764. |
| GeneID | 5519. |
| KEGG | hsa:5519. |
| UCSC | uc001plw.1. human. uc001plx.1. human. |
Organism-specific databases | |
| CTD | 5519. |
| GeneCards | GC11M111618. |
| HGNC | HGNC:9303. PPP2R1B. |
| HPA | CAB004034. HPA018908. |
| MIM | 603113. gene. |
| neXtProt | NX_P30154. |
| PharmGKB | PA33667. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG247268. |
| HOGENOM | HOG000078539. |
| HOVERGEN | HBG000011. |
| KO | K03456. |
| OMA | HVNTRDT. |
Enzyme and pathway databases | |
| Reactome | REACT_111102. Signal Transduction. REACT_111217. Metabolism. REACT_115566. Cell Cycle. REACT_21300. Mitotic M-M/G1 phases. REACT_604. Hemostasis. REACT_6782. TRAF6 Mediated Induction of proinflammatory cytokines. REACT_6900. Immune System. |
Gene expression databases | |
| ArrayExpress | P30154. |
| Bgee | P30154. |
| CleanEx | HS_PPP2R1B. |
| Genevestigator | P30154. |
| GermOnline | ENSG00000137713. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.25.10.10. 1 hit. |
| InterPro | IPR011989. ARM-like. IPR016024. ARM-type_fold. IPR000357. HEAT. IPR021133. HEAT_type_2. [Graphical view] |
| Pfam | PF02985. HEAT. 2 hits. [Graphical view] |
| SUPFAM | SSF48371. ARM-type_fold. 1 hit. |
| PROSITE | PS50077. HEAT_REPEAT. 12 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | PPP2R1B. human. |
| GenomeRNAi | 5519. |
| NextBio | 21346. |
| SOURCE | Search... |
Entry information
| Entry name | 2AAB_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P30154 Secondary accession number(s): B0YJ69 Q8NHV8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
