Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nitric oxide synthase, brain

Gene

NOS1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Produces nitric oxide (NO) which is a messenger molecule with diverse functions throughout the body. In the brain and peripheral nervous system, NO displays many properties of a neurotransmitter. Probably has nitrosylase activity and mediates cysteine S-nitrosylation of cytoplasmic target proteins such SRR.

Catalytic activityi

2 L-arginine + 3 NADPH + 4 O2 = 2 L-citrulline + 2 nitric oxide + 3 NADP+ + 4 H2O.

Cofactori

Protein has several cofactor binding sites:

Enzyme regulationi

Stimulated by calcium/calmodulin. Inhibited by n-Nos-inhibiting protein (PIN) which may prevent the dimerization of the protein. Inhibited by NOSIP.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi420Iron (heme axial ligand)By similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi886 – 917FMNPROSITE-ProRule annotationAdd BLAST32
Nucleotide bindingi1032 – 1043FADBy similarityAdd BLAST12
Nucleotide bindingi1175 – 1185FADBy similarityAdd BLAST11
Nucleotide bindingi1250 – 1268NADPBy similarityAdd BLAST19
Nucleotide bindingi1348 – 1363NADPBy similarityAdd BLAST16

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionCalmodulin-binding, Oxidoreductase
LigandFAD, Flavoprotein, FMN, Heme, Iron, Metal-binding, NADP

Enzyme and pathway databases

BioCyciMetaCyc:HS01647-MONOMER
BRENDAi1.14.13.39 2681
ReactomeiR-HSA-1222556 ROS, RNS production in phagocytes
R-HSA-392154 Nitric oxide stimulates guanylate cyclase
R-HSA-5578775 Ion homeostasis
SIGNORiP29475

Names & Taxonomyi

Protein namesi
Recommended name:
Nitric oxide synthase, brain (EC:1.14.13.39)
Alternative name(s):
Constitutive NOS
NC-NOS
NOS type I
Neuronal NOS
Short name:
N-NOS
Short name:
nNOS
Peptidyl-cysteine S-nitrosylase NOS1
bNOS
Gene namesi
Name:NOS1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

EuPathDBiHostDB:ENSG00000089250.18
HGNCiHGNC:7872 NOS1
MIMi163731 gene
neXtProtiNX_P29475

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cell projection, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi4842
MalaCardsiNOS1
OpenTargetsiENSG00000089250
PharmGKBiPA252

Chemistry databases

ChEMBLiCHEMBL3568
DrugBankiDB03461 2'-Monophosphoadenosine 5'-Diphosphoribose
DB01997 3-Bromo-7-Nitroindazole
DB03892 5-N-Allyl-Arginine
DB00997 Doxorubicin
DB03147 Flavin adenine dinucleotide
DB01942 Formic Acid
DB00155 L-Citrulline
DB02077 L-N(Omega)-Nitroarginine-(4r)-Amino-L-Proline Amide
DB09241 Methylene blue
DB02044 N-(3-(Aminomethyl)Benzyl)Acetamidine
DB03449 N-(4-(2-((3-Chlorophenylmethyl)Amino)Ethyl)Phenyl)-2-Thiophecarboxamidine
DB02727 N-Butyl-N'-Hydroxyguanidine
DB02143 N-Isopropyl-N'-Hydroxyguanidine
DB03144 N-Omega-Hydroxy-L-Arginine
DB02644 N-Omega-Propyl-L-Arginine
DB02027 N-{(4s)-4-Amino-5-[(2-Aminoethyl)Amino]Pentyl}-N'-Nitroguanidine
DB03710 N5-(1-Imino-3-Butenyl)-L-Ornithine
DB04223 Nitroarginine
DB06096 NXN-188
DB03247 Riboflavin Monophosphate
DB02991 S-Ethyl-N-[4-(Trifluoromethyl)Phenyl]Isothiourea
DB03707 S-Ethyl-N-Phenyl-Isothiourea
GuidetoPHARMACOLOGYi1251

Polymorphism and mutation databases

BioMutaiNOS1
DMDMi1709333

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001709211 – 1434Nitric oxide synthase, brainAdd BLAST1434

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei852PhosphoserineBy similarity1
Modified residuei862PhosphoserineBy similarity1
Modified residuei863PhosphoserineBy similarity1

Post-translational modificationi

Ubiquitinated; mediated by STUB1/CHIP in the presence of Hsp70 and Hsp40 (in vitro).By similarity

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQBiP29475
PaxDbiP29475
PeptideAtlasiP29475
PRIDEiP29475

PTM databases

iPTMnetiP29475
PhosphoSitePlusiP29475

Miscellaneous databases

PMAP-CutDBiP29475

Expressioni

Tissue specificityi

Isoform 1 is ubiquitously expressed: detected in skeletal muscle and brain, also in testis, lung and kidney, and at low levels in heart, adrenal gland and retina. Not detected in the platelets. Isoform 3 is expressed only in testis. Isoform 4 is detected in testis, skeletal muscle, lung, and kidney, at low levels in the brain, but not in the heart and adrenal gland.

Gene expression databases

BgeeiENSG00000089250
CleanExiHS_NOS1
ExpressionAtlasiP29475 baseline and differential
GenevisibleiP29475 HS

Organism-specific databases

HPAiCAB002167
HPA058312

Interactioni

Subunit structurei

Homodimer. Interacts with DLG4; the interaction possibly being prevented by the association between NOS1 and CAPON. Forms a ternary complex with CAPON and RASD1. Forms a ternary complex with CAPON and SYN1. Interacts with ZDHHC23. Interacts with NOSIP; which may impair its synaptic location (By similarity). Interacts with HTR4. Interacts with VAC14 (By similarity). Interacts with SLC6A4 (By similarity). Interacts (via N-terminal domain) with DLG4 (via N-terminal tandem pair of PDZ domains) (By similarity).By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
VAC14Q08AM65EBI-7164065,EBI-2107455

GO - Molecular functioni

Protein-protein interaction databases

BioGridi11090515 interactors.
CORUMiP29475
DIPiDIP-40999N
IntActiP29475 4 interactors.
MINTiP29475
STRINGi9606.ENSP00000337459

Chemistry databases

BindingDBiP29475

Structurei

Secondary structure

11434
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi306 – 310Combined sources5
Turni311 – 313Combined sources3
Beta strandi316 – 319Combined sources4
Helixi321 – 324Combined sources4
Beta strandi333 – 336Combined sources4
Helixi356 – 373Combined sources18
Helixi380 – 396Combined sources17
Helixi403 – 415Combined sources13
Helixi423 – 425Combined sources3
Beta strandi430 – 433Combined sources4
Helixi440 – 455Combined sources16
Helixi456 – 458Combined sources3
Beta strandi463 – 466Combined sources4
Beta strandi471 – 475Combined sources5
Beta strandi481 – 485Combined sources5
Beta strandi489 – 491Combined sources3
Beta strandi497 – 499Combined sources3
Helixi501 – 503Combined sources3
Helixi504 – 512Combined sources9
Beta strandi520 – 522Combined sources3
Beta strandi527 – 530Combined sources4
Beta strandi537 – 539Combined sources3
Helixi543 – 545Combined sources3
Beta strandi548 – 550Combined sources3
Helixi557 – 562Combined sources6
Beta strandi565 – 568Combined sources4
Beta strandi576 – 579Combined sources4
Beta strandi582 – 585Combined sources4
Helixi595 – 599Combined sources5
Helixi601 – 604Combined sources4
Turni606 – 609Combined sources4
Helixi612 – 618Combined sources7
Helixi626 – 628Combined sources3
Helixi630 – 648Combined sources19
Helixi656 – 674Combined sources19
Helixi681 – 684Combined sources4
Beta strandi687 – 689Combined sources3
Helixi690 – 692Combined sources3
Helixi694 – 697Combined sources4
Beta strandi706 – 710Combined sources5
Helixi715 – 718Combined sources4

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4D1NX-ray2.03A/B/C/D302-721[»]
4UCHX-ray2.20A/B302-723[»]
4UH5X-ray1.98A/B302-722[»]
4UH6X-ray1.98A/B302-722[»]
4V3UX-ray2.30A/B/C/D302-721[»]
5ADFX-ray1.97A/B302-722[»]
5ADGX-ray1.98A/B302-722[»]
5ADIX-ray2.20A/B302-722[»]
5FVUX-ray2.22A/B302-722[»]
5FVVX-ray2.05A/B302-722[»]
5FVWX-ray2.20A/B302-722[»]
5FVXX-ray2.30A/B302-722[»]
5UO1X-ray1.90A/B302-722[»]
5UO2X-ray1.95A/B302-722[»]
5UO3X-ray2.20A/B302-722[»]
5UO4X-ray2.00A/B302-722[»]
5UO5X-ray2.00A/B302-722[»]
5UO6X-ray1.96A/B302-722[»]
5UO7X-ray2.06A/B302-722[»]
5VUVX-ray1.98A/B302-722[»]
5VUWX-ray2.03A/B302-722[»]
5VUXX-ray2.30A/B302-722[»]
5VUYX-ray2.15A/B302-722[»]
5VUZX-ray1.97A/B302-722[»]
5VV0X-ray1.80A/B302-722[»]
5VV1X-ray1.95A/B302-722[»]
5VV2X-ray2.00A/B302-722[»]
5VV3X-ray2.18A/B302-722[»]
5VV4X-ray2.10A/B302-722[»]
5VV5X-ray2.15A/B302-722[»]
ProteinModelPortaliP29475
SMRiP29475
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini17 – 99PDZPROSITE-ProRule annotationAdd BLAST83
Domaini760 – 940Flavodoxin-likePROSITE-ProRule annotationAdd BLAST181
Domaini995 – 1242FAD-binding FR-typePROSITE-ProRule annotationAdd BLAST248

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 205Interaction with NOSIPBy similarityAdd BLAST205
Regioni163 – 245PIN (nNOS-inhibiting protein) bindingAdd BLAST83
Regioni730 – 750Calmodulin-bindingSequence analysisAdd BLAST21
Regioni755 – 774Tetrahydrobiopterin-bindingBy similarityAdd BLAST20

Domaini

The PDZ domain in the N-terminal part of the neuronal isoform participates in protein-protein interaction, and is responsible for targeting nNos to synaptic membranes in muscles. Mediates interaction with VAC14 (By similarity).By similarity

Sequence similaritiesi

Belongs to the NOS family.Curated

Phylogenomic databases

eggNOGiKOG1158 Eukaryota
COG0369 LUCA
COG4362 LUCA
GeneTreeiENSGT00840000129757
HOGENOMiHOG000220884
HOVERGENiHBG000159
InParanoidiP29475
KOiK13240
OMAiDDNRYHE
OrthoDBiEOG091G10Z0
PhylomeDBiP29475
TreeFamiTF324410

Family and domain databases

Gene3Di1.20.990.101 hit
3.40.50.3601 hit
InterProiView protein in InterPro
IPR003097 FAD-binding_1
IPR017927 Fd_Rdtase_FAD-bd
IPR001094 Flavdoxin-like
IPR008254 Flavodoxin/NO_synth
IPR001709 Flavoprot_Pyr_Nucl_cyt_Rdtase
IPR029039 Flavoprotein-like_sf
IPR023173 NADPH_Cyt_P450_Rdtase_alpha
IPR012144 NOS_euk
IPR004030 NOS_N
IPR036119 NOS_N_sf
IPR001433 OxRdtase_FAD/NAD-bd
IPR001478 PDZ
IPR036034 PDZ_sf
IPR017938 Riboflavin_synthase-like_b-brl
PfamiView protein in Pfam
PF00667 FAD_binding_1, 1 hit
PF00258 Flavodoxin_1, 1 hit
PF00175 NAD_binding_1, 1 hit
PF02898 NO_synthase, 1 hit
PF00595 PDZ, 1 hit
PIRSFiPIRSF000333 NOS, 1 hit
PRINTSiPR00369 FLAVODOXIN
PR00371 FPNCR
SMARTiView protein in SMART
SM00228 PDZ, 1 hit
SUPFAMiSSF50156 SSF50156, 1 hit
SSF52218 SSF52218, 1 hit
SSF56512 SSF56512, 1 hit
SSF63380 SSF63380, 1 hit
PROSITEiView protein in PROSITE
PS51384 FAD_FR, 1 hit
PS50902 FLAVODOXIN_LIKE, 1 hit
PS60001 NOS, 1 hit
PS50106 PDZ, 1 hit

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Isoform 3 is produced by different alternative splicing events implicating either the untranslated exons TEX1 (TN-NOS) or TEX1B (TN-NOSB) leading to a N-terminally truncated protein which possesses enzymatic activity comparable to that of isoform 1. The C-terminally truncated isoform 4 is produced by insertion of the TEX2 exon between exons 3 and 4 of isoform 1, leading to a frameshift and a premature stop codon.1 Publication
Isoform 1 (identifier: P29475-1) [UniParc]FASTAAdd to basket
Also known as: N-NOS-1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEDHMFGVQQ IQPNVISVRL FKRKVGGLGF LVKERVSKPP VIISDLIRGG
60 70 80 90 100
AAEQSGLIQA GDIILAVNGR PLVDLSYDSA LEVLRGIASE THVVLILRGP
110 120 130 140 150
EGFTTHLETT FTGDGTPKTI RVTQPLGPPT KAVDLSHQPP AGKEQPLAVD
160 170 180 190 200
GASGPGNGPQ HAYDDGQEAG SLPHANGLAP RPPGQDPAKK ATRVSLQGRG
210 220 230 240 250
ENNELLKEIE PVLSLLTSGS RGVKGGAPAK AEMKDMGIQV DRDLDGKSHK
260 270 280 290 300
PLPLGVENDR VFNDLWGKGN VPVVLNNPYS EKEQPPTSGK QSPTKNGSPS
310 320 330 340 350
KCPRFLKVKN WETEVVLTDT LHLKSTLETG CTEYICMGSI MHPSQHARRP
360 370 380 390 400
EDVRTKGQLF PLAKEFIDQY YSSIKRFGSK AHMERLEEVN KEIDTTSTYQ
410 420 430 440 450
LKDTELIYGA KHAWRNASRC VGRIQWSKLQ VFDARDCTTA HGMFNYICNH
460 470 480 490 500
VKYATNKGNL RSAITIFPQR TDGKHDFRVW NSQLIRYAGY KQPDGSTLGD
510 520 530 540 550
PANVQFTEIC IQQGWKPPRG RFDVLPLLLQ ANGNDPELFQ IPPELVLEVP
560 570 580 590 600
IRHPKFEWFK DLGLKWYGLP AVSNMLLEIG GLEFSACPFS GWYMGTEIGV
610 620 630 640 650
RDYCDNSRYN ILEEVAKKMN LDMRKTSSLW KDQALVEINI AVLYSFQSDK
660 670 680 690 700
VTIVDHHSAT ESFIKHMENE YRCRGGCPAD WVWIVPPMSG SITPVFHQEM
710 720 730 740 750
LNYRLTPSFE YQPDPWNTHV WKGTNGTPTK RRAIGFKKLA EAVKFSAKLM
760 770 780 790 800
GQAMAKRVKA TILYATETGK SQAYAKTLCE IFKHAFDAKV MSMEEYDIVH
810 820 830 840 850
LEHETLVLVV TSTFGNGDPP ENGEKFGCAL MEMRHPNSVQ EERKSYKVRF
860 870 880 890 900
NSVSSYSDSQ KSSGDGPDLR DNFESAGPLA NVRFSVFGLG SRAYPHFCAF
910 920 930 940 950
GHAVDTLLEE LGGERILKMR EGDELCGQEE AFRTWAKKVF KAACDVFCVG
960 970 980 990 1000
DDVNIEKANN SLISNDRSWK RNKFRLTFVA EAPELTQGLS NVHKKRVSAA
1010 1020 1030 1040 1050
RLLSRQNLQS PKSSRSTIFV RLHTNGSQEL QYQPGDHLGV FPGNHEDLVN
1060 1070 1080 1090 1100
ALIERLEDAP PVNQMVKVEL LEERNTALGV ISNWTDELRL PPCTIFQAFK
1110 1120 1130 1140 1150
YYLDITTPPT PLQLQQFASL ATSEKEKQRL LVLSKGLQEY EEWKWGKNPT
1160 1170 1180 1190 1200
IVEVLEEFPS IQMPATLLLT QLSLLQPRYY SISSSPDMYP DEVHLTVAIV
1210 1220 1230 1240 1250
SYRTRDGEGP IHHGVCSSWL NRIQADELVP CFVRGAPSFH LPRNPQVPCI
1260 1270 1280 1290 1300
LVGPGTGIAP FRSFWQQRQF DIQHKGMNPC PMVLVFGCRQ SKIDHIYREE
1310 1320 1330 1340 1350
TLQAKNKGVF RELYTAYSRE PDKPKKYVQD ILQEQLAESV YRALKEQGGH
1360 1370 1380 1390 1400
IYVCGDVTMA ADVLKAIQRI MTQQGKLSAE DAGVFISRMR DDNRYHEDIF
1410 1420 1430
GVTLRTYEVT NRLRSESIAF IEESKKDTDE VFSS
Length:1,434
Mass (Da):160,970
Last modified:October 1, 1996 - v2
Checksum:i99235793B953BF37
GO
Isoform 2 (identifier: P29475-2) [UniParc]FASTAAdd to basket
Also known as: N-NOS-2

The sequence of this isoform differs from the canonical sequence as follows:
     509-613: Missing.

Show »
Length:1,329
Mass (Da):148,919
Checksum:iDF791B80FDB12302
GO
Isoform 3 (identifier: P29475-3) [UniParc]FASTAAdd to basket
Also known as: TN-NOS, TN-NOSB

The sequence of this isoform differs from the canonical sequence as follows:
     1-336: Missing.

Show »
Length:1,098
Mass (Da):125,113
Checksum:iA1CD5C5012436233
GO
Isoform 4 (identifier: P29475-4) [UniParc]FASTAAdd to basket
Also known as: TEX2-insertion

The sequence of this isoform differs from the canonical sequence as follows:
     285-407: PPTSGKQSPT...TYQLKDTELI → MRKLRITEGF...PKPTWKGWKR
     408-1434: Missing.

Show »
Length:407
Mass (Da):43,838
Checksum:i7E9420C658EFACD2
GO
Isoform 5 (identifier: P29475-5) [UniParc]FASTAAdd to basket
Also known as: nNOSmu

The sequence of this isoform differs from the canonical sequence as follows:
     844-844: K → KYPEPLRFFPRKGPPLPNGDTEVHGLAAARDSQHR

Show »
Length:1,468
Mass (Da):164,779
Checksum:i95906AC90699A0E2
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti131K → E in AAB49040 (PubMed:8879752).Curated1
Sequence conflicti178 – 184LAPRPPG → WPQAPR (PubMed:7678401).Curated7
Sequence conflicti178 – 184LAPRPPG → WPQAPR (PubMed:8879752).Curated7
Sequence conflicti492 – 493QP → HR in AAA36376 (PubMed:7678401).Curated2
Sequence conflicti549V → L in AAA36376 (PubMed:7678401).Curated1
Sequence conflicti563G → A in AAA36376 (PubMed:7678401).Curated1
Sequence conflicti1407Y → I in AAA36376 (PubMed:7678401).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_018948228P → S1 PublicationCorresponds to variant dbSNP:rs9658279Ensembl.1
Natural variantiVAR_018949394D → A1 PublicationCorresponds to variant dbSNP:rs9658356Ensembl.1
Natural variantiVAR_018950725N → D1 PublicationCorresponds to variant dbSNP:rs9658403Ensembl.1
Natural variantiVAR_018951864G → D1 PublicationCorresponds to variant dbSNP:rs9658445Ensembl.1
Natural variantiVAR_0189521064Q → R1 PublicationCorresponds to variant dbSNP:rs9658482Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0035711 – 336Missing in isoform 3. CuratedAdd BLAST336
Alternative sequenceiVSP_003572285 – 407PPTSG…DTELI → MRKLRITEGFGVQRGSHNHP PPQENSPPQRMAAPPSVHAS SRSRTGRLRWFSLTPSTLRA HWKRDALSTSAWAPSCILLS MQGGLKTSAQKDSSSLSPKS LLINTIHQLKDLAPKPTWKG WKR in isoform 4. CuratedAdd BLAST123
Alternative sequenceiVSP_003573408 – 1434Missing in isoform 4. CuratedAdd BLAST1027
Alternative sequenceiVSP_003574509 – 613Missing in isoform 2. 2 PublicationsAdd BLAST105
Alternative sequenceiVSP_044916844K → KYPEPLRFFPRKGPPLPNGD TEVHGLAAARDSQHR in isoform 5. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U17327 mRNA Translation: AAA62405.1
U17326
, U17299, U17300, U17301, U17302, U17303, U17304, U17305, U17307, U17308, U17309, U17310, U17311, U17312, U17313, U17314, U17315, U17316, U17317, U17318, U17319, U17320, U17321, U17322, U17323, U17324, U17325 Genomic DNA Translation: AAB60654.1 Sequence problems.
D16408 mRNA Translation: BAA03895.1
L02881 mRNA Translation: AAA36376.1
U31466 mRNA Translation: AAB49040.1
U66362 Genomic DNA No translation available.
AY445095 Genomic DNA Translation: AAR07069.1
AC026364 Genomic DNA No translation available.
AC068799 Genomic DNA No translation available.
AC073864 Genomic DNA No translation available.
AJ004918 mRNA Translation: CAA06218.1
CCDSiCCDS41842.1 [P29475-1]
CCDS55890.1 [P29475-5]
PIRiG01946
RefSeqiNP_000611.1, NM_000620.4 [P29475-1]
NP_001191142.1, NM_001204213.1 [P29475-3]
NP_001191143.1, NM_001204214.1 [P29475-3]
NP_001191147.1, NM_001204218.1 [P29475-5]
XP_011536700.1, XM_011538398.2 [P29475-5]
XP_016874834.1, XM_017019345.1 [P29475-5]
XP_016874835.1, XM_017019346.1 [P29475-5]
XP_016874836.1, XM_017019347.1 [P29475-1]
UniGeneiHs.654410
Hs.684465
Hs.684466
Hs.684467
Hs.735734

Genome annotation databases

EnsembliENST00000317775; ENSP00000320758; ENSG00000089250 [P29475-1]
ENST00000338101; ENSP00000337459; ENSG00000089250 [P29475-5]
ENST00000618760; ENSP00000477999; ENSG00000089250 [P29475-5]
GeneIDi4842
KEGGihsa:4842
UCSCiuc001twm.3 human [P29475-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiNOS1_HUMAN
AccessioniPrimary (citable) accession number: P29475
Secondary accession number(s): E9PH30, O75713
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 1, 1993
Last sequence update: October 1, 1996
Last modified: April 25, 2018
This is version 202 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome