SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P29533

- VCAM1_MOUSE

UniProt

P29533 - VCAM1_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Vascular cell adhesion protein 1

Gene
Vcam1, Vcam-1
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Important in cell-cell recognition. Appears to function in leukocyte-endothelial cell adhesion. Interacts with integrin alpha-4/beta-1 (ITGA4/ITGB1) on leukocytes, and mediates both adhesion and signal transduction. The VCAM1/ITGA4/ITGB1 interaction may play a pathophysiologic role both in immune responses and in leukocyte emigration to sites of inflammation.

GO - Molecular functioni

  1. integrin binding Source: MGI

GO - Biological processi

  1. cell adhesion Source: MGI
  2. cellular response to glucose stimulus Source: MGI
  3. chorio-allantoic fusion Source: MGI
  4. embryonic placenta morphogenesis Source: MGI
  5. heart development Source: MGI
  6. heterophilic cell-cell adhesion Source: MGI
  7. leukocyte cell-cell adhesion Source: MGI
  8. viral process Source: UniProtKB-KW
  9. visceral serous pericardium development Source: DFLAT
Complete GO annotation...

Keywords - Biological processi

Cell adhesion, Host-virus interaction

Names & Taxonomyi

Protein namesi
Recommended name:
Vascular cell adhesion protein 1
Short name:
V-CAM 1
Short name:
VCAM-1
Alternative name(s):
CD_antigen: CD106
Gene namesi
Name:Vcam1
Synonyms:Vcam-1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Unplaced

Organism-specific databases

MGIiMGI:98926. Vcam1.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini25 – 698674Extracellular Reviewed predictionAdd
BLAST
Transmembranei699 – 72022Helical; Reviewed predictionAdd
BLAST
Topological domaini721 – 73919Cytoplasmic Reviewed predictionAdd
BLAST

GO - Cellular componenti

  1. anchored component of membrane Source: UniProtKB-KW
  2. cell periphery Source: MGI
  3. integral component of membrane Source: UniProtKB-KW
  4. plasma membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2424 InferredAdd
BLAST
Chaini25 – 739715Vascular cell adhesion protein 1PRO_0000014998Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi47 ↔ 95 By similarity
Disulfide bondi52 ↔ 99 By similarity
Disulfide bondi137 ↔ 195 By similarity
Glycosylationi225 – 2251N-linked (GlcNAc...)1 Publication
Disulfide bondi246 ↔ 291 By similarity
Glycosylationi264 – 2641N-linked (GlcNAc...); atypical1 Publication
Glycosylationi273 – 2731N-linked (GlcNAc...)1 Publication
Disulfide bondi335 ↔ 383 By similarity
Glycosylationi424 – 4241N-linked (GlcNAc...) Reviewed prediction
Glycosylationi531 – 5311N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi534 ↔ 579 By similarity
Glycosylationi552 – 5521N-linked (GlcNAc...); atypical1 Publication
Glycosylationi561 – 5611N-linked (GlcNAc...)1 Publication

Post-translational modificationi

The GPI-anchor is located on position 319 of isoform 2.

Keywords - PTMi

Disulfide bond, Glycoprotein, GPI-anchor, Lipoprotein

Proteomic databases

MaxQBiP29533.
PaxDbiP29533.
PRIDEiP29533.

PTM databases

PhosphoSiteiP29533.

Expressioni

Tissue specificityi

Expressed on inflamed vascular endothelium, as well as on macrophage-like and dendritic cell types in both normal and inflamed tissue. Expressed in the bone marrow.1 Publication

Gene expression databases

CleanExiMM_VCAM1.
GenevestigatoriP29533.

Interactioni

Subunit structurei

Binds to ECMV-D capsid proteins and acts as a receptor for this virus.1 Publication

Protein-protein interaction databases

DIPiDIP-29097N.
IntActiP29533. 1 interaction.
MINTiMINT-4139873.

Structurei

3D structure databases

ProteinModelPortaliP29533.
SMRiP29533. Positions 25-686.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini25 – 11187Ig-like C2-type 1Add
BLAST
Domaini119 – 21294Ig-like C2-type 2Add
BLAST
Domaini223 – 30987Ig-like C2-type 3Add
BLAST
Domaini312 – 39382Ig-like C2-type 4Add
BLAST
Domaini408 – 50699Ig-like C2-type 5Add
BLAST
Domaini511 – 59585Ig-like C2-type 6Add
BLAST
Domaini600 – 68283Ig-like C2-type 7Add
BLAST

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG148090.
HOGENOMiHOG000004820.
HOVERGENiHBG053965.
InParanoidiP29533.
KOiK06527.
PhylomeDBiP29533.

Family and domain databases

Gene3Di2.60.40.10. 7 hits.
InterProiIPR003987. ICAM_VCAM_N.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR008424. Ig_C2-set.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR003989. VCAM-1.
[Graphical view]
PfamiPF05790. C2-set. 2 hits.
PF07679. I-set. 3 hits.
[Graphical view]
PRINTSiPR01472. ICAMVCAM1.
PR01474. VCAM1.
SMARTiSM00409. IG. 2 hits.
SM00408. IGc2. 3 hits.
[Graphical view]
PROSITEiPS50835. IG_LIKE. 5 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P29533-1) [UniParc]FASTAAdd to Basket

Also known as: Long

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MPVKMVAVLG ASTVLWILFA VSQAFKIEIS PEYKTIAQIG DSMALTCSTT    50
GCESPLFSWR TQIDSPLNAK VRTEGSKSVL TMEPVSFENE HSYLCTATCG 100
SGKLERSIHV DIYSFPKDPE IQFSGPLEVG KPVTVKCLAP DIYPVYRLEI 150
DLFKGDQLMN RQEFSSEEMT KSLETKSLEV TFTPVIEDIG KALVCRAKLH 200
IDQIDSTLKE RETVKELQVY ISPRNTTISV HPSTRLQEGG AVTMTCSSEG 250
LPAPEIFWGR KLDNEVLQLL SGNATLTLIA MRMEDSGVYV CEGVNLIGRD 300
KAEVELVVQE KPFIVDISPG SQVAAQVGDS VVLTCAAIGC DSPSFSWRTQ 350
TDSPLNGVVR NEGAKSTLVL SSVGFEDEHS YLCAVTCLQR TLEKRTQVEV 400
YSFPEDPVIK MSGPLVHGRP VTVNCTVPNV YPFDHLEIEL LKGETTLMKK 450
YFLEEMGIKS LETKILETTF IPTIEDTGKS LVCLARLHSG EMESEPKQRQ 500
SVQPLYVNVA PKETTIWVSP SPILEEGSPV NLTCSSDGIP APKILWSRQL 550
NNGELQPLSE NTTLTFMSTK RDDSGIYVCE GINEAGISRK SVELIIQVSP 600
KDIQLTVFPS KSVKEGDTVI ISCTCGNVPE TWIILKKKAK TGDMVLKSVD 650
GSYTIRQAQL QDAGIYECES KTEVGSQLRS LTLDVKGKEH NKDYFSPELL 700
ALYCASSLVI PAIGMIVYFA RKANMKGSYS LVEAQKSKV 739
Length:739
Mass (Da):81,317
Last modified:April 1, 1993 - v1
Checksum:i3D2134C341E5E449
GO
Isoform 2 (identifier: P29533-2) [UniParc]FASTAAdd to Basket

Also known as: Short

The sequence of this isoform differs from the canonical sequence as follows:
     310-345: EKPFIVDISPGSQVAAQVGDSVVLTCAAIGCDSPSF → DGRMKSQITNGHQLTVHLMFAKSFYFICYLCLYLAL
     346-739: Missing.

Note: GPI-anchor amidated asparagine on Asn-319.

Show »
Length:345
Mass (Da):38,372
Checksum:i973A28A199C6EA15
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei310 – 34536EKPFI…DSPSF → DGRMKSQITNGHQLTVHLMF AKSFYFICYLCLYLAL in isoform 2. VSP_002581Add
BLAST
Alternative sequencei346 – 739394Missing in isoform 2. VSP_002582Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti693 – 6931D → N in AAA16921. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
M84487 mRNA. Translation: AAA40545.1.
X67783 mRNA. Translation: CAA47989.1.
L22355
, L22301, L22349, L22350, L22351, L22352, L22353, L22354 Genomic DNA. Translation: AAA16921.1.
L22350, L22301, L22349 Genomic DNA. Translation: AAA16920.1.
U12878 Genomic DNA. Translation: AAB60659.1. Sequence problems.
U12879 Genomic DNA. Translation: AAB60660.1. Sequence problems.
U12880 Genomic DNA. Translation: AAB60661.1. Sequence problems.
U12874 Genomic DNA. Translation: AAB60662.1. Sequence problems.
U12871 Genomic DNA. Translation: AAB60663.1. Sequence problems.
U12883 Genomic DNA. Translation: AAB60664.1. Sequence problems.
U12881 Genomic DNA. Translation: AAA80010.1. Sequence problems.
U12882 Genomic DNA. Translation: AAA80011.1. Sequence problems.
U12875 Genomic DNA. Translation: AAA80012.1. Sequence problems.
U12872 Genomic DNA. Translation: AAA80013.1. Sequence problems.
U12876 Genomic DNA. Translation: AAA80014.1. Sequence problems.
U12873 Genomic DNA. Translation: AAA80015.1. Sequence problems.
U12877 Genomic DNA. Translation: AAA80016.1. Sequence problems.
L08431 mRNA. Translation: AAA40546.1.
U12884 mRNA. Translation: AAA64832.1.
L12541 mRNA. Translation: AAC37607.1.
U42327 Genomic DNA. Translation: AAB88576.1.
CCDSiCCDS17785.1. [P29533-1]
PIRiB48919. A46052.
JN0581.
RefSeqiNP_035823.3. NM_011693.3.
UniGeneiMm.440909.
Mm.76649.

Genome annotation databases

GeneIDi22329.
KEGGimmu:22329.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Web resourcesi

Functional Glycomics Gateway - Glycan Binding

VCAM-1

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
M84487 mRNA. Translation: AAA40545.1 .
X67783 mRNA. Translation: CAA47989.1 .
L22355
, L22301 , L22349 , L22350 , L22351 , L22352 , L22353 , L22354 Genomic DNA. Translation: AAA16921.1 .
L22350 , L22301 , L22349 Genomic DNA. Translation: AAA16920.1 .
U12878 Genomic DNA. Translation: AAB60659.1 . Sequence problems.
U12879 Genomic DNA. Translation: AAB60660.1 . Sequence problems.
U12880 Genomic DNA. Translation: AAB60661.1 . Sequence problems.
U12874 Genomic DNA. Translation: AAB60662.1 . Sequence problems.
U12871 Genomic DNA. Translation: AAB60663.1 . Sequence problems.
U12883 Genomic DNA. Translation: AAB60664.1 . Sequence problems.
U12881 Genomic DNA. Translation: AAA80010.1 . Sequence problems.
U12882 Genomic DNA. Translation: AAA80011.1 . Sequence problems.
U12875 Genomic DNA. Translation: AAA80012.1 . Sequence problems.
U12872 Genomic DNA. Translation: AAA80013.1 . Sequence problems.
U12876 Genomic DNA. Translation: AAA80014.1 . Sequence problems.
U12873 Genomic DNA. Translation: AAA80015.1 . Sequence problems.
U12877 Genomic DNA. Translation: AAA80016.1 . Sequence problems.
L08431 mRNA. Translation: AAA40546.1 .
U12884 mRNA. Translation: AAA64832.1 .
L12541 mRNA. Translation: AAC37607.1 .
U42327 Genomic DNA. Translation: AAB88576.1 .
CCDSi CCDS17785.1. [P29533-1 ]
PIRi B48919. A46052.
JN0581.
RefSeqi NP_035823.3. NM_011693.3.
UniGenei Mm.440909.
Mm.76649.

3D structure databases

ProteinModelPortali P29533.
SMRi P29533. Positions 25-686.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

DIPi DIP-29097N.
IntActi P29533. 1 interaction.
MINTi MINT-4139873.

PTM databases

PhosphoSitei P29533.

Proteomic databases

MaxQBi P29533.
PaxDbi P29533.
PRIDEi P29533.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

GeneIDi 22329.
KEGGi mmu:22329.

Organism-specific databases

CTDi 7412.
MGIi MGI:98926. Vcam1.

Phylogenomic databases

eggNOGi NOG148090.
HOGENOMi HOG000004820.
HOVERGENi HBG053965.
InParanoidi P29533.
KOi K06527.
PhylomeDBi P29533.

Miscellaneous databases

NextBioi 302567.
PROi P29533.
SOURCEi Search...

Gene expression databases

CleanExi MM_VCAM1.
Genevestigatori P29533.

Family and domain databases

Gene3Di 2.60.40.10. 7 hits.
InterProi IPR003987. ICAM_VCAM_N.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR008424. Ig_C2-set.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR003989. VCAM-1.
[Graphical view ]
Pfami PF05790. C2-set. 2 hits.
PF07679. I-set. 3 hits.
[Graphical view ]
PRINTSi PR01472. ICAMVCAM1.
PR01474. VCAM1.
SMARTi SM00409. IG. 2 hits.
SM00408. IGc2. 3 hits.
[Graphical view ]
PROSITEi PS50835. IG_LIKE. 5 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Strain: FVB.
    Tissue: Lung.
  2. "Cloning and sequencing of mouse VCAM-1 cDNA."
    Araki M., Araki K., Vassalli P.
    Gene 126:261-264(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE (ISOFORM 1).
    Tissue: Lymph node.
  3. Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1).
    Strain: 129.
    Tissue: Embryo.
  4. Kumar A.G., Dai Y.X., Kozak C.A., Mims M.P., Gotto A.M. Jr., Ballantyne C.M.
    Submitted (AUG-1994) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE OF 1-693 (ISOFORM 1).
    Strain: 129/Sv and NIH Swiss.
  5. "Cloning of an inflammation-specific phosphatidyl inositol-linked form of murine vascular cell adhesion molecule-1."
    Moy P., Lobb R., Tizard R., Olson D., Hession C.
    J. Biol. Chem. 268:8835-8841(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Strain: FVB.
    Tissue: Lung.
  6. "Murine VCAM-1. Molecular cloning, mapping, and analysis of a truncated form."
    Kumar A.G., Dai X.Y., Kozak C.A., Mims M.P., Gotto A.M. Jr., Ballantyne C.M.
    J. Immunol. 153:4088-4098(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Strain: C57BL/6.
    Tissue: Liver.
  7. "Cytokine induction of an alternatively spliced murine vascular cell adhesion molecule (VCAM) mRNA encoding a glycosylphosphatidylinositol-anchored VCAM protein."
    Terry R.W., Kwee L., Levine J.F., Labow M.A.
    Proc. Natl. Acad. Sci. U.S.A. 90:5919-5923(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 311-345 (ISOFORM 2).
    Strain: FVB/N.
    Tissue: Kidney.
  8. Korenaga R., Ando J., Tsuboi H., Kamiya A.
    Submitted (DEC-1995) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE OF 1-21.
    Tissue: Endothelial cell.
  9. "VCAM-1 is a receptor for encephalomyocarditis virus on murine vascular endothelial cells."
    Huber S.A.
    J. Virol. 68:3453-3458(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH ECMV-D CAPSID PROTEINS.
  10. "A VCAM-like adhesion molecule on murine bone marrow stromal cells mediates binding of lymphocyte precursors in culture."
    Miyake K., Medina K., Ishihara K., Kimoto M., Auerbach R., Kincade P.W.
    J. Cell Biol. 114:557-565(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 27-32, TISSUE SPECIFICITY.
  11. "The mouse C2C12 myoblast cell surface N-linked glycoproteome: identification, glycosite occupancy, and membrane orientation."
    Gundry R.L., Raginski K., Tarasova Y., Tchernyshyov I., Bausch-Fluck D., Elliott S.T., Boheler K.R., Van Eyk J.E., Wollscheid B.
    Mol. Cell. Proteomics 8:2555-2569(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-225; ASN-264; ASN-273; ASN-552 AND ASN-561.
    Tissue: Myoblast.

Entry informationi

Entry nameiVCAM1_MOUSE
AccessioniPrimary (citable) accession number: P29533
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 1, 1993
Last sequence update: April 1, 1993
Last modified: July 9, 2014
This is version 138 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi