Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P29533 (VCAM1_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 138. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Vascular cell adhesion protein 1

Short name=V-CAM 1
Short name=VCAM-1
Alternative name(s):
CD_antigen=CD106
Gene names
Name:Vcam1
Synonyms:Vcam-1
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length739 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Important in cell-cell recognition. Appears to function in leukocyte-endothelial cell adhesion. Interacts with integrin alpha-4/beta-1 (ITGA4/ITGB1) on leukocytes, and mediates both adhesion and signal transduction. The VCAM1/ITGA4/ITGB1 interaction may play a pathophysiologic role both in immune responses and in leukocyte emigration to sites of inflammation.

Subunit structure

Binds to ECMV-D capsid proteins and acts as a receptor for this virus. Ref.9

Subcellular location

Isoform 1: Cell membrane; Single-pass type I membrane protein.

Isoform 2: Cell membrane; Lipid-anchorGPI-anchor.

Tissue specificity

Expressed on inflamed vascular endothelium, as well as on macrophage-like and dendritic cell types in both normal and inflamed tissue. Expressed in the bone marrow. Ref.10

Post-translational modification

The GPI-anchor is located on position 319 of isoform 2.

Sequence similarities

Contains 7 Ig-like C2-type (immunoglobulin-like) domains.

Ontologies

Keywords
   Biological processCell adhesion
Host-virus interaction
   Cellular componentCell membrane
Membrane
   Coding sequence diversityAlternative splicing
   DomainImmunoglobulin domain
Repeat
Signal
Transmembrane
Transmembrane helix
   PTMDisulfide bond
Glycoprotein
GPI-anchor
Lipoprotein
   Technical termComplete proteome
Direct protein sequencing
Reference proteome
Gene Ontology (GO)
   Biological_processcell adhesion

Inferred from direct assay PubMed 12021259. Source: MGI

cellular response to glucose stimulus

Inferred from direct assay PubMed 17670746. Source: MGI

chorio-allantoic fusion

Inferred from mutant phenotype PubMed 7530222PubMed 7539357. Source: MGI

embryonic placenta morphogenesis

Inferred from mutant phenotype PubMed 7530222. Source: MGI

heart development

Inferred from mutant phenotype PubMed 7539357. Source: MGI

heterophilic cell-cell adhesion

Inferred from mutant phenotype PubMed 8145052. Source: MGI

leukocyte cell-cell adhesion

Inferred from mutant phenotype PubMed 8562500. Source: MGI

viral process

Inferred from electronic annotation. Source: UniProtKB-KW

visceral serous pericardium development

Traceable author statement PubMed 20299672. Source: DFLAT

   Cellular_componentanchored component of membrane

Inferred from electronic annotation. Source: UniProtKB-KW

cell periphery

Inferred from direct assay PubMed 21464233. Source: MGI

integral component of membrane

Inferred from electronic annotation. Source: UniProtKB-KW

plasma membrane

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functionintegrin binding

Inferred from sequence orthology PubMed 23620790. Source: MGI

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: P29533-1)

Also known as: Long;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: P29533-2)

Also known as: Short;

The sequence of this isoform differs from the canonical sequence as follows:
     310-345: EKPFIVDISPGSQVAAQVGDSVVLTCAAIGCDSPSF → DGRMKSQITNGHQLTVHLMFAKSFYFICYLCLYLAL
     346-739: Missing.
Note: GPI-anchor amidated asparagine on Asn-319.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2424 Probable
Chain25 – 739715Vascular cell adhesion protein 1
PRO_0000014998

Regions

Topological domain25 – 698674Extracellular Potential
Transmembrane699 – 72022Helical; Potential
Topological domain721 – 73919Cytoplasmic Potential
Domain25 – 11187Ig-like C2-type 1
Domain119 – 21294Ig-like C2-type 2
Domain223 – 30987Ig-like C2-type 3
Domain312 – 39382Ig-like C2-type 4
Domain408 – 50699Ig-like C2-type 5
Domain511 – 59585Ig-like C2-type 6
Domain600 – 68283Ig-like C2-type 7

Amino acid modifications

Glycosylation2251N-linked (GlcNAc...) Ref.11
Glycosylation2641N-linked (GlcNAc...); atypical Ref.11
Glycosylation2731N-linked (GlcNAc...) Ref.11
Glycosylation4241N-linked (GlcNAc...) Potential
Glycosylation5311N-linked (GlcNAc...) Potential
Glycosylation5521N-linked (GlcNAc...); atypical Ref.11
Glycosylation5611N-linked (GlcNAc...) Ref.11
Disulfide bond47 ↔ 95 By similarity
Disulfide bond52 ↔ 99 By similarity
Disulfide bond137 ↔ 195 By similarity
Disulfide bond246 ↔ 291 By similarity
Disulfide bond335 ↔ 383 By similarity
Disulfide bond534 ↔ 579 By similarity

Natural variations

Alternative sequence310 – 34536EKPFI…DSPSF → DGRMKSQITNGHQLTVHLMF AKSFYFICYLCLYLAL in isoform 2.
VSP_002581
Alternative sequence346 – 739394Missing in isoform 2.
VSP_002582

Experimental info

Sequence conflict6931D → N in AAA16921. Ref.3

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (Long) [UniParc].

Last modified April 1, 1993. Version 1.
Checksum: 3D2134C341E5E449

FASTA73981,317
        10         20         30         40         50         60 
MPVKMVAVLG ASTVLWILFA VSQAFKIEIS PEYKTIAQIG DSMALTCSTT GCESPLFSWR 

        70         80         90        100        110        120 
TQIDSPLNAK VRTEGSKSVL TMEPVSFENE HSYLCTATCG SGKLERSIHV DIYSFPKDPE 

       130        140        150        160        170        180 
IQFSGPLEVG KPVTVKCLAP DIYPVYRLEI DLFKGDQLMN RQEFSSEEMT KSLETKSLEV 

       190        200        210        220        230        240 
TFTPVIEDIG KALVCRAKLH IDQIDSTLKE RETVKELQVY ISPRNTTISV HPSTRLQEGG 

       250        260        270        280        290        300 
AVTMTCSSEG LPAPEIFWGR KLDNEVLQLL SGNATLTLIA MRMEDSGVYV CEGVNLIGRD 

       310        320        330        340        350        360 
KAEVELVVQE KPFIVDISPG SQVAAQVGDS VVLTCAAIGC DSPSFSWRTQ TDSPLNGVVR 

       370        380        390        400        410        420 
NEGAKSTLVL SSVGFEDEHS YLCAVTCLQR TLEKRTQVEV YSFPEDPVIK MSGPLVHGRP 

       430        440        450        460        470        480 
VTVNCTVPNV YPFDHLEIEL LKGETTLMKK YFLEEMGIKS LETKILETTF IPTIEDTGKS 

       490        500        510        520        530        540 
LVCLARLHSG EMESEPKQRQ SVQPLYVNVA PKETTIWVSP SPILEEGSPV NLTCSSDGIP 

       550        560        570        580        590        600 
APKILWSRQL NNGELQPLSE NTTLTFMSTK RDDSGIYVCE GINEAGISRK SVELIIQVSP 

       610        620        630        640        650        660 
KDIQLTVFPS KSVKEGDTVI ISCTCGNVPE TWIILKKKAK TGDMVLKSVD GSYTIRQAQL 

       670        680        690        700        710        720 
QDAGIYECES KTEVGSQLRS LTLDVKGKEH NKDYFSPELL ALYCASSLVI PAIGMIVYFA 

       730 
RKANMKGSYS LVEAQKSKV 

« Hide

Isoform 2 (Short) [UniParc].

Checksum: 973A28A199C6EA15
Show »

FASTA34538,372

References

« Hide 'large scale' references
[1]"Cloning of murine and rat vascular cell adhesion molecule-1."
Hession C., Moy P., Tizard R., Chisholm P., Williams C., Wysk M., Burkly L., Miyake K., Kincade P., Lobb R.
Biochem. Biophys. Res. Commun. 183:163-169(1992) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Strain: FVB.
Tissue: Lung.
[2]"Cloning and sequencing of mouse VCAM-1 cDNA."
Araki M., Araki K., Vassalli P.
Gene 126:261-264(1993) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE (ISOFORM 1).
Tissue: Lymph node.
[3]"Structure of the murine VCAM1 gene."
Cybulsky M.I., Allan-Motamed M., Collins T.
Genomics 18:387-391(1993) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1).
Strain: 129.
Tissue: Embryo.
[4]Kumar A.G., Dai Y.X., Kozak C.A., Mims M.P., Gotto A.M. Jr., Ballantyne C.M.
Submitted (AUG-1994) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE OF 1-693 (ISOFORM 1).
Strain: 129/Sv and NIH Swiss.
[5]"Cloning of an inflammation-specific phosphatidyl inositol-linked form of murine vascular cell adhesion molecule-1."
Moy P., Lobb R., Tizard R., Olson D., Hession C.
J. Biol. Chem. 268:8835-8841(1993) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
Strain: FVB.
Tissue: Lung.
[6]"Murine VCAM-1. Molecular cloning, mapping, and analysis of a truncated form."
Kumar A.G., Dai X.Y., Kozak C.A., Mims M.P., Gotto A.M. Jr., Ballantyne C.M.
J. Immunol. 153:4088-4098(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
Strain: C57BL/6.
Tissue: Liver.
[7]"Cytokine induction of an alternatively spliced murine vascular cell adhesion molecule (VCAM) mRNA encoding a glycosylphosphatidylinositol-anchored VCAM protein."
Terry R.W., Kwee L., Levine J.F., Labow M.A.
Proc. Natl. Acad. Sci. U.S.A. 90:5919-5923(1993) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 311-345 (ISOFORM 2).
Strain: FVB/N.
Tissue: Kidney.
[8]Korenaga R., Ando J., Tsuboi H., Kamiya A.
Submitted (DEC-1995) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE OF 1-21.
Tissue: Endothelial cell.
[9]"VCAM-1 is a receptor for encephalomyocarditis virus on murine vascular endothelial cells."
Huber S.A.
J. Virol. 68:3453-3458(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH ECMV-D CAPSID PROTEINS.
[10]"A VCAM-like adhesion molecule on murine bone marrow stromal cells mediates binding of lymphocyte precursors in culture."
Miyake K., Medina K., Ishihara K., Kimoto M., Auerbach R., Kincade P.W.
J. Cell Biol. 114:557-565(1991) [PubMed] [Europe PMC] [Abstract]
Cited for: PROTEIN SEQUENCE OF 27-32, TISSUE SPECIFICITY.
[11]"The mouse C2C12 myoblast cell surface N-linked glycoproteome: identification, glycosite occupancy, and membrane orientation."
Gundry R.L., Raginski K., Tarasova Y., Tchernyshyov I., Bausch-Fluck D., Elliott S.T., Boheler K.R., Van Eyk J.E., Wollscheid B.
Mol. Cell. Proteomics 8:2555-2569(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-225; ASN-264; ASN-273; ASN-552 AND ASN-561.
Tissue: Myoblast.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
M84487 mRNA. Translation: AAA40545.1.
X67783 mRNA. Translation: CAA47989.1.
L22355 expand/collapse EMBL AC list , L22301, L22349, L22350, L22351, L22352, L22353, L22354 Genomic DNA. Translation: AAA16921.1.
L22350, L22301, L22349 Genomic DNA. Translation: AAA16920.1.
U12878 Genomic DNA. Translation: AAB60659.1. Sequence problems.
U12879 Genomic DNA. Translation: AAB60660.1. Sequence problems.
U12880 Genomic DNA. Translation: AAB60661.1. Sequence problems.
U12874 Genomic DNA. Translation: AAB60662.1. Sequence problems.
U12871 Genomic DNA. Translation: AAB60663.1. Sequence problems.
U12883 Genomic DNA. Translation: AAB60664.1. Sequence problems.
U12881 Genomic DNA. Translation: AAA80010.1. Sequence problems.
U12882 Genomic DNA. Translation: AAA80011.1. Sequence problems.
U12875 Genomic DNA. Translation: AAA80012.1. Sequence problems.
U12872 Genomic DNA. Translation: AAA80013.1. Sequence problems.
U12876 Genomic DNA. Translation: AAA80014.1. Sequence problems.
U12873 Genomic DNA. Translation: AAA80015.1. Sequence problems.
U12877 Genomic DNA. Translation: AAA80016.1. Sequence problems.
L08431 mRNA. Translation: AAA40546.1.
U12884 mRNA. Translation: AAA64832.1.
L12541 mRNA. Translation: AAC37607.1.
U42327 Genomic DNA. Translation: AAB88576.1.
CCDSCCDS17785.1. [P29533-1]
PIRA46052. B48919.
JN0581.
RefSeqNP_035823.3. NM_011693.3.
UniGeneMm.440909.
Mm.76649.

3D structure databases

ProteinModelPortalP29533.
SMRP29533. Positions 25-686.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

DIPDIP-29097N.
IntActP29533. 1 interaction.
MINTMINT-4139873.

PTM databases

PhosphoSiteP29533.

Proteomic databases

MaxQBP29533.
PaxDbP29533.
PRIDEP29533.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

GeneID22329.
KEGGmmu:22329.

Organism-specific databases

CTD7412.
MGIMGI:98926. Vcam1.

Phylogenomic databases

eggNOGNOG148090.
HOGENOMHOG000004820.
HOVERGENHBG053965.
InParanoidP29533.
KOK06527.
PhylomeDBP29533.

Gene expression databases

CleanExMM_VCAM1.
GenevestigatorP29533.

Family and domain databases

Gene3D2.60.40.10. 7 hits.
InterProIPR003987. ICAM_VCAM_N.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR008424. Ig_C2-set.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR003989. VCAM-1.
[Graphical view]
PfamPF05790. C2-set. 2 hits.
PF07679. I-set. 3 hits.
[Graphical view]
PRINTSPR01472. ICAMVCAM1.
PR01474. VCAM1.
SMARTSM00409. IG. 2 hits.
SM00408. IGc2. 3 hits.
[Graphical view]
PROSITEPS50835. IG_LIKE. 5 hits.
[Graphical view]
ProtoNetSearch...

Other

NextBio302567.
PROP29533.
SOURCESearch...

Entry information

Entry nameVCAM1_MOUSE
AccessionPrimary (citable) accession number: P29533
Entry history
Integrated into UniProtKB/Swiss-Prot: April 1, 1993
Last sequence update: April 1, 1993
Last modified: July 9, 2014
This is version 138 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot