Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Vascular cell adhesion protein 1

Gene

Vcam1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Important in cell-cell recognition. Appears to function in leukocyte-endothelial cell adhesion. Interacts with integrin alpha-4/beta-1 (ITGA4/ITGB1) on leukocytes, and mediates both adhesion and signal transduction. The VCAM1/ITGA4/ITGB1 interaction may play a pathophysiologic role both in immune responses and in leukocyte emigration to sites of inflammation.

GO - Molecular functioni

GO - Biological processi

  • amine metabolic process Source: MGI
  • calcium-mediated signaling using intracellular calcium source Source: MGI
  • cell adhesion Source: MGI
  • cell-matrix adhesion Source: MGI
  • cellular response to glucose stimulus Source: MGI
  • chorio-allantoic fusion Source: MGI
  • embryonic placenta morphogenesis Source: MGI
  • heart development Source: MGI
  • heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules Source: MGI
  • leukocyte cell-cell adhesion Source: MGI
  • leukocyte tethering or rolling Source: MGI
  • positive regulation of T cell proliferation Source: MGI
  • viral process Source: UniProtKB-KW
  • visceral serous pericardium development Source: DFLAT

Keywordsi

Biological processCell adhesion, Host-virus interaction

Enzyme and pathway databases

ReactomeiR-MMU-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
R-MMU-216083 Integrin cell surface interactions

Names & Taxonomyi

Protein namesi
Recommended name:
Vascular cell adhesion protein 1
Short name:
V-CAM 1
Short name:
VCAM-1
Alternative name(s):
CD_antigen: CD106
Gene namesi
Name:Vcam1
Synonyms:Vcam-1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 3

Organism-specific databases

MGIiMGI:98926 Vcam1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini25 – 698ExtracellularSequence analysisAdd BLAST674
Transmembranei699 – 720HelicalSequence analysisAdd BLAST22
Topological domaini721 – 739CytoplasmicSequence analysisAdd BLAST19

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 24CuratedAdd BLAST24
ChainiPRO_000001499825 – 739Vascular cell adhesion protein 1Add BLAST715

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi47 ↔ 95PROSITE-ProRule annotation
Disulfide bondi52 ↔ 99PROSITE-ProRule annotation
Disulfide bondi137 ↔ 195PROSITE-ProRule annotation
Glycosylationi225N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi246 ↔ 291PROSITE-ProRule annotation
Glycosylationi264N-linked (GlcNAc...) asparagine; atypical1 Publication1
Glycosylationi273N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi335 ↔ 383PROSITE-ProRule annotation
Glycosylationi424N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi531N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi534 ↔ 579PROSITE-ProRule annotation
Glycosylationi552N-linked (GlcNAc...) asparagine; atypical1 Publication1
Glycosylationi561N-linked (GlcNAc...) asparagine1 Publication1
Isoform 2 (identifier: P29533-2)
Lipidationi319GPI-anchor amidated asparagine1 Publication1

Keywords - PTMi

Disulfide bond, Glycoprotein, GPI-anchor, Lipoprotein

Proteomic databases

MaxQBiP29533
PaxDbiP29533
PeptideAtlasiP29533
PRIDEiP29533

PTM databases

iPTMnetiP29533
PhosphoSitePlusiP29533

Expressioni

Tissue specificityi

Expressed on inflamed vascular endothelium, as well as on macrophage-like and dendritic cell types in both normal and inflamed tissue. Expressed in the bone marrow.1 Publication

Gene expression databases

BgeeiENSMUSG00000027962
CleanExiMM_VCAM1
ExpressionAtlasiP29533 baseline and differential

Interactioni

Subunit structurei

Binds to ECMV-D capsid proteins and acts as a receptor for this virus.

GO - Molecular functioni

Protein-protein interaction databases

BioGridi204505, 1 interactor
DIPiDIP-29097N
IntActiP29533, 2 interactors
MINTiP29533
STRINGi10090.ENSMUSP00000029574

Structurei

3D structure databases

ProteinModelPortaliP29533
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini25 – 111Ig-like C2-type 1Add BLAST87
Domaini119 – 212Ig-like C2-type 2Add BLAST94
Domaini223 – 309Ig-like C2-type 3Add BLAST87
Domaini312 – 393Ig-like C2-type 4Add BLAST82
Domaini408 – 506Ig-like C2-type 5Add BLAST99
Domaini511 – 595Ig-like C2-type 6Add BLAST85
Domaini600 – 682Ig-like C2-type 7Add BLAST83

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IIKS Eukaryota
ENOG4111F4V LUCA
GeneTreeiENSGT00830000128299
HOGENOMiHOG000004820
HOVERGENiHBG053965
InParanoidiP29533
PhylomeDBiP29533

Family and domain databases

Gene3Di2.60.40.10, 7 hits
InterProiView protein in InterPro
IPR003987 ICAM_VCAM_N
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR008424 Ig_C2-set
IPR013098 Ig_I-set
IPR003599 Ig_sub
IPR003598 Ig_sub2
IPR013151 Immunoglobulin
IPR003989 VCAM-1
PANTHERiPTHR44644 PTHR44644, 3 hits
PfamiView protein in Pfam
PF05790 C2-set, 2 hits
PF07679 I-set, 3 hits
PF00047 ig, 1 hit
PRINTSiPR01472 ICAMVCAM1
PR01474 VCAM1
SMARTiView protein in SMART
SM00409 IG, 5 hits
SM00408 IGc2, 5 hits
SUPFAMiSSF48726 SSF48726, 7 hits
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 5 hits

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P29533-1) [UniParc]FASTAAdd to basket
Also known as: Long

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPVKMVAVLG ASTVLWILFA VSQAFKIEIS PEYKTIAQIG DSMALTCSTT
60 70 80 90 100
GCESPLFSWR TQIDSPLNAK VRTEGSKSVL TMEPVSFENE HSYLCTATCG
110 120 130 140 150
SGKLERSIHV DIYSFPKDPE IQFSGPLEVG KPVTVKCLAP DIYPVYRLEI
160 170 180 190 200
DLFKGDQLMN RQEFSSEEMT KSLETKSLEV TFTPVIEDIG KALVCRAKLH
210 220 230 240 250
IDQIDSTLKE RETVKELQVY ISPRNTTISV HPSTRLQEGG AVTMTCSSEG
260 270 280 290 300
LPAPEIFWGR KLDNEVLQLL SGNATLTLIA MRMEDSGVYV CEGVNLIGRD
310 320 330 340 350
KAEVELVVQE KPFIVDISPG SQVAAQVGDS VVLTCAAIGC DSPSFSWRTQ
360 370 380 390 400
TDSPLNGVVR NEGAKSTLVL SSVGFEDEHS YLCAVTCLQR TLEKRTQVEV
410 420 430 440 450
YSFPEDPVIK MSGPLVHGRP VTVNCTVPNV YPFDHLEIEL LKGETTLMKK
460 470 480 490 500
YFLEEMGIKS LETKILETTF IPTIEDTGKS LVCLARLHSG EMESEPKQRQ
510 520 530 540 550
SVQPLYVNVA PKETTIWVSP SPILEEGSPV NLTCSSDGIP APKILWSRQL
560 570 580 590 600
NNGELQPLSE NTTLTFMSTK RDDSGIYVCE GINEAGISRK SVELIIQVSP
610 620 630 640 650
KDIQLTVFPS KSVKEGDTVI ISCTCGNVPE TWIILKKKAK TGDMVLKSVD
660 670 680 690 700
GSYTIRQAQL QDAGIYECES KTEVGSQLRS LTLDVKGKEH NKDYFSPELL
710 720 730
ALYCASSLVI PAIGMIVYFA RKANMKGSYS LVEAQKSKV
Length:739
Mass (Da):81,317
Last modified:April 1, 1993 - v1
Checksum:i3D2134C341E5E449
GO
Isoform 2 (identifier: P29533-2) [UniParc]FASTAAdd to basket
Also known as: Short

The sequence of this isoform differs from the canonical sequence as follows:
     310-345: EKPFIVDISPGSQVAAQVGDSVVLTCAAIGCDSPSF → DGRMKSQITNGHQLTVHLMFAKSFYFICYLCLYLAL
     346-739: Missing.

Show »
Length:345
Mass (Da):38,372
Checksum:i973A28A199C6EA15
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti693D → N in AAA16921 (PubMed:7507076).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_002581310 – 345EKPFI…DSPSF → DGRMKSQITNGHQLTVHLMF AKSFYFICYLCLYLAL in isoform 2. 3 PublicationsAdd BLAST36
Alternative sequenceiVSP_002582346 – 739Missing in isoform 2. 3 PublicationsAdd BLAST394

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M84487 mRNA Translation: AAA40545.1
X67783 mRNA Translation: CAA47989.1
L22355
, L22301, L22349, L22350, L22351, L22352, L22353, L22354 Genomic DNA Translation: AAA16921.1
L22350, L22301, L22349 Genomic DNA Translation: AAA16920.1
U12878 Genomic DNA Translation: AAB60659.1 Sequence problems.
U12879 Genomic DNA Translation: AAB60660.1 Sequence problems.
U12880 Genomic DNA Translation: AAB60661.1 Sequence problems.
U12874 Genomic DNA Translation: AAB60662.1 Sequence problems.
U12871 Genomic DNA Translation: AAB60663.1 Sequence problems.
U12883 Genomic DNA Translation: AAB60664.1 Sequence problems.
U12881 Genomic DNA Translation: AAA80010.1 Sequence problems.
U12882 Genomic DNA Translation: AAA80011.1 Sequence problems.
U12875 Genomic DNA Translation: AAA80012.1 Sequence problems.
U12872 Genomic DNA Translation: AAA80013.1 Sequence problems.
U12876 Genomic DNA Translation: AAA80014.1 Sequence problems.
U12873 Genomic DNA Translation: AAA80015.1 Sequence problems.
U12877 Genomic DNA Translation: AAA80016.1 Sequence problems.
L08431 mRNA Translation: AAA40546.1
U12884 mRNA Translation: AAA64832.1
L12541 mRNA Translation: AAC37607.1
U42327 Genomic DNA Translation: AAB88576.1
CCDSiCCDS17785.1 [P29533-1]
PIRiB48919 A46052
JN0581
UniGeneiMm.440909
Mm.76649

Genome annotation databases

EnsembliENSMUST00000196449; ENSMUSP00000142876; ENSMUSG00000027962 [P29533-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiVCAM1_MOUSE
AccessioniPrimary (citable) accession number: P29533
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 1, 1993
Last sequence update: April 1, 1993
Last modified: April 25, 2018
This is version 169 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health