P29475 (NOS1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 150.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Nitric oxide synthase, brain EC=1.14.13.39 Alternative name(s): Constitutive NOS NC-NOS NOS type I Neuronal NOS Short name=N-NOS Short name=nNOS Peptidyl-cysteine S-nitrosylase NOS1 bNOS | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1434 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Produces nitric oxide (NO) which is a messenger molecule with diverse functions throughout the body. In the brain and peripheral nervous system, NO displays many properties of a neurotransmitter. Probably has nitrosylase activity and mediates cysteine S-nitrosylation of cytoplasmic target proteins such SRR. |
| Catalytic activity | 2 L-arginine + 3 NADPH + 4 O2 = 2 L-citrulline + 2 nitric oxide + 3 NADP+ + 4 H2O. |
| Cofactor | Heme group. Binds 1 FAD. Binds 1 FMN. Tetrahydrobiopterin (BH4). May stabilize the dimeric form of the enzyme. |
| Enzyme regulation | Stimulated by calcium/calmodulin. Inhibited by n-Nos-inhibiting protein (PIN) which may prevent the dimerization of the protein. Inhibited by NOSIP. |
| Subunit structure | Homodimer. Interacts with DLG4; the interaction possibly being prevented by the association between NOS1 and CAPON. Forms a ternary complex with CAPON and RASD1. Forms a ternary complex with CAPON and SYN1. Interacts with ZDHHC23. Interacts with NOSIP; which may impair its synaptic location By similarity. Interacts with HTR4. Interacts with VAC14 By similarity. Interacts with SLC6A4 By similarity. |
| Subcellular location | Cell membrane › sarcolemma; Peripheral membrane protein. Cell projection › dendritic spine By similarity. Note: In skeletal muscle, it is localized beneath the sarcolemma of fast-twitch muscle fiber by associating with the dystrophin glycoprotein complex. In neurons, enriched in dendritic spines By similarity. |
| Tissue specificity | Isoform 1 is ubiquitously expressed: detected in skeletal muscle and brain, also in testis, lung and kidney, and at low levels in heart, adrenal gland and retina. Not detected in the platelets. Isoform 3 is expressed only in testis. Isoform 4 is detected in testis, skeletal muscle, lung, and kidney, at low levels in the brain, but not in the heart and adrenal gland. |
| Domain | The PDZ domain in the N-terminal part of the neuronal isoform participates in protein-protein interaction, and is responsible for targeting nNos to synaptic membranes in muscles. Mediates interaction with VAC14 By similarity. |
| Post-translational modification | Ubiquitinated; mediated by STUB1/CHIP in the presence of Hsp70 and Hsp40 (in vitro) By similarity. |
| Sequence similarities | Belongs to the NOS family. Contains 1 FAD-binding FR-type domain. Contains 1 flavodoxin-like domain. Contains 1 PDZ (DHR) domain. |
Ontologies
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] Note: Isoform 3 is produced by different alternative splicing events implicating either the untranslated exons TEX1 (TN-NOS) or TEX1B (TN-NOSB) leading to a N-terminus truncated protein which possesses enzymatic activity comparable to that of isoform 1. The C-terminal truncated isoform 4 is produced by insertion of the TEX2 exon between exons 3 and 4 of isoform 1, leading to a frameshift and a premature stop codon. | ||||||
| Isoform 1 (identifier: P29475-1) Also known as: N-NOS-1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P29475-2) Also known as: N-NOS-2; The sequence of this isoform differs from the canonical sequence as follows: 509-613: Missing. | ||||||
| Isoform 3 (identifier: P29475-3) Also known as: TN-NOS; TN-NOSB; The sequence of this isoform differs from the canonical sequence as follows: 1-336: Missing. | ||||||
| Isoform 4 (identifier: P29475-4) Also known as: TEX2-insertion; The sequence of this isoform differs from the canonical sequence as follows: 285-407: PPTSGKQSPT...TYQLKDTELI → MRKLRITEGF...PKPTWKGWKR 408-1434: Missing. | ||||||
| Isoform 5 (identifier: P29475-5) Also known as: nNOSmu; The sequence of this isoform differs from the canonical sequence as follows: 844-844: K → KYPEPLRFFPRKGPPLPNGDTEVHGLAAARDSQHR |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1434 | 1434 | Nitric oxide synthase, brain | PRO_0000170921 | |||||
Regions | |||||||||
| Domain | 17 – 99 | 83 | PDZ | ||||||
| Domain | 760 – 940 | 181 | Flavodoxin-like | ||||||
| Domain | 995 – 1242 | 248 | FAD-binding FR-type | ||||||
| Nucleotide binding | 886 – 917 | 32 | FMN By similarity | ||||||
| Nucleotide binding | 1032 – 1043 | 12 | FAD By similarity | ||||||
| Nucleotide binding | 1175 – 1185 | 11 | FAD By similarity | ||||||
| Nucleotide binding | 1250 – 1268 | 19 | NADP By similarity | ||||||
| Nucleotide binding | 1348 – 1363 | 16 | NADP By similarity | ||||||
| Region | 1 – 205 | 205 | Interaction with NOSIP By similarity | ||||||
| Region | 163 – 245 | 83 | PIN (nNOS-inhibiting protein) binding | ||||||
| Region | 730 – 750 | 21 | Calmodulin-binding Potential | ||||||
| Region | 755 – 774 | 20 | Tetrahydrobiopterin-binding By similarity | ||||||
Sites | |||||||||
| Metal binding | 420 | 1 | Iron (heme axial ligand) By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 336 | 336 | Missing in isoform 3. | VSP_003571 | |||||
| Alternative sequence | 285 – 407 | 123 | PPTSG…DTELI → MRKLRITEGFGVQRGSHNHP PPQENSPPQRMAAPPSVHAS SRSRTGRLRWFSLTPSTLRA HWKRDALSTSAWAPSCILLS MQGGLKTSAQKDSSSLSPKS LLINTIHQLKDLAPKPTWKG WKR in isoform 4. | VSP_003572 | |||||
| Alternative sequence | 408 – 1434 | 1027 | Missing in isoform 4. | VSP_003573 | |||||
| Alternative sequence | 509 – 613 | 105 | Missing in isoform 2. | VSP_003574 | |||||
| Alternative sequence | 844 | 1 | K → KYPEPLRFFPRKGPPLPNGD TEVHGLAAARDSQHR in isoform 5. | VSP_044916 | |||||
| Natural variant | 228 | 1 | P → S. Ref.6 Corresponds to variant rs9658279 [ dbSNP | Ensembl ]. | VAR_018948 | |||||
| Natural variant | 394 | 1 | D → A. Ref.6 Corresponds to variant rs9658356 [ dbSNP | Ensembl ]. | VAR_018949 | |||||
| Natural variant | 725 | 1 | N → D. Ref.6 Corresponds to variant rs9658403 [ dbSNP | Ensembl ]. | VAR_018950 | |||||
| Natural variant | 864 | 1 | G → D. Ref.6 Corresponds to variant rs9658445 [ dbSNP | Ensembl ]. | VAR_018951 | |||||
| Natural variant | 1064 | 1 | Q → R. Ref.6 Corresponds to variant rs9658482 [ dbSNP | Ensembl ]. | VAR_018952 | |||||
Experimental info | |||||||||
| Sequence conflict | 131 | 1 | K → E in AAB49040. Ref.4 | ||||||
| Sequence conflict | 178 – 184 | 7 | LAPRPPG → WPQAPR Ref.3 | ||||||
| Sequence conflict | 178 – 184 | 7 | LAPRPPG → WPQAPR Ref.4 | ||||||
| Sequence conflict | 492 – 493 | 2 | QP → HR in AAA36376. Ref.3 | ||||||
| Sequence conflict | 549 | 1 | V → L in AAA36376. Ref.3 | ||||||
| Sequence conflict | 563 | 1 | G → A in AAA36376. Ref.3 | ||||||
| Sequence conflict | 1407 | 1 | Y → I in AAA36376. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Structural organization of the human neuronal nitric oxide synthase gene (NOS1)." Hall A.V., Antoniou H., Wang Y., Cheung A.H., Arbus A.M., Olson S.L., Lu W.C., Kau C.-L., Marsden P.A. J. Biol. Chem. 269:33082-33090(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1). |
| [2] | "Expression of two types of nitric oxide synthase mRNA in human neuroblastoma cell lines." Fujisawa H., Ogura T., Kurashima Y., Yokoyama T., Yamashita J., Esumi H. J. Neurochem. 63:140-145(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). Tissue: Cerebellum. |
| [3] | "Cloned human brain nitric oxide synthase is highly expressed in skeletal muscle." Nakane M., Schmidt H.H.H.W., Pollock J.S., Foerstermann U., Murad F. FEBS Lett. 316:175-180(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Tissue: Brain. |
| [4] | "Neuronal isoform of nitric oxide synthase is expressed at low levels in human retina." Park C.-S., Gianotti C., Park R., Krishna G. Cell. Mol. Neurobiol. 16:499-515(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Retina. |
| [5] | "A novel, testis-specific mRNA transcript encoding an NH2-terminal truncated nitric-oxide synthase." Wang Y., Goligorsky M.S., Lin M., Wilcox J.N., Marsden P.A. J. Biol. Chem. 272:11392-11401(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 3 AND 4). Tissue: Testis. |
| [6] | NIEHS SNPs program Submitted (OCT-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS SER-228; ALA-394; ASP-725; ASP-864 AND ARG-1064. |
| [7] | "The finished DNA sequence of human chromosome 12." Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. Gibbs R.A.Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "Isolation and characterization of a novel, human neuronal nitric oxide synthase cDNA." Larsson B., Phillips S.C. Biochem. Biophys. Res. Commun. 251:898-902(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 835-901 (ISOFORM 5), ALTERNATIVE SPLICING. Tissue: Skeletal muscle. |
| + | Additional computationally mapped references. |
Web resources
| NIEHS-SNPs |
| Wikipedia Nitric oxide synthase entry |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U17327 mRNA. Translation: AAA62405.1. U17326 U17325 Genomic DNA. Translation: AAB60654.1. Sequence problems.D16408 mRNA. Translation: BAA03895.1. L02881 mRNA. Translation: AAA36376.1. U31466 mRNA. Translation: AAB49040.1. U66362 Genomic DNA. No translation available. AY445095 Genomic DNA. Translation: AAR07069.1. AC026364 Genomic DNA. No translation available. AC068799 Genomic DNA. No translation available. AC073864 Genomic DNA. No translation available. AJ004918 mRNA. Translation: CAA06218.1. |
| IPI | IPI00216232. IPI00217225. IPI00472618. IPI00746356. IPI00795843. |
| PIR | G01946. |
| RefSeq | NP_000611.1. NM_000620.4. NP_001191142.1. NM_001204213.1. NP_001191143.1. NM_001204214.1. NP_001191147.1. NM_001204218.1. |
| UniGene | Hs.654410. Hs.684465. Hs.684466. Hs.684467. Hs.735734. |
3D structure databases | |
| ProteinModelPortal | P29475. |
| ModBase | Search... |
Protein-protein interaction databases | |
| MINT | MINT-122019. |
| STRING | 9606.ENSP00000320758. |
PTM databases | |
| PhosphoSite | P29475. |
Polymorphism databases | |
| DMDM | 1709333. |
Proteomic databases | |
| PaxDb | P29475. |
| PRIDE | P29475. |
Protocols and materials databases | |
| DNASU | 4842. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000317775; ENSP00000320758; ENSG00000089250. ENST00000338101; ENSP00000337459; ENSG00000089250. |
| GeneID | 4842. |
| KEGG | hsa:4842. |
| UCSC | uc001twm.2. human. uc001twn.2. human. |
Organism-specific databases | |
| CTD | 4842. |
| GeneCards | GC12M117636. |
| HGNC | HGNC:7872. NOS1. |
| HPA | CAB002167. |
| MIM | 163731. gene. |
| neXtProt | NX_P29475. |
| PharmGKB | PA252. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG4362. |
| HOGENOM | HOG000220884. |
| HOVERGEN | HBG000159. |
| KO | K13240. |
| OMA | QVPCILI. |
| OrthoDB | EOG4MKNFC. |
Enzyme and pathway databases | |
| BioCyc | MetaCyc:HS01647-MONOMER. |
| Reactome | REACT_116125. Disease. REACT_604. Hemostasis. |
Gene expression databases | |
| ArrayExpress | P29475. |
| Bgee | P29475. |
| CleanEx | HS_NOS1. |
| Genevestigator | P29475. |
| GermOnline | ENSG00000089250. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.20.990.10. 1 hit. 3.90.340.10. 1 hit. |
| InterPro | IPR003097. FAD-binding_1. IPR017927. Fd_Rdtase_FAD-bd. IPR001094. Flavdoxin. IPR008254. Flavodoxin/NO_synth. IPR001709. Flavoprot_Pyr_Nucl_cyt_Rdtase. IPR023173. NADPH_Cyt_P450_Rdtase_dom3. IPR004030. NO_synthase_oxygenase_dom. IPR026009. NOS. IPR012144. NOS_met. IPR001433. OxRdtase_FAD/NAD-bd. IPR001478. PDZ. IPR017938. Riboflavin_synthase-like_b-brl. [Graphical view] |
| PANTHER | PTHR19384:SF5. PTHR19384:SF5. 1 hit. |
| Pfam | PF00667. FAD_binding_1. 1 hit. PF00258. Flavodoxin_1. 1 hit. PF00175. NAD_binding_1. 1 hit. PF02898. NO_synthase. 1 hit. PF00595. PDZ. 1 hit. [Graphical view] |
| PIRSF | PIRSF000333. NOS. 1 hit. |
| PRINTS | PR00369. FLAVODOXIN. PR00371. FPNCR. |
| SMART | SM00228. PDZ. 1 hit. [Graphical view] |
| SUPFAM | SSF56512. NO_synthase_oxygenase_reg. 1 hit. SSF50156. PDZ. 1 hit. SSF63380. Riboflavin_synthase_like_b-brl. 1 hit. |
| PROSITE | PS51384. FAD_FR. 1 hit. PS50902. FLAVODOXIN_LIKE. 1 hit. PS60001. NOS. 1 hit. PS50106. PDZ. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | P29475. |
| ChEMBL | CHEMBL3568. |
| ChiTaRS | NOS1. human. |
| DrugBank | DB00155. L-Citrulline. |
| GenomeRNAi | 4842. |
| NextBio | 18658. |
| PMAP-CutDB | P29475. |
| SOURCE | Search... |
Entry information
| Entry name | NOS1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P29475 Secondary accession number(s): E9PH30, O75713 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
