Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P29533

- VCAM1_MOUSE

UniProt

P29533 - VCAM1_MOUSE

Protein

Vascular cell adhesion protein 1

Gene

Vcam1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 139 (01 Oct 2014)
      Sequence version 1 (01 Apr 1993)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Important in cell-cell recognition. Appears to function in leukocyte-endothelial cell adhesion. Interacts with integrin alpha-4/beta-1 (ITGA4/ITGB1) on leukocytes, and mediates both adhesion and signal transduction. The VCAM1/ITGA4/ITGB1 interaction may play a pathophysiologic role both in immune responses and in leukocyte emigration to sites of inflammation.

    GO - Molecular functioni

    1. integrin binding Source: MGI

    GO - Biological processi

    1. cell adhesion Source: MGI
    2. cellular response to glucose stimulus Source: MGI
    3. chorio-allantoic fusion Source: MGI
    4. embryonic placenta morphogenesis Source: MGI
    5. heart development Source: MGI
    6. heterophilic cell-cell adhesion Source: MGI
    7. leukocyte cell-cell adhesion Source: MGI
    8. viral process Source: UniProtKB-KW
    9. visceral serous pericardium development Source: DFLAT

    Keywords - Biological processi

    Cell adhesion, Host-virus interaction

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Vascular cell adhesion protein 1
    Short name:
    V-CAM 1
    Short name:
    VCAM-1
    Alternative name(s):
    CD_antigen: CD106
    Gene namesi
    Name:Vcam1
    Synonyms:Vcam-1
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Unplaced

    Organism-specific databases

    MGIiMGI:98926. Vcam1.

    Subcellular locationi

    GO - Cellular componenti

    1. anchored component of membrane Source: UniProtKB-KW
    2. cell periphery Source: MGI
    3. integral component of membrane Source: UniProtKB-KW
    4. plasma membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell membrane, Membrane

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2424CuratedAdd
    BLAST
    Chaini25 – 739715Vascular cell adhesion protein 1PRO_0000014998Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi47 ↔ 95PROSITE-ProRule annotation
    Disulfide bondi52 ↔ 99PROSITE-ProRule annotation
    Disulfide bondi137 ↔ 195PROSITE-ProRule annotation
    Glycosylationi225 – 2251N-linked (GlcNAc...)1 Publication
    Disulfide bondi246 ↔ 291PROSITE-ProRule annotation
    Glycosylationi264 – 2641N-linked (GlcNAc...); atypical1 Publication
    Glycosylationi273 – 2731N-linked (GlcNAc...)1 Publication
    Disulfide bondi335 ↔ 383PROSITE-ProRule annotation
    Glycosylationi424 – 4241N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi531 – 5311N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi534 ↔ 579PROSITE-ProRule annotation
    Glycosylationi552 – 5521N-linked (GlcNAc...); atypical1 Publication
    Glycosylationi561 – 5611N-linked (GlcNAc...)1 Publication

    Post-translational modificationi

    The GPI-anchor is located on position 319 of isoform 2.

    Keywords - PTMi

    Disulfide bond, Glycoprotein, GPI-anchor, Lipoprotein

    Proteomic databases

    MaxQBiP29533.
    PaxDbiP29533.
    PRIDEiP29533.

    PTM databases

    PhosphoSiteiP29533.

    Expressioni

    Tissue specificityi

    Expressed on inflamed vascular endothelium, as well as on macrophage-like and dendritic cell types in both normal and inflamed tissue. Expressed in the bone marrow.1 Publication

    Gene expression databases

    CleanExiMM_VCAM1.
    GenevestigatoriP29533.

    Interactioni

    Subunit structurei

    Binds to ECMV-D capsid proteins and acts as a receptor for this virus.

    Protein-protein interaction databases

    DIPiDIP-29097N.
    IntActiP29533. 1 interaction.
    MINTiMINT-4139873.

    Structurei

    3D structure databases

    ProteinModelPortaliP29533.
    SMRiP29533. Positions 25-686.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini25 – 698674ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini721 – 73919CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei699 – 72022HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini25 – 11187Ig-like C2-type 1Add
    BLAST
    Domaini119 – 21294Ig-like C2-type 2Add
    BLAST
    Domaini223 – 30987Ig-like C2-type 3Add
    BLAST
    Domaini312 – 39382Ig-like C2-type 4Add
    BLAST
    Domaini408 – 50699Ig-like C2-type 5Add
    BLAST
    Domaini511 – 59585Ig-like C2-type 6Add
    BLAST
    Domaini600 – 68283Ig-like C2-type 7Add
    BLAST

    Sequence similaritiesi

    Keywords - Domaini

    Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG148090.
    HOGENOMiHOG000004820.
    HOVERGENiHBG053965.
    InParanoidiP29533.
    KOiK06527.
    PhylomeDBiP29533.

    Family and domain databases

    Gene3Di2.60.40.10. 7 hits.
    InterProiIPR003987. ICAM_VCAM_N.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR008424. Ig_C2-set.
    IPR013098. Ig_I-set.
    IPR003599. Ig_sub.
    IPR003598. Ig_sub2.
    IPR003989. VCAM-1.
    [Graphical view]
    PfamiPF05790. C2-set. 2 hits.
    PF07679. I-set. 3 hits.
    [Graphical view]
    PRINTSiPR01472. ICAMVCAM1.
    PR01474. VCAM1.
    SMARTiSM00409. IG. 2 hits.
    SM00408. IGc2. 3 hits.
    [Graphical view]
    PROSITEiPS50835. IG_LIKE. 5 hits.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P29533-1) [UniParc]FASTAAdd to Basket

    Also known as: Long

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MPVKMVAVLG ASTVLWILFA VSQAFKIEIS PEYKTIAQIG DSMALTCSTT    50
    GCESPLFSWR TQIDSPLNAK VRTEGSKSVL TMEPVSFENE HSYLCTATCG 100
    SGKLERSIHV DIYSFPKDPE IQFSGPLEVG KPVTVKCLAP DIYPVYRLEI 150
    DLFKGDQLMN RQEFSSEEMT KSLETKSLEV TFTPVIEDIG KALVCRAKLH 200
    IDQIDSTLKE RETVKELQVY ISPRNTTISV HPSTRLQEGG AVTMTCSSEG 250
    LPAPEIFWGR KLDNEVLQLL SGNATLTLIA MRMEDSGVYV CEGVNLIGRD 300
    KAEVELVVQE KPFIVDISPG SQVAAQVGDS VVLTCAAIGC DSPSFSWRTQ 350
    TDSPLNGVVR NEGAKSTLVL SSVGFEDEHS YLCAVTCLQR TLEKRTQVEV 400
    YSFPEDPVIK MSGPLVHGRP VTVNCTVPNV YPFDHLEIEL LKGETTLMKK 450
    YFLEEMGIKS LETKILETTF IPTIEDTGKS LVCLARLHSG EMESEPKQRQ 500
    SVQPLYVNVA PKETTIWVSP SPILEEGSPV NLTCSSDGIP APKILWSRQL 550
    NNGELQPLSE NTTLTFMSTK RDDSGIYVCE GINEAGISRK SVELIIQVSP 600
    KDIQLTVFPS KSVKEGDTVI ISCTCGNVPE TWIILKKKAK TGDMVLKSVD 650
    GSYTIRQAQL QDAGIYECES KTEVGSQLRS LTLDVKGKEH NKDYFSPELL 700
    ALYCASSLVI PAIGMIVYFA RKANMKGSYS LVEAQKSKV 739
    Length:739
    Mass (Da):81,317
    Last modified:April 1, 1993 - v1
    Checksum:i3D2134C341E5E449
    GO
    Isoform 2 (identifier: P29533-2) [UniParc]FASTAAdd to Basket

    Also known as: Short

    The sequence of this isoform differs from the canonical sequence as follows:
         310-345: EKPFIVDISPGSQVAAQVGDSVVLTCAAIGCDSPSF → DGRMKSQITNGHQLTVHLMFAKSFYFICYLCLYLAL
         346-739: Missing.

    Note: GPI-anchor amidated asparagine on Asn-319.

    Show »
    Length:345
    Mass (Da):38,372
    Checksum:i973A28A199C6EA15
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti693 – 6931D → N in AAA16921. (PubMed:7507076)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei310 – 34536EKPFI…DSPSF → DGRMKSQITNGHQLTVHLMF AKSFYFICYLCLYLAL in isoform 2. 3 PublicationsVSP_002581Add
    BLAST
    Alternative sequencei346 – 739394Missing in isoform 2. 3 PublicationsVSP_002582Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M84487 mRNA. Translation: AAA40545.1.
    X67783 mRNA. Translation: CAA47989.1.
    L22355
    , L22301, L22349, L22350, L22351, L22352, L22353, L22354 Genomic DNA. Translation: AAA16921.1.
    L22350, L22301, L22349 Genomic DNA. Translation: AAA16920.1.
    U12878 Genomic DNA. Translation: AAB60659.1. Sequence problems.
    U12879 Genomic DNA. Translation: AAB60660.1. Sequence problems.
    U12880 Genomic DNA. Translation: AAB60661.1. Sequence problems.
    U12874 Genomic DNA. Translation: AAB60662.1. Sequence problems.
    U12871 Genomic DNA. Translation: AAB60663.1. Sequence problems.
    U12883 Genomic DNA. Translation: AAB60664.1. Sequence problems.
    U12881 Genomic DNA. Translation: AAA80010.1. Sequence problems.
    U12882 Genomic DNA. Translation: AAA80011.1. Sequence problems.
    U12875 Genomic DNA. Translation: AAA80012.1. Sequence problems.
    U12872 Genomic DNA. Translation: AAA80013.1. Sequence problems.
    U12876 Genomic DNA. Translation: AAA80014.1. Sequence problems.
    U12873 Genomic DNA. Translation: AAA80015.1. Sequence problems.
    U12877 Genomic DNA. Translation: AAA80016.1. Sequence problems.
    L08431 mRNA. Translation: AAA40546.1.
    U12884 mRNA. Translation: AAA64832.1.
    L12541 mRNA. Translation: AAC37607.1.
    U42327 Genomic DNA. Translation: AAB88576.1.
    CCDSiCCDS17785.1. [P29533-1]
    PIRiB48919. A46052.
    JN0581.
    RefSeqiNP_035823.3. NM_011693.3.
    UniGeneiMm.440909.
    Mm.76649.

    Genome annotation databases

    GeneIDi22329.
    KEGGimmu:22329.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Web resourcesi

    Functional Glycomics Gateway - Glycan Binding

    VCAM-1

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M84487 mRNA. Translation: AAA40545.1 .
    X67783 mRNA. Translation: CAA47989.1 .
    L22355
    , L22301 , L22349 , L22350 , L22351 , L22352 , L22353 , L22354 Genomic DNA. Translation: AAA16921.1 .
    L22350 , L22301 , L22349 Genomic DNA. Translation: AAA16920.1 .
    U12878 Genomic DNA. Translation: AAB60659.1 . Sequence problems.
    U12879 Genomic DNA. Translation: AAB60660.1 . Sequence problems.
    U12880 Genomic DNA. Translation: AAB60661.1 . Sequence problems.
    U12874 Genomic DNA. Translation: AAB60662.1 . Sequence problems.
    U12871 Genomic DNA. Translation: AAB60663.1 . Sequence problems.
    U12883 Genomic DNA. Translation: AAB60664.1 . Sequence problems.
    U12881 Genomic DNA. Translation: AAA80010.1 . Sequence problems.
    U12882 Genomic DNA. Translation: AAA80011.1 . Sequence problems.
    U12875 Genomic DNA. Translation: AAA80012.1 . Sequence problems.
    U12872 Genomic DNA. Translation: AAA80013.1 . Sequence problems.
    U12876 Genomic DNA. Translation: AAA80014.1 . Sequence problems.
    U12873 Genomic DNA. Translation: AAA80015.1 . Sequence problems.
    U12877 Genomic DNA. Translation: AAA80016.1 . Sequence problems.
    L08431 mRNA. Translation: AAA40546.1 .
    U12884 mRNA. Translation: AAA64832.1 .
    L12541 mRNA. Translation: AAC37607.1 .
    U42327 Genomic DNA. Translation: AAB88576.1 .
    CCDSi CCDS17785.1. [P29533-1 ]
    PIRi B48919. A46052.
    JN0581.
    RefSeqi NP_035823.3. NM_011693.3.
    UniGenei Mm.440909.
    Mm.76649.

    3D structure databases

    ProteinModelPortali P29533.
    SMRi P29533. Positions 25-686.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    DIPi DIP-29097N.
    IntActi P29533. 1 interaction.
    MINTi MINT-4139873.

    PTM databases

    PhosphoSitei P29533.

    Proteomic databases

    MaxQBi P29533.
    PaxDbi P29533.
    PRIDEi P29533.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    GeneIDi 22329.
    KEGGi mmu:22329.

    Organism-specific databases

    CTDi 7412.
    MGIi MGI:98926. Vcam1.

    Phylogenomic databases

    eggNOGi NOG148090.
    HOGENOMi HOG000004820.
    HOVERGENi HBG053965.
    InParanoidi P29533.
    KOi K06527.
    PhylomeDBi P29533.

    Miscellaneous databases

    NextBioi 302567.
    PROi P29533.
    SOURCEi Search...

    Gene expression databases

    CleanExi MM_VCAM1.
    Genevestigatori P29533.

    Family and domain databases

    Gene3Di 2.60.40.10. 7 hits.
    InterProi IPR003987. ICAM_VCAM_N.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR008424. Ig_C2-set.
    IPR013098. Ig_I-set.
    IPR003599. Ig_sub.
    IPR003598. Ig_sub2.
    IPR003989. VCAM-1.
    [Graphical view ]
    Pfami PF05790. C2-set. 2 hits.
    PF07679. I-set. 3 hits.
    [Graphical view ]
    PRINTSi PR01472. ICAMVCAM1.
    PR01474. VCAM1.
    SMARTi SM00409. IG. 2 hits.
    SM00408. IGc2. 3 hits.
    [Graphical view ]
    PROSITEi PS50835. IG_LIKE. 5 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Strain: FVB.
      Tissue: Lung.
    2. "Cloning and sequencing of mouse VCAM-1 cDNA."
      Araki M., Araki K., Vassalli P.
      Gene 126:261-264(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE (ISOFORM 1).
      Tissue: Lymph node.
    3. Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1).
      Strain: 129.
      Tissue: Embryo.
    4. Kumar A.G., Dai Y.X., Kozak C.A., Mims M.P., Gotto A.M. Jr., Ballantyne C.M.
      Submitted (AUG-1994) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE OF 1-693 (ISOFORM 1).
      Strain: 129/Sv and NIH Swiss.
    5. "Cloning of an inflammation-specific phosphatidyl inositol-linked form of murine vascular cell adhesion molecule-1."
      Moy P., Lobb R., Tizard R., Olson D., Hession C.
      J. Biol. Chem. 268:8835-8841(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
      Strain: FVB.
      Tissue: Lung.
    6. "Murine VCAM-1. Molecular cloning, mapping, and analysis of a truncated form."
      Kumar A.G., Dai X.Y., Kozak C.A., Mims M.P., Gotto A.M. Jr., Ballantyne C.M.
      J. Immunol. 153:4088-4098(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
      Strain: C57BL/6.
      Tissue: Liver.
    7. "Cytokine induction of an alternatively spliced murine vascular cell adhesion molecule (VCAM) mRNA encoding a glycosylphosphatidylinositol-anchored VCAM protein."
      Terry R.W., Kwee L., Levine J.F., Labow M.A.
      Proc. Natl. Acad. Sci. U.S.A. 90:5919-5923(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 311-345 (ISOFORM 2).
      Strain: FVB/N.
      Tissue: Kidney.
    8. Korenaga R., Ando J., Tsuboi H., Kamiya A.
      Submitted (DEC-1995) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE OF 1-21.
      Tissue: Endothelial cell.
    9. "VCAM-1 is a receptor for encephalomyocarditis virus on murine vascular endothelial cells."
      Huber S.A.
      J. Virol. 68:3453-3458(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH ECMV-D CAPSID PROTEINS.
    10. "A VCAM-like adhesion molecule on murine bone marrow stromal cells mediates binding of lymphocyte precursors in culture."
      Miyake K., Medina K., Ishihara K., Kimoto M., Auerbach R., Kincade P.W.
      J. Cell Biol. 114:557-565(1991) [PubMed] [Europe PMC] [Abstract]
      Cited for: PROTEIN SEQUENCE OF 27-32, TISSUE SPECIFICITY.
    11. "The mouse C2C12 myoblast cell surface N-linked glycoproteome: identification, glycosite occupancy, and membrane orientation."
      Gundry R.L., Raginski K., Tarasova Y., Tchernyshyov I., Bausch-Fluck D., Elliott S.T., Boheler K.R., Van Eyk J.E., Wollscheid B.
      Mol. Cell. Proteomics 8:2555-2569(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-225; ASN-264; ASN-273; ASN-552 AND ASN-561.
      Tissue: Myoblast.

    Entry informationi

    Entry nameiVCAM1_MOUSE
    AccessioniPrimary (citable) accession number: P29533
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 1, 1993
    Last sequence update: April 1, 1993
    Last modified: October 1, 2014
    This is version 139 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3