Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P30154

- 2AAB_HUMAN

UniProt

P30154 - 2AAB_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform

Gene

PPP2R1B

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

The PR65 subunit of protein phosphatase 2A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit.

GO - Biological processi

  1. apoptotic process involved in morphogenesis Source: UniProtKB
  2. positive regulation of extrinsic apoptotic signaling pathway in absence of ligand Source: UniProtKB
Complete GO annotation...

Enzyme and pathway databases

ReactomeiREACT_11063. Degradation of beta-catenin by the destruction complex.
REACT_11065. Beta-catenin phosphorylation cascade.
REACT_12436. ERKs are inactivated.
REACT_12599. ERK/MAPK targets.
REACT_1383. Glycolysis.
REACT_150182. MASTL Facilitates Mitotic Progression.
REACT_150425. Resolution of Sister Chromatid Cohesion.
REACT_150471. Separation of Sister Chromatids.
REACT_1505. Integration of energy metabolism.
REACT_15334. DARPP-32 events.
REACT_1857. Cyclin A/B1 associated events during G2/M transition.
REACT_19405. CTLA4 inhibitory signaling.
REACT_200610. disassembly of the destruction complex and recruitment of AXIN to the membrane.
REACT_228060. truncations of AMER1 destabilize the destruction complex.
REACT_228137. S45 mutants of beta-catenin aren't phosphorylated.
REACT_228159. S33 mutants of beta-catenin aren't phosphorylated.
REACT_228196. APC truncation mutants have impaired AXIN binding.
REACT_228251. S37 mutants of beta-catenin aren't phosphorylated.
REACT_228261. T41 mutants of beta-catenin aren't phosphorylated.
REACT_228285. AXIN missense mutants destabilize the destruction complex.
REACT_228314. misspliced GSK3beta mutants stabilize beta-catenin.
REACT_23879. Platelet sensitization by LDL.
REACT_329. Inhibition of replication initiation of damaged DNA by RB1/E2F1.
REACT_682. Mitotic Prometaphase.
REACT_705. PP2A-mediated dephosphorylation of key metabolic factors.
REACT_821. Cyclin D associated events in G1.

Names & Taxonomyi

Protein namesi
Recommended name:
Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform
Alternative name(s):
PP2A subunit A isoform PR65-beta
PP2A subunit A isoform R1-beta
Gene namesi
Name:PPP2R1B
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 11

Organism-specific databases

HGNCiHGNC:9303. PPP2R1B.

Subcellular locationi

GO - Cellular componenti

  1. extracellular vesicular exosome Source: UniProtKB
  2. membrane raft Source: UniProtKB
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA33667.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11Removed1 Publication
Chaini2 – 601600Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoformPRO_0000071403Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylalanine1 Publication

Keywords - PTMi

Acetylation

Proteomic databases

MaxQBiP30154.
PaxDbiP30154.
PRIDEiP30154.

PTM databases

PhosphoSiteiP30154.

Expressioni

Gene expression databases

BgeeiP30154.
CleanExiHS_PPP2R1B.
ExpressionAtlasiP30154. baseline and differential.
GenevestigatoriP30154.

Organism-specific databases

HPAiCAB004034.
HPA018908.

Interactioni

Subunit structurei

PP2A consists of a common heterodimeric core enzyme, composed of a 36 kDa catalytic subunit (subunit C) and a 65 kDa constant regulatory subunit (PR65 or subunit A), that associates with a variety of regulatory subunits. Proteins that associate with the core dimer include three families of regulatory subunits B (the R2/B/PR55/B55, R3/B''/PR72/PR130/PR59 and R5/B'/B56 families), the 48 kDa variable regulatory subunit, viral proteins, and cell signaling molecules. Interacts with IPO9. Interacts with SGOL1. Interacts with RAF1.3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
ClockO087852EBI-357094,EBI-79859From a different organism.
PPP2CAP677757EBI-357094,EBI-712311
PPP2R2AP631512EBI-357094,EBI-1048931
PPP2R5AQ151722EBI-357094,EBI-641666
PPP2R5CQ133622EBI-357094,EBI-1266156
PPP2R5DQ147382EBI-357094,EBI-396563
PPP2R5EQ165373EBI-357094,EBI-968374
RALAP112336EBI-357094,EBI-1036803
Unc5bO087224EBI-357094,EBI-4404185From a different organism.

Protein-protein interaction databases

BioGridi111511. 65 interactions.
IntActiP30154. 64 interactions.
MINTiMINT-1150161.
STRINGi9606.ENSP00000311344.

Structurei

3D structure databases

ProteinModelPortaliP30154.
SMRiP30154. Positions 19-601.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati20 – 5839HEAT 1Add
BLAST
Repeati59 – 9638HEAT 2Add
BLAST
Repeati97 – 13539HEAT 3Add
BLAST
Repeati136 – 17338HEAT 4Add
BLAST
Repeati174 – 21239HEAT 5Add
BLAST
Repeati213 – 25139HEAT 6Add
BLAST
Repeati252 – 29039HEAT 7Add
BLAST
Repeati291 – 33343HEAT 8Add
BLAST
Repeati334 – 37239HEAT 9Add
BLAST
Repeati373 – 41139HEAT 10Add
BLAST
Repeati412 – 45039HEAT 11Add
BLAST
Repeati451 – 48939HEAT 12Add
BLAST
Repeati490 – 52839HEAT 13Add
BLAST
Repeati529 – 56739HEAT 14Add
BLAST
Repeati568 – 60134HEAT 15Add
BLAST

Domaini

Each HEAT repeat appears to consist of two alpha helices joined by a hydrophilic region, the intrarepeat loop. The repeat units may be arranged laterally to form a rod-like structure.

Sequence similaritiesi

Contains 15 HEAT repeats.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiNOG247268.
GeneTreeiENSGT00730000110944.
HOGENOMiHOG000078539.
HOVERGENiHBG000011.
InParanoidiP30154.
KOiK03456.
OMAiNREQIIM.
OrthoDBiEOG764722.
PhylomeDBiP30154.
TreeFamiTF105552.

Family and domain databases

Gene3Di1.25.10.10. 1 hit.
InterProiIPR011989. ARM-like.
IPR016024. ARM-type_fold.
IPR000357. HEAT.
IPR021133. HEAT_type_2.
[Graphical view]
PfamiPF02985. HEAT. 2 hits.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 1 hit.
PROSITEiPS50077. HEAT_REPEAT. 12 hits.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P30154-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAGASELGTG PGAAGGDGDD SLYPIAVLID ELRNEDVQLR LNSIKKLSTI
60 70 80 90 100
ALALGVERTR SELLPFLTDT IYDEDEVLLA LAEQLGNFTG LVGGPDFAHC
110 120 130 140 150
LLPPLENLAT VEETVVRDKA VESLRQISQE HTPVALEAYF VPLVKRLASG
160 170 180 190 200
DWFTSRTSAC GLFSVCYPRA SNAVKAEIRQ QFRSLCSDDT PMVRRAAASK
210 220 230 240 250
LGEFAKVLEL DSVKSEIVPL FTSLASDEQD SVRLLAVEAC VSIAQLLSQD
260 270 280 290 300
DLETLVMPTL RQAAEDKSWR VRYMVADRFS ELQKAMGPKI TLNDLIPAFQ
310 320 330 340 350
NLLKDCEAEV RAAAAHKVKE LGENLPIEDR ETIIMNQILP YIKELVSDTN
360 370 380 390 400
QHVKSALASV IMGLSTILGK ENTIEHLLPL FLAQLKDECP DVRLNIISNL
410 420 430 440 450
DCVNEVIGIR QLSQSLLPAI VELAEDAKWR VRLAIIEYMP LLAGQLGVEF
460 470 480 490 500
FDEKLNSLCM AWLVDHVYAI REAATNNLMK LVQKFGTEWA QNTIVPKVLV
510 520 530 540 550
MANDPNYLHR MTTLFCINAL SEACGQEITT KQMLPIVLKM AGDQVANVRF
560 570 580 590 600
NVAKSLQKIG PILDTNALQG EVKPVLQKLG QDEDMDVKYF AQEAISVLAL

A
Length:601
Mass (Da):66,214
Last modified:October 17, 2006 - v3
Checksum:i86AB20D7505210B0
GO
Isoform 2 (identifier: P30154-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     598-601: LALA → VAQRLRKLEFPVKDSGEPSVPRADKNHFPRPTVPGEDMGKGPVYQLRGDTRDTLAQLGIAELVHFSQSTD

Show »
Length:667
Mass (Da):73,585
Checksum:i726EA8A8FB0DEB23
GO
Isoform 3 (identifier: P30154-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     39-102: Missing.
     598-601: LALA → VAQRLRKLEFPVKDSGEPSVPRADKNHFPRPTVPGEDMGKGPVYQLRGDTRDTLAQLGIAELVHFSQSTD

Note: No experimental confirmation available.

Show »
Length:603
Mass (Da):66,617
Checksum:i3FB011FD47C65810
GO
Isoform 4 (identifier: P30154-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     344-388: Missing.

Note: No experimental confirmation available.

Show »
Length:556
Mass (Da):61,314
Checksum:i1FFAFBC9A8C38FA2
GO
Isoform 5 (identifier: P30154-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     103-229: Missing.

Show »
Length:474
Mass (Da):52,214
Checksum:i6F8EEB7D9779BFB1
GO

Sequence cautioni

The sequence AAA59983.1 differs from that shown. Reason: Contaminating sequence. Sequence of unknown origin in the N-terminal part.Curated
The sequence BAG59103.1 differs from that shown. Reason: Frameshift at position 540. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti74 – 741E → V in AAA59983. (PubMed:2159327)Curated
Sequence conflicti178 – 1781I → T in AAC63525. (PubMed:9795170)Curated
Sequence conflicti178 – 1781I → T in AAG39644. (PubMed:11313745)Curated
Sequence conflicti178 – 1781I → T in AAA59983. (PubMed:2159327)Curated
Sequence conflicti211 – 2111D → G in BAG57867. (PubMed:14702039)Curated
Sequence conflicti411 – 4111Q → R in AAA59983. (PubMed:2159327)Curated
Sequence conflicti503 – 5031N → S in BAG57867. (PubMed:14702039)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti8 – 81G → R in a lung cancer patient. 1 Publication
Corresponds to variant rs142771326 [ dbSNP | Ensembl ].
VAR_022895
Natural varianti15 – 151G → A in a colorectal cancer patient. 1 Publication
VAR_022896
Natural varianti65 – 651P → S in a lung cancer patient. 1 Publication
VAR_022897
Natural varianti90 – 901G → D in a lung cancer patient. 3 Publications
Corresponds to variant rs1805076 [ dbSNP | Ensembl ].
VAR_006384
Natural varianti101 – 1011L → P in a colon adenocarcinoma. 1 Publication
VAR_022898
Natural varianti343 – 3431K → E in a lung cancer patient. 1 Publication
VAR_022899
Natural varianti365 – 3651S → P in a colorectal cancer patient. 1 Publication
VAR_022900
Natural varianti448 – 4481V → A in a colon adenocarcinoma. 1 Publication
VAR_022901
Natural varianti498 – 4981V → E in a colorectal cancer patient. 1 Publication
VAR_022902
Natural varianti499 – 4991L → I in a colorectal cancer patient. 1 Publication
VAR_022903
Natural varianti500 – 5001V → G in a colorectal cancer patient. 1 Publication
VAR_022904
Natural varianti504 – 5041D → G in a lung cancer patient. 1 Publication
VAR_022905
Natural varianti545 – 5451V → A in a colon adenocarcinoma. 1 Publication
VAR_022906

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei39 – 10264Missing in isoform 3. 1 PublicationVSP_043379Add
BLAST
Alternative sequencei103 – 229127Missing in isoform 5. 1 PublicationVSP_046684Add
BLAST
Alternative sequencei344 – 38845Missing in isoform 4. 1 PublicationVSP_045275Add
BLAST
Alternative sequencei598 – 6014LALA → VAQRLRKLEFPVKDSGEPSV PRADKNHFPRPTVPGEDMGK GPVYQLRGDTRDTLAQLGIA ELVHFSQSTD in isoform 2 and isoform 3. 2 PublicationsVSP_036460

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF083439
, AF083425, AF083426, AF083427, AF083428, AF083429, AF083430, AF083431, AF083432, AF083433, AF083434, AF083435, AF083436, AF083437, AF083438 Genomic DNA. Translation: AAC63525.1.
AF087438 mRNA. Translation: AAC69624.1.
AF163473 mRNA. Translation: AAG39644.1.
AK294716 mRNA. Translation: BAG57867.1.
AK296455 mRNA. Translation: BAG59103.1. Frameshift.
AK301705 mRNA. Translation: BAG63177.1.
EF445011 Genomic DNA. Translation: ACA06046.1.
EF445011 Genomic DNA. Translation: ACA06047.1.
AP000925 Genomic DNA. No translation available.
AP001781 Genomic DNA. No translation available.
CH471065 Genomic DNA. Translation: EAW67150.1.
CH471065 Genomic DNA. Translation: EAW67151.1.
BC027596 mRNA. Translation: AAH27596.1.
M65254 mRNA. Translation: AAA59983.1. Sequence problems.
CCDSiCCDS53706.1. [P30154-3]
CCDS53707.1. [P30154-5]
CCDS53708.1. [P30154-4]
CCDS8348.1. [P30154-2]
CCDS8349.1. [P30154-1]
PIRiB34541.
RefSeqiNP_001171033.1. NM_001177562.1. [P30154-4]
NP_001171034.1. NM_001177563.1. [P30154-5]
NP_002707.3. NM_002716.4. [P30154-1]
NP_859050.1. NM_181699.2. [P30154-2]
NP_859051.1. NM_181700.1. [P30154-3]
UniGeneiHs.269128.
Hs.584790.

Genome annotation databases

EnsembliENST00000311129; ENSP00000311344; ENSG00000137713. [P30154-2]
ENST00000341980; ENSP00000343317; ENSG00000137713. [P30154-4]
ENST00000393055; ENSP00000376775; ENSG00000137713. [P30154-5]
ENST00000426998; ENSP00000410671; ENSG00000137713. [P30154-3]
ENST00000527614; ENSP00000437193; ENSG00000137713. [P30154-1]
GeneIDi5519.
KEGGihsa:5519.
UCSCiuc001plw.1. human. [P30154-2]
uc001plx.1. human. [P30154-1]
uc010rwi.1. human. [P30154-3]

Polymorphism databases

DMDMi116241236.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF083439
, AF083425 , AF083426 , AF083427 , AF083428 , AF083429 , AF083430 , AF083431 , AF083432 , AF083433 , AF083434 , AF083435 , AF083436 , AF083437 , AF083438 Genomic DNA. Translation: AAC63525.1 .
AF087438 mRNA. Translation: AAC69624.1 .
AF163473 mRNA. Translation: AAG39644.1 .
AK294716 mRNA. Translation: BAG57867.1 .
AK296455 mRNA. Translation: BAG59103.1 . Frameshift.
AK301705 mRNA. Translation: BAG63177.1 .
EF445011 Genomic DNA. Translation: ACA06046.1 .
EF445011 Genomic DNA. Translation: ACA06047.1 .
AP000925 Genomic DNA. No translation available.
AP001781 Genomic DNA. No translation available.
CH471065 Genomic DNA. Translation: EAW67150.1 .
CH471065 Genomic DNA. Translation: EAW67151.1 .
BC027596 mRNA. Translation: AAH27596.1 .
M65254 mRNA. Translation: AAA59983.1 . Sequence problems.
CCDSi CCDS53706.1. [P30154-3 ]
CCDS53707.1. [P30154-5 ]
CCDS53708.1. [P30154-4 ]
CCDS8348.1. [P30154-2 ]
CCDS8349.1. [P30154-1 ]
PIRi B34541.
RefSeqi NP_001171033.1. NM_001177562.1. [P30154-4 ]
NP_001171034.1. NM_001177563.1. [P30154-5 ]
NP_002707.3. NM_002716.4. [P30154-1 ]
NP_859050.1. NM_181699.2. [P30154-2 ]
NP_859051.1. NM_181700.1. [P30154-3 ]
UniGenei Hs.269128.
Hs.584790.

3D structure databases

ProteinModelPortali P30154.
SMRi P30154. Positions 19-601.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 111511. 65 interactions.
IntActi P30154. 64 interactions.
MINTi MINT-1150161.
STRINGi 9606.ENSP00000311344.

PTM databases

PhosphoSitei P30154.

Polymorphism databases

DMDMi 116241236.

Proteomic databases

MaxQBi P30154.
PaxDbi P30154.
PRIDEi P30154.

Protocols and materials databases

DNASUi 5519.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000311129 ; ENSP00000311344 ; ENSG00000137713 . [P30154-2 ]
ENST00000341980 ; ENSP00000343317 ; ENSG00000137713 . [P30154-4 ]
ENST00000393055 ; ENSP00000376775 ; ENSG00000137713 . [P30154-5 ]
ENST00000426998 ; ENSP00000410671 ; ENSG00000137713 . [P30154-3 ]
ENST00000527614 ; ENSP00000437193 ; ENSG00000137713 . [P30154-1 ]
GeneIDi 5519.
KEGGi hsa:5519.
UCSCi uc001plw.1. human. [P30154-2 ]
uc001plx.1. human. [P30154-1 ]
uc010rwi.1. human. [P30154-3 ]

Organism-specific databases

CTDi 5519.
GeneCardsi GC11M111656.
HGNCi HGNC:9303. PPP2R1B.
HPAi CAB004034.
HPA018908.
MIMi 603113. gene.
neXtProti NX_P30154.
PharmGKBi PA33667.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG247268.
GeneTreei ENSGT00730000110944.
HOGENOMi HOG000078539.
HOVERGENi HBG000011.
InParanoidi P30154.
KOi K03456.
OMAi NREQIIM.
OrthoDBi EOG764722.
PhylomeDBi P30154.
TreeFami TF105552.

Enzyme and pathway databases

Reactomei REACT_11063. Degradation of beta-catenin by the destruction complex.
REACT_11065. Beta-catenin phosphorylation cascade.
REACT_12436. ERKs are inactivated.
REACT_12599. ERK/MAPK targets.
REACT_1383. Glycolysis.
REACT_150182. MASTL Facilitates Mitotic Progression.
REACT_150425. Resolution of Sister Chromatid Cohesion.
REACT_150471. Separation of Sister Chromatids.
REACT_1505. Integration of energy metabolism.
REACT_15334. DARPP-32 events.
REACT_1857. Cyclin A/B1 associated events during G2/M transition.
REACT_19405. CTLA4 inhibitory signaling.
REACT_200610. disassembly of the destruction complex and recruitment of AXIN to the membrane.
REACT_228060. truncations of AMER1 destabilize the destruction complex.
REACT_228137. S45 mutants of beta-catenin aren't phosphorylated.
REACT_228159. S33 mutants of beta-catenin aren't phosphorylated.
REACT_228196. APC truncation mutants have impaired AXIN binding.
REACT_228251. S37 mutants of beta-catenin aren't phosphorylated.
REACT_228261. T41 mutants of beta-catenin aren't phosphorylated.
REACT_228285. AXIN missense mutants destabilize the destruction complex.
REACT_228314. misspliced GSK3beta mutants stabilize beta-catenin.
REACT_23879. Platelet sensitization by LDL.
REACT_329. Inhibition of replication initiation of damaged DNA by RB1/E2F1.
REACT_682. Mitotic Prometaphase.
REACT_705. PP2A-mediated dephosphorylation of key metabolic factors.
REACT_821. Cyclin D associated events in G1.

Miscellaneous databases

ChiTaRSi PPP2R1B. human.
GeneWikii PPP2R1B.
GenomeRNAii 5519.
NextBioi 21346.
PROi P30154.
SOURCEi Search...

Gene expression databases

Bgeei P30154.
CleanExi HS_PPP2R1B.
ExpressionAtlasi P30154. baseline and differential.
Genevestigatori P30154.

Family and domain databases

Gene3Di 1.25.10.10. 1 hit.
InterProi IPR011989. ARM-like.
IPR016024. ARM-type_fold.
IPR000357. HEAT.
IPR021133. HEAT_type_2.
[Graphical view ]
Pfami PF02985. HEAT. 2 hits.
[Graphical view ]
SUPFAMi SSF48371. SSF48371. 1 hit.
PROSITEi PS50077. HEAT_REPEAT. 12 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Genomic organization and precise physical location of protein phosphatase 2A regulatory subunit A beta isoform gene on chromosome band 11q23."
    Baysal B.E., Farr J.E., Goss J.R., Devlin B., Richard C.W. III
    Gene 217:107-116(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  2. "Alterations of the PPP2R1B gene in human lung and colon cancer."
    Wang S.S., Esplin E.D., Li J.L., Huang L., Gazdar A., Minna J., Evans G.A.
    Science 282:284-287(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS ARG-8; SER-65; ASP-90; PRO-101; GLU-343; ALA-448; GLY-504 AND ALA-545.
  3. "A high-resolution integrated map spanning the SDHD gene at 11q23: a 1.1-Mb BAC contig, a partial transcript map and 15 new repeat polymorphisms in a tumour-suppressor region."
    Baysal B.E., Willett-Brozick J.E., Taschner P.E.M., Dauwerse J.G., Devilee P., Devlin B.
    Eur. J. Hum. Genet. 9:121-129(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 4 AND 5).
    Tissue: Brain, Testis and Thalamus.
  5. NHLBI resequencing and genotyping service (RS&G)
    Submitted (FEB-2007) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Testis.
  9. "Alpha- and beta-forms of the 65-kDa subunit of protein phosphatase 2A have a similar 39 amino acid repeating structure."
    Hemmings B.A., Adams-Pearson C., Maurer F., Mueller P., Goris J., Merlevede W., Hofsteenge J., Stone S.R.
    Biochemistry 29:3166-3173(1990) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 31-601 (ISOFORM 1).
  10. "Raf-1-associated protein phosphatase 2A as a positive regulator of kinase activation."
    Abraham D., Podar K., Pacher M., Kubicek M., Welzel N., Hemmings B.A., Dilworth S.M., Mischak H., Kolch W., Baccarini M.
    J. Biol. Chem. 275:22300-22304(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH RAF1.
  11. "Interaction between protein phosphatase 2A and members of the importin beta superfamily."
    Lubert E.J., Sarge K.D.
    Biochem. Biophys. Res. Commun. 303:908-913(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH IPO9.
  12. "Shugoshin collaborates with protein phosphatase 2A to protect cohesin."
    Kitajima T.S., Sakuno T., Ishiguro K., Iemura S., Natsume T., Kawashima S.A., Watanabe Y.
    Nature 441:46-52(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH SGOL1.
  13. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  14. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].
  15. "Absence of PPP2R1B gene alterations in primary ovarian cancers."
    Campbell I.G., Manolitsas T.
    Oncogene 18:6367-6369(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT ASP-90.
  16. "Alterations of the PPP2R1B gene located at 11q23 in human colorectal cancers."
    Takagi Y., Futamura M., Yamaguchi K., Aoki S., Takahashi T., Saji S.
    Gut 47:268-271(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS ALA-15; PRO-365; GLU-498; ILE-499 AND GLY-500.
  17. "Alterations in the suppressor gene PPP2R1B in parathyroid hyperplasias and adenomas."
    Hemmer S., Wasenius V.M., Haglund C., Zhu Y., Knuutila S., Franssila K., Joensuu H.
    Cancer Genet. Cytogenet. 134:13-17(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT ASP-90.

Entry informationi

Entry namei2AAB_HUMAN
AccessioniPrimary (citable) accession number: P30154
Secondary accession number(s): A8MY67
, B0YJ69, B4DGQ6, B4DK91, B4DWW5, F8W8G1, O75620, Q8NHV8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 1, 1993
Last sequence update: October 17, 2006
Last modified: November 26, 2014
This is version 144 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3