Reviewed,
UniProtKB/Swiss-Prot P29533 (VCAM1_MOUSE)
Last modified
July 13, 2010.
Version 103.
History...
Clusters with 100%,
90%,
50% identity |
Documents (2) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and originHide
| Protein names | Recommended name: Vascular cell adhesion protein 1 Short name=V-CAM 1 Short name=VCAM-1 Alternative name(s): CD_antigen=CD106 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributesHide
| Sequence length | 739 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)Hide
| Function | Important in cell-cell recognition. Appears to function in leukocyte-endothelial cell adhesion. Interacts with the beta-1 integrin VLA4 on leukocytes, and mediates both adhesion and signal transduction. The VCAM1/VLA4 interaction may play a pathophysiologic role both in immune responses and in leukocyte emigration to sites of inflammation. |
| Subunit structure | Binds to ECMV-D capsid proteins and acts as a receptor for this virus. Ref.9 |
| Subcellular location | Isoform 1: Cell membrane; Single-pass type I membrane protein. Isoform 2: Cell membrane; Lipid-anchor › GPI-anchor. |
| Tissue specificity | Expressed on inflamed vascular endothelium, as well as on macrophage-like and dendritic cell types in both normal and inflamed tissue. Expressed in the bone marrow. Ref.10 |
| Post-translational modification | The GPI-anchor is located on position 319 of isoform 2. |
| Sequence similarities | Contains 7 Ig-like C2-type (immunoglobulin-like) domains. |
OntologiesHide
| Keywords | |
|---|---|
| Biological process | Cell adhesion Host-virus interaction |
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Immunoglobulin domain Repeat Signal Transmembrane |
| PTM | Disulfide bond GPI-anchor Glycoprotein Lipoprotein |
| Technical term | Direct protein sequencing |
| Gene Ontology (GO) | |
| Biological process | chorio-allantoic fusion Inferred from mutant phenotype. Source: MGI embryonic placenta morphogenesisInferred from mutant phenotype. Source: MGI heart developmentInferred from mutant phenotype. Source: MGI heterophilic cell-cell adhesionInferred from mutant phenotype. Source: MGI interspecies interaction between organismsInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | anchored to membrane Inferred from electronic annotation. Source: UniProtKB-KW integral to membraneInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative productsHide
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P29533-1) Also known as: Long; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P29533-2) Also known as: Short; The sequence of this isoform differs from the canonical sequence as follows: 310-345: EKPFIVDISPGSQVAAQVGDSVVLTCAAIGCDSPSF → DGRMKSQITNGHQLTVHLMFAKSFYFICYLCLYLAL 346-739: Missing. | ||||||
| Note: GPI-anchored form. |
Sequence annotation (Features)Hide
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 24 | 24 | Probable | ||||||||
| Chain | 25 – 739 | 715 | Vascular cell adhesion protein 1 | PRO_0000014998 | |||||||
Regions | |||||||||||
| Topological domain | 25 – 698 | 674 | Extracellular Potential | ||||||||
| Transmembrane | 699 – 720 | 22 | Helical; Potential | ||||||||
| Topological domain | 721 – 739 | 19 | Cytoplasmic Potential | ||||||||
| Domain | 25 – 111 | 87 | Ig-like C2-type 1 | ||||||||
| Domain | 119 – 212 | 94 | Ig-like C2-type 2 | ||||||||
| Domain | 223 – 309 | 87 | Ig-like C2-type 3 | ||||||||
| Domain | 312 – 393 | 82 | Ig-like C2-type 4 | ||||||||
| Domain | 408 – 506 | 99 | Ig-like C2-type 5 | ||||||||
| Domain | 511 – 595 | 85 | Ig-like C2-type 6 | ||||||||
| Domain | 600 – 682 | 83 | Ig-like C2-type 7 | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 225 | 1 | N-linked (GlcNAc...) Ref.11 | ||||||||
| Glycosylation | 264 | 1 | N-linked (GlcNAc...) Ref.11 | ||||||||
| Glycosylation | 273 | 1 | N-linked (GlcNAc...) Ref.11 | ||||||||
| Glycosylation | 424 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 531 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 552 | 1 | N-linked (GlcNAc...) Ref.11 | ||||||||
| Glycosylation | 561 | 1 | N-linked (GlcNAc...) Ref.11 | ||||||||
| Disulfide bond | 47 ↔ 95 | By similarity | |||||||||
| Disulfide bond | 52 ↔ 99 | By similarity | |||||||||
| Disulfide bond | 137 ↔ 195 | By similarity | |||||||||
| Disulfide bond | 246 ↔ 291 | By similarity | |||||||||
| Disulfide bond | 335 ↔ 383 | By similarity | |||||||||
| Disulfide bond | 534 ↔ 579 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 310 – 345 | 36 | EKPFI…DSPSF → DGRMKSQITNGHQLTVHLMF AKSFYFICYLCLYLAL in isoform 2. | VSP_002581 | |||||||
| Alternative sequence | 346 – 739 | 394 | Missing in isoform 2. | VSP_002582 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 693 | 1 | D → N in AAA16921. Ref.3 | ||||||||
SequencesHide
| ||||||||||||||||||||||||
ReferencesHide
| « Hide 'large scale' references | |
| [1] | "Cloning of murine and rat vascular cell adhesion molecule-1." Hession C., Moy P., Tizard R., Chisholm P., Williams C., Wysk M., Burkly L., Miyake K., Kincade P., Lobb R. Biochem. Biophys. Res. Commun. 183:163-169(1992) [PubMed: 1371918] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Strain: FVB. Tissue: Lung. |
| [2] | "Cloning and sequencing of mouse VCAM-1 cDNA." Araki M., Araki K., Vassalli P. Gene 126:261-264(1993) [PubMed: 7683304] [Abstract] Cited for: NUCLEOTIDE SEQUENCE (ISOFORM 1). Tissue: Lymph node. |
| [3] | "Structure of the murine VCAM1 gene." Cybulsky M.I., Allan-Motamed M., Collins T. Genomics 18:387-391(1993) [PubMed: 7507076] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1). Strain: 129. Tissue: Embryo. |
| [4] | Kumar A.G., Dai Y.X., Kozak C.A., Mims M.P., Gotto A.M. Jr., Ballantyne C.M. Submitted (AUG-1994) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE OF 1-693 (ISOFORM 1). Strain: 129/Sv and NIH Swiss. |
| [5] | "Cloning of an inflammation-specific phosphatidyl inositol-linked form of murine vascular cell adhesion molecule-1." Moy P., Lobb R., Tizard R., Olson D., Hession C. J. Biol. Chem. 268:8835-8841(1993) [PubMed: 7682556] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Strain: FVB. Tissue: Lung. |
| [6] | "Murine VCAM-1. Molecular cloning, mapping, and analysis of a truncated form." Kumar A.G., Dai X.Y., Kozak C.A., Mims M.P., Gotto A.M. Jr., Ballantyne C.M. J. Immunol. 153:4088-4098(1994) [PubMed: 7523515] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Strain: C57BL/6. Tissue: Liver. |
| [7] | "Cytokine induction of an alternatively spliced murine vascular cell adhesion molecule (VCAM) mRNA encoding a glycosylphosphatidylinositol-anchored VCAM protein." Terry R.W., Kwee L., Levine J.F., Labow M.A. Proc. Natl. Acad. Sci. U.S.A. 90:5919-5923(1993) [PubMed: 7687058] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 311-345 (ISOFORM 2). Strain: FVB/N. Tissue: Kidney. |
| [8] | Korenaga R., Ando J., Tsuboi H., Kamiya A. Submitted (DEC-1995) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE OF 1-21. Tissue: Endothelial cell. |
| [9] | "VCAM-1 is a receptor for encephalomyocarditis virus on murine vascular endothelial cells." Huber S.A. J. Virol. 68:3453-3458(1994) [PubMed: 7514674] [Abstract] Cited for: INTERACTION WITH ECMV-D CAPSID PROTEINS. |
| [10] | "A VCAM-like adhesion molecule on murine bone marrow stromal cells mediates binding of lymphocyte precursors in culture." Miyake K., Medina K., Ishihara K., Kimoto M., Auerbach R., Kincade P.W. J. Cell Biol. 114:557-565(1991) [PubMed: 1713592] [Abstract] Cited for: PROTEIN SEQUENCE OF 27-32, TISSUE SPECIFICITY. |
| [11] | "The mouse C2C12 myoblast cell surface N-linked glycoproteome: identification, glycosite occupancy, and membrane orientation." Gundry R.L., Raginski K., Tarasova Y., Tchernyshyov I., Bausch-Fluck D., Elliott S.T., Boheler K.R., Van Eyk J.E., Wollscheid B. Mol. Cell. Proteomics 8:2555-2569(2009) [PubMed: 19656770] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-225; ASN-264; ASN-273; ASN-552 AND ASN-561, MASS SPECTROMETRY. Tissue: Myoblast. |
| + | Additional computationally mapped references. |
Cross-referencesHide
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | M84487 mRNA. Translation: AAA40545.1. X67783 mRNA. Translation: CAA47989.1. L22355 L22354 Genomic DNA. Translation: AAA16921.1. L22350, L22301, L22349 Genomic DNA. Translation: AAA16920.1. U12878 Genomic DNA. Translation: AAB60659.1. Sequence problems. U12879 Genomic DNA. Translation: AAB60660.1. Sequence problems. U12880 Genomic DNA. Translation: AAB60661.1. Sequence problems. U12874 Genomic DNA. Translation: AAB60662.1. Sequence problems. U12871 Genomic DNA. Translation: AAB60663.1. Sequence problems. U12883 Genomic DNA. Translation: AAB60664.1. Sequence problems. U12881 Genomic DNA. Translation: AAA80010.1. Sequence problems. U12882 Genomic DNA. Translation: AAA80011.1. Sequence problems. U12875 Genomic DNA. Translation: AAA80012.1. Sequence problems. U12872 Genomic DNA. Translation: AAA80013.1. Sequence problems. U12876 Genomic DNA. Translation: AAA80014.1. Sequence problems. U12873 Genomic DNA. Translation: AAA80015.1. Sequence problems. U12877 Genomic DNA. Translation: AAA80016.1. Sequence problems. L08431 mRNA. Translation: AAA40546.1. U12884 mRNA. Translation: AAA64832.1. L12541 mRNA. Translation: AAC37607.1. U42327 Genomic DNA. Translation: AAB88576.1. |
| IPI | IPI00126834. IPI00264750. |
| PIR | A46052. B48919. JN0581. |
| RefSeq | NP_035823.3. |
| UniGene | Mm.440909 Mm.76649 |
3D structure databases | |
| SMR | P29533. Positions 25-223, 35-386, 235-685. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-29097N. |
| STRING | P29533. |
PTM databases | |
| PhosphoSite | P29533. |
Proteomic databases | |
| PRIDE | P29533. |
Genome annotation databases | |
| Ensembl | ENSMUST00000029574; ENSMUSP00000029574; ENSMUSG00000027962; Mus musculus. [Genome view] ENSMUST00000106493; ENSMUSP00000102102; ENSMUSG00000027962; Mus musculus. [Genome view] |
| GeneID | 22329. |
| KEGG | mmu:22329. |
Organism-specific databases | |
| CTD | 22329. |
| MGI | MGI:98926. Vcam1. |
Phylogenomic databases | |
| eggNOG | roNOG04595. |
| HOGENOM | HBG126178. |
| HOVERGEN | HBG053965. |
| InParanoid | P29533. |
Gene expression databases | |
| ArrayExpress | P29533. |
| Bgee | P29533. |
| CleanEx | MM_VCAM1. |
| Genevestigator | P29533. |
| GermOnline | ENSMUSG00000027962. Mus musculus. |
Family and domain databases | |
| InterPro | IPR003987. ICAM_VCAM_N. IPR007110. Ig-like. IPR013783. Ig-like_fold. IPR008424. Ig_C2-set. IPR013098. Ig_I-set. IPR003599. Ig_sub. IPR003598. Ig_sub2. IPR003989. VCAM-1. [Graphical view] |
| Gene3D | G3DSA:2.60.40.10. Ig-like_fold. 7 hits. |
| Pfam | PF05790. C2-set. 2 hits. PF07679. I-set. 5 hits. [Graphical view] |
| PRINTS | PR01472. ICAMVCAM1. PR01474. VCAM1. |
| SMART | SM00409. IG. 2 hits. SM00408. IGc2. 3 hits. [Graphical view] |
| PROSITE | PS50835. IG_LIKE. 5 hits. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| SOURCE | Search... |
Entry informationHide
| Entry name | VCAM1_MOUSE | ||||||||
| Accession | Primary (citable) accession number: P29533 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documentsHide
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


