Reviewed,
UniProtKB/Swiss-Prot P30154 (2AAB_HUMAN)
Last modified
November 3, 2009.
Version 92.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform Alternative name(s): PP2A, subunit A, PR65-beta isoform PP2A, subunit A, R1-beta isoform | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Complete proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 601 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | The PR65 subunit of protein phosphatase 2A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit. |
| Subunit structure | PP2A consists of a common heterodimeric core enzyme, composed of a 36 kDa catalytic subunit (subunit C) and a 65 kDa constant regulatory subunit (PR65 or subunit A), that associates with a variety of regulatory subunits. Proteins that associate with the core dimer include three families of regulatory subunits B (the R2/B/PR55/B55, R3/B''/PR72/PR130/PR59 and R5/B'/B56 families), the 48 kDa variable regulatory subunit, viral proteins, and cell signaling molecules. Interacts with IPO9. Interacts with SGOL1. Ref.9 Ref.10 |
| Domain | Each HEAT repeat appears to consist of two alpha helices joined by a hydrophilic region, the intrarepeat loop. The repeat units may be arranged laterally to form a rod-like structure. |
| Involvement in disease | Defects in PPP2R1B might be a cause of some lung and colorectal cancers. |
| Sequence similarities | Belongs to the phosphatase 2A regulatory subunit A family. Contains 15 HEAT repeats. |
| Sequence caution | The sequence AAA59983.1 differs from that shown. Reason: Miscellaneous discrepancy. Contaminating sequence. Sequence of unknown origin in the N-terminal part. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Molecular function | antigen binding Inferred from sequence or structural similarity. Source: UniProtKB protein bindingInferred from sequence or structural similarity. Source: UniProtKB |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| PPP2CA | P67775 | 1 | EBI-357094,EBI-712311 | |
| PPP2R2A | P63151 | 1 | EBI-357094,EBI-1048931 | |
| PPP2R5A | Q15172 | 1 | EBI-357094,EBI-641666 | |
| PPP2R5C | Q13362 | 1 | EBI-357094,EBI-1266156 | |
| PPP2R5D | Q14738 | 1 | EBI-357094,EBI-396563 | |
| PPP2R5E | Q16537 | 1 | EBI-357094,EBI-968374 | |
| RALA | P11233 | 1 | EBI-357094,EBI-1036803 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P30154-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P30154-2) The sequence of this isoform differs from the canonical sequence as follows: 598-601: LALA → VAQRLRKLEFPVKDSGEPSVPRADKNHFPRPTVPGEDMGKGPVYQLRGDTRDTLAQLGIAELVHFSQSTD |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 601 | 601 | Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform | PRO_0000071403 | |||||
Regions | |||||||||
| Repeat | 20 – 58 | 39 | HEAT 1 | ||||||
| Repeat | 59 – 96 | 38 | HEAT 2 | ||||||
| Repeat | 97 – 135 | 39 | HEAT 3 | ||||||
| Repeat | 136 – 173 | 38 | HEAT 4 | ||||||
| Repeat | 174 – 212 | 39 | HEAT 5 | ||||||
| Repeat | 213 – 251 | 39 | HEAT 6 | ||||||
| Repeat | 252 – 290 | 39 | HEAT 7 | ||||||
| Repeat | 291 – 333 | 43 | HEAT 8 | ||||||
| Repeat | 334 – 372 | 39 | HEAT 9 | ||||||
| Repeat | 373 – 411 | 39 | HEAT 10 | ||||||
| Repeat | 412 – 450 | 39 | HEAT 11 | ||||||
| Repeat | 451 – 489 | 39 | HEAT 12 | ||||||
| Repeat | 490 – 528 | 39 | HEAT 13 | ||||||
| Repeat | 529 – 567 | 39 | HEAT 14 | ||||||
| Repeat | 568 – 601 | 34 | HEAT 15 | ||||||
Natural variations | |||||||||
| Alternative sequence | 598 – 601 | 4 | LALA → VAQRLRKLEFPVKDSGEPSV PRADKNHFPRPTVPGEDMGK GPVYQLRGDTRDTLAQLGIA ELVHFSQSTD in isoform 2. | VSP_036460 | |||||
| Natural variant | 8 | 1 | G → R in a lung cancer patient. Ref.2 | VAR_022895 | |||||
| Natural variant | 15 | 1 | G → A in a colorectal cancer patient. Ref.13 | VAR_022896 | |||||
| Natural variant | 65 | 1 | P → S in a lung cancer patient. Ref.2 | VAR_022897 | |||||
| Natural variant | 90 | 1 | G → D in a lung cancer patient. dbSNP rs1805076. Ref.2 Ref.12 Ref.14 | VAR_006384 | |||||
| Natural variant | 101 | 1 | L → P in a colon adenocarcinoma. Ref.2 | VAR_022898 | |||||
| Natural variant | 343 | 1 | K → E in a lung cancer patient. Ref.2 | VAR_022899 | |||||
| Natural variant | 365 | 1 | S → P in a colorectal cancer patient. Ref.13 | VAR_022900 | |||||
| Natural variant | 448 | 1 | V → A in a colon adenocarcinoma. Ref.2 | VAR_022901 | |||||
| Natural variant | 498 | 1 | V → E in a colorectal cancer patient. Ref.13 | VAR_022902 | |||||
| Natural variant | 499 | 1 | L → I in a colorectal cancer patient. Ref.13 | VAR_022903 | |||||
| Natural variant | 500 | 1 | V → G in a colorectal cancer patient. Ref.13 | VAR_022904 | |||||
| Natural variant | 504 | 1 | D → G in a lung cancer patient. Ref.2 | VAR_022905 | |||||
| Natural variant | 545 | 1 | V → A in a colon adenocarcinoma. Ref.2 | VAR_022906 | |||||
Experimental info | |||||||||
| Sequence conflict | 74 | 1 | E → V in AAA59983. Ref.8 | ||||||
| Sequence conflict | 178 | 1 | I → T in AAC63525. Ref.1 | ||||||
| Sequence conflict | 178 | 1 | I → T in AAG39644. Ref.3 | ||||||
| Sequence conflict | 178 | 1 | I → T in AAA59983. Ref.8 | ||||||
| Sequence conflict | 411 | 1 | Q → R in AAA59983. Ref.8 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Genomic organization and precise physical location of protein phosphatase 2A regulatory subunit A beta isoform gene on chromosome band 11q23." Baysal B.E., Farr J.E., Goss J.R., Devlin B., Richard C.W. III Gene 217:107-116(1998) [PubMed: 9795170] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [2] | "Alterations of the PPP2R1B gene in human lung and colon cancer." Wang S.S., Esplin E.D., Li J.L., Huang L., Gazdar A., Minna J., Evans G.A. Science 282:284-287(1998) [PubMed: 9765152] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS ARG-8; SER-65; ASP-90; PRO-101; GLU-343; ALA-448; GLY-504 AND ALA-545. |
| [3] | "A high-resolution integrated map spanning the SDHD gene at 11q23: a 1.1-Mb BAC contig, a partial transcript map and 15 new repeat polymorphisms in a tumour-suppressor region." Baysal B.E., Willett-Brozick J.E., Taschner P.E.M., Dauwerse J.G., Devilee P., Devlin B. Eur. J. Hum. Genet. 9:121-129(2001) [PubMed: 11313745] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [4] | NHLBI resequencing and genotyping service (RS&G) Submitted (FEB-2007) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [5] | "Human chromosome 11 DNA sequence and analysis including novel gene identification." Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. Sakaki Y.Nature 440:497-500(2006) [PubMed: 16554811] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Testis. |
| [8] | "Alpha- and beta-forms of the 65-kDa subunit of protein phosphatase 2A have a similar 39 amino acid repeating structure." Hemmings B.A., Adams-Pearson C., Maurer F., Mueller P., Goris J., Merlevede W., Hofsteenge J., Stone S.R. Biochemistry 29:3166-3173(1990) [PubMed: 2159327] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 31-601 (ISOFORM 1). |
| [9] | "Interaction between protein phosphatase 2A and members of the importin beta superfamily." Lubert E.J., Sarge K.D. Biochem. Biophys. Res. Commun. 303:908-913(2003) [PubMed: 12670497] [Abstract] Cited for: INTERACTION WITH IPO9. |
| [10] | "Shugoshin collaborates with protein phosphatase 2A to protect cohesin." Kitajima T.S., Sakuno T., Ishiguro K., Iemura S., Natsume T., Kawashima S.A., Watanabe Y. Nature 441:46-52(2006) [PubMed: 16541025] [Abstract] Cited for: INTERACTION WITH SGOL1. |
| [11] | Colinge J., Superti-Furga G., Bennett K.L. Submitted (OCT-2008) to UniProtKB Cited for: IDENTIFICATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. |
| [12] | "Absence of PPP2R1B gene alterations in primary ovarian cancers." Campbell I.G., Manolitsas T. Oncogene 18:6367-6369(1999) [PubMed: 10597236] [Abstract] Cited for: VARIANT ASP-90. |
| [13] | "Alterations of the PPP2R1B gene located at 11q23 in human colorectal cancers." Takagi Y., Futamura M., Yamaguchi K., Aoki S., Takahashi T., Saji S. Gut 47:268-271(2000) [PubMed: 10896920] [Abstract] Cited for: VARIANTS ALA-15; PRO-365; GLU-498; ILE-499 AND GLY-500. |
| [14] | "Alterations in the suppressor gene PPP2R1B in parathyroid hyperplasias and adenomas." Hemmer S., Wasenius V.M., Haglund C., Zhu Y., Knuutila S., Franssila K., Joensuu H. Cancer Genet. Cytogenet. 134:13-17(2002) [PubMed: 11996789] [Abstract] Cited for: VARIANT ASP-90. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
AF083439 AF083438 Genomic DNA. Translation: AAC63525.1. AF087438 mRNA. Translation: AAC69624.1. AF163473 mRNA. Translation: AAG39644.1. EF445011 Genomic DNA. Translation: ACA06047.1. AP000925 Genomic DNA. No translation available. AP001781 Genomic DNA. No translation available. CH471065 Genomic DNA. Translation: EAW67151.1. BC027596 mRNA. Translation: AAH27596.1. M65254 mRNA. Translation: AAA59983.1. Sequence problems. | |
| IPI | IPI00294178. IPI00335449. |
| PIR | B34541. |
| RefSeq | NP_002707.3. NP_859050.1. |
| UniGene | Hs.584790 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1B3U based on UniProtKB P30153. |
| SMR | P30154. Positions 14-601. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P30154. 31 interactions. |
| STRING | P30154. |
Proteomic databases | |
| PRIDE | P30154. |
Genome annotation databases | |
| Ensembl | ENST00000311129; ENSP00000311344; ENSG00000137713; Homo sapiens. [Genome view] ENST00000341980; ENSP00000343317; ENSG00000137713; Homo sapiens. [Genome view] ENST00000393055; ENSP00000376775; ENSG00000137713; Homo sapiens. [Genome view] ENST00000412902; ENSP00000403301; ENSG00000137713; Homo sapiens. [Genome view] ENST00000426998; ENSP00000410671; ENSG00000137713; Homo sapiens. [Genome view] ENST00000427203; ENSP00000415759; ENSG00000137713; Homo sapiens. [Genome view] |
| GeneID | 5519. |
| KEGG | hsa:5519. |
| UCSC | uc001plw.1. human. uc001plx.1. human. |
Organism-specific databases | |
| CTD | 5519. |
| GeneCards | GC11M111102. |
| HGNC | HGNC:9303. PPP2R1B. |
| HPA | CAB004034. |
| MIM | 603113. gene. |
| PharmGKB | PA33667. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | P30154. |
| OMA | HVNTRDT. |
Enzyme and pathway databases | |
| Reactome | REACT_11045. Signaling by Wnt. REACT_11061. Signalling by NGF. REACT_1505. Integration of energy metabolism. REACT_152. Cell Cycle, Mitotic. REACT_15295. Opioid Signalling. REACT_6900. Signaling in Immune system. |
Gene expression databases | |
| ArrayExpress | P30154. |
| Bgee | P30154. |
| CleanEx | HS_PPP2R1B. |
| Genevestigator | P30154. |
| GermOnline | ENSG00000137713. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR011989. ARM-like. IPR000357. HEAT. [Graphical view] |
| Gene3D | G3DSA:1.25.10.10. ARM-like. 1 hit. |
| Pfam | PF02985. HEAT. 11 hits. [Graphical view] |
| PROSITE | PS50077. HEAT_REPEAT. 12 hits. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 21346. |
| SOURCE | Search... |
Entry information
| Entry name | 2AAB_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P30154 Secondary accession number(s): O75620, Q8NHV8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


