P29474 (NOS3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 164.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Nitric oxide synthase, endothelial EC=1.14.13.39 Alternative name(s): Constitutive NOS Short name=cNOS EC-NOS Endothelial NOS Short name=eNOS NOS type III Short name=NOSIII | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1203 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Produces nitric oxide (NO) which is implicated in vascular smooth muscle relaxation through a cGMP-mediated signal transduction pathway. NO mediates vascular endothelial growth factor (VEGF)-induced angiogenesis in coronary vessels and promotes blood clotting through the activation of platelets. Ref.7 Isoform eNOS13C: Lacks eNOS activity, dominant-negative form that may down-regulate eNOS activity by forming heterodimers with isoform 1. Ref.7 |
| Catalytic activity | 2 L-arginine + 3 NADPH + 4 O2 = 2 L-citrulline + 2 nitric oxide + 3 NADP+ + 4 H2O. |
| Cofactor | Heme group. Binds 1 FAD. Binds 1 FMN. Tetrahydrobiopterin (BH4). May stabilize the dimeric form of the enzyme. |
| Enzyme regulation | Stimulated by calcium/calmodulin. Inhibited by NOSIP and NOSTRIN. Ref.20 Ref.21 |
| Subunit structure | |
| Subcellular location | Cell membrane. Membrane › caveola. Cytoplasm › cytoskeleton. Golgi apparatus. Note: Specifically associates with actin cytoskeleton in the G2 phase of the cell cycle; which is favored by interaction with NOSIP and results in a reduced enzymatic activity. Ref.20 Ref.21 Ref.23 Ref.24 |
| Tissue specificity | Platelets, placenta, liver and kidney. Ref.19 |
| Post-translational modification | Phosphorylation by AMPK at Ser-1177 in the presence of Ca2+-calmodulin (CaM) activates activity. In absence of Ca2+-calmodulin, AMPK also phosphorylates Thr-495, resulting in inhibition of activity By similarity. Phosphorylation of Ser-114 by CDK5 reduces activity. |
| Polymorphism | Variation in NOS3 seem to be associated with susceptibility to coronary spasm. |
| Sequence similarities | Belongs to the NOS family. Contains 1 FAD-binding FR-type domain. Contains 1 flavodoxin-like domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| CDC37 | Q16543 | 4 | EBI-1391623,EBI-295634 | |
| NOSTRIN | Q8IVI9 | 7 | EBI-1391623,EBI-1391643 | |
| ST13 | P50502 | 3 | EBI-1391623,EBI-357285 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P29474-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform eNOS13C (identifier: P29474-2) The sequence of this isoform differs from the canonical sequence as follows: 584-625: ESFAAALMEM...ISCSDPLVSS → EGLTLWPRLE...VGTTGACHDA 626-1203: Missing. | ||||||
| Note: Lacks eNOS activity. | ||||||
| Isoform eNOS13B (identifier: P29474-3) The sequence of this isoform differs from the canonical sequence as follows: 585-614: SFAAALMEMSGPYNSSPRPEQHKSYKIRFN → RWGFAMLPRLVSNSWVQAIHLPRPPKVLRL 615-1203: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1203 | 1203 | Nitric oxide synthase, endothelial | PRO_0000170943 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 520 – 703 | 184 | Flavodoxin-like | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 756 – 1002 | 247 | FAD-binding FR-type | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 649 – 680 | 32 | FMN By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 793 – 804 | 12 | FAD By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 935 – 945 | 11 | FAD By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 1010 – 1028 | 19 | NADP By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 1108 – 1123 | 16 | NADP By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 98 – 486 | 389 | Interaction with NOSIP | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 491 – 510 | 20 | Calmodulin-binding Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 94 | 1 | Zinc | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 99 | 1 | Zinc | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 184 | 1 | Iron (heme axial ligand) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 114 | 1 | Phosphoserine; by CDK5 Ref.25 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 141 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 495 | 1 | Phosphothreonine; by AMPK Ref.22 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 633 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1175 | 1 | Phosphothreonine By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1177 | 1 | Phosphoserine; by AMPK Ref.22 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Lipidation | 2 | 1 | N-myristoyl glycine By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Lipidation | 15 | 1 | S-palmitoyl cysteine By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Lipidation | 26 | 1 | S-palmitoyl cysteine By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 584 – 625 | 42 | ESFAA…PLVSS → EGLTLWPRLECSSTITAHCS LNLLDSSNPPTSTSQVVGTT GACHDA in isoform eNOS13C. | VSP_042625 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 585 – 614 | 30 | SFAAA…KIRFN → RWGFAMLPRLVSNSWVQAIH LPRPPKVLRL in isoform eNOS13B. | VSP_045495 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 615 – 1203 | 589 | Missing in isoform eNOS13B. | VSP_045496 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 626 – 1203 | 578 | Missing in isoform eNOS13C. | VSP_042626 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 112 | 1 | R → Q. Ref.12 Corresponds to variant rs3918166 [ dbSNP | Ensembl ]. | VAR_031218 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 298 | 1 | E → D in susceptibility to coronary spasm. Ref.7 Ref.10 Ref.12 Ref.16 Ref.29 Ref.30 Corresponds to variant rs1799983 [ dbSNP | Ensembl ]. | VAR_008037 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 474 | 1 | R → C in a colorectal cancer sample; somatic mutation. Ref.31 | VAR_036303 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 602 | 1 | R → Q in a colorectal cancer sample; somatic mutation. Ref.31 | VAR_036304 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 665 | 1 | R → H. Corresponds to variant rs7792133 [ dbSNP | Ensembl ]. | VAR_061377 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 827 | 1 | V → M. Ref.12 Corresponds to variant rs3918232 [ dbSNP | Ensembl ]. | VAR_031219 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 885 | 1 | R → M. Ref.12 Corresponds to variant rs3918201 [ dbSNP | Ensembl ]. | VAR_031220 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 982 | 1 | Q → L. Ref.12 Corresponds to variant rs3918234 [ dbSNP | Ensembl ]. | VAR_031221 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 114 | 1 | S → A: Reduced nitrite (NO) production. Ref.25 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 53 | 1 | S → R in AAA36373. Ref.17 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 168 | 1 | S → G in BAG37648. Ref.10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 414 | 1 | K → R in BAF85617. Ref.10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 489 | 1 | G → S in AAD14336. Ref.18 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 567 | 1 | V → W in CAA53950. Ref.5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1150 | 1 | R → RQ in BAA05652. Ref.6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1194 | 1 | D → E in CAA53950. Ref.5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 70 – 73 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 74 – 76 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 79 – 81 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 85 – 87 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 88 – 90 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 121 – 137 | 17 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 144 – 160 | 17 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 167 – 180 | 14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 187 – 189 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 194 – 197 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 204 – 219 | 16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 220 – 222 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 227 – 230 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 236 – 238 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 245 – 249 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 253 – 255 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 261 – 263 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 265 – 267 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 268 – 276 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 284 – 286 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 291 – 294 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 301 – 303 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 307 – 309 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 312 – 314 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 321 – 326 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 329 – 332 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 340 – 343 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 346 – 349 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 359 – 363 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 365 – 368 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 370 – 373 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 376 – 382 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 390 – 392 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 394 – 413 | 20 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 420 – 438 | 19 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 445 – 448 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 451 – 453 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 454 – 456 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 458 – 461 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 470 – 474 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 497 – 505 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and expression of a cDNA encoding human endothelium-derived relaxing factor/nitric oxide synthase." Janssens S.P., Shimouchi A., Quertermous T., Bloch D.B., Bloch K.D. J. Biol. Chem. 267:14519-14522(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | Erratum Janssens S.P., Shimouchi A., Quertermous T., Bloch D.B., Bloch K.D. J. Biol. Chem. 267:22694-22694(1992) |
| [3] | "Molecular cloning and characterization of human endothelial nitric oxide synthase." Marsden P.A., Schappert K.T., Chen H.S., Flowers M., Sundell C.L., Wilcox J.N., Lamas S., Michel T. FEBS Lett. 307:287-293(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [4] | "Structure and chromosomal localization of the human constitutive endothelial nitric oxide synthase gene." Marsden P.A., Heng H.H.Q., Scherer S.W., Stewart R.J., Hall A.V., Shi X.-M., Tsui L.-C., Schappert K.T. J. Biol. Chem. 268:17478-17488(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [5] | "Gene structure, polymorphism and mapping of the human endothelial nitric oxide synthase gene." Nadaud S.A., Bonnardeaux A., Lathrop M., Soubrier F. Biochem. Biophys. Res. Commun. 198:1027-1033(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. Tissue: Placenta. |
| [6] | "Cloning and structural characterization of the human endothelial nitric-oxide-synthase gene." Miyahara K., Kawamoto T., Sase K., Yui Y., Toda K., Yang L.X., Hattori R., Aoyama T., Yamamoto Y., Doi Y., Ogoshi S., Hashimoto K., Kawai C., Sasayama S., Shizuta Y. Eur. J. Biochem. 223:719-726(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [7] | "Alternative splicing in intron 13 of the human eNOS gene: a potential mechanism for regulating eNOS activity." Lorenz M., Hewing B., Hui J., Zepp A., Baumann G., Bindereif A., Stangl V., Stangl K. FASEB J. 21:1556-1564(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ENOS13B AND ENOS13C), ALTERNATIVE SPLICING, FUNCTION (ISOFORM ENOS13C), VARIANT ASP-298. |
| [8] | Liao J.K. Submitted (DEC-1993) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. Tissue: Umbilical vein. |
| [9] | "The role of phosphatidylinositol-3-oh kinase in platelet-derived nitric oxide release and platelet disaggregation." Zhang Y., Freedman J.E. Submitted (JUL-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Platelet. |
| [10] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ASP-298. Tissue: Hippocampus and Trachea. |
| [11] | Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S. Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Spleen. |
| [12] | SeattleSNPs variation discovery resource Submitted (JUN-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS GLN-112; ASP-298; MET-827; MET-885 AND LEU-982. |
| [13] | NHLBI resequencing and genotyping service (RS&G) Submitted (DEC-2007) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [14] | "The DNA sequence of human chromosome 7." Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. Wilson R.K.Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [15] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [16] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ASP-298. Tissue: Placenta. |
| [17] | "Isolation and chromosomal localization of the human endothelial nitric oxide synthase (NOS3) gene." Robinson L.J., Weremowicz S., Morton C.C., Michel T. Genomics 19:350-357(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-53. Tissue: Placenta. |
| [18] | "Expression of constitutive endothelial nitric oxide synthase in human blood platelets." Sase K., Michel T. Life Sci. 57:2049-2055(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 411-528 (ISOFORM 1/ENOS13C). Tissue: Platelet. |
| [19] | "Purification and characterization of the constitutive nitric oxide synthase from human placenta." Garvey E.P., Tuttle J.V., Covington K., Merrill B.M., Wood E.R., Baylis S.A., Charles I.G. Arch. Biochem. Biophys. 311:235-241(1994) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 167-175; 531-540; 835-845; 876-881; 886-898; 1001-1005 AND 1068-1080, TISSUE SPECIFICITY. Tissue: Placenta. |
| [20] | "NOSIP, a novel modulator of endothelial nitric oxide synthase activity." Dedio J., Koenig P., Wohlfart P., Schroeder C., Kummer W., Mueller-Esterl W. FASEB J. 15:79-89(2001) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH NOSIP, ENZYME REGULATION, SUBCELLULAR LOCATION. |
| [21] | "NOSTRIN: a protein modulating nitric oxide release and subcellular distribution of endothelial nitric oxide synthase." Zimmermann K., Opitz N., Dedio J., Renne C., Mueller-Esterl W., Oess S. Proc. Natl. Acad. Sci. U.S.A. 99:17167-17172(2002) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH NOSTRIN, ENZYME REGULATION, SUBCELLULAR LOCATION. |
| [22] | "Endothelial thrombomodulin induces Ca2+ signals and nitric oxide synthesis through epidermal growth factor receptor kinase and calmodulin kinase II." David-Dufilho M., Millanvoye-Van Brussel E., Topal G., Walch L., Brunet A., Rendu F. J. Biol. Chem. 280:35999-36006(2005) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT THR-495 AND SER-1177. |
| [23] | "NOSTRIN functions as a homotrimeric adaptor protein facilitating internalization of eNOS." Icking A., Matt S., Opitz N., Wiesenthal A., Mueller-Esterl W., Schilling K. J. Cell Sci. 118:5059-5069(2005) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [24] | "Cell cycle-regulated inactivation of endothelial NO synthase through NOSIP-dependent targeting to the cytoskeleton." Schleicher M., Brundin F., Gross S., Mueller-Esterl W., Oess S. Mol. Cell. Biol. 25:8251-8258(2005) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [25] | "CDK5 phosphorylates eNOS at Ser-113 and regulates NO production." Lee C.-H., Wei Y.-W., Huang Y.-T., Lin Y.-T., Lee Y.-C., Lee K.-H., Lu P.-J. J. Cell. Biochem. 110:112-117(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT SER-114, MUTAGENESIS OF SER-114. |
| [26] | "Structural characterization of nitric oxide synthase isoforms reveals striking active-site conservation." Fischmann T.O., Hruza A., Niu X.D., Fossetta J.D., Lunn C.A., Dolphin E., Prongay A.J., Reichert P., Lundell D.J., Narula S.K., Weber P.C. Nat. Struct. Biol. 6:233-242(1999) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.4 ANGSTROMS). |
| [27] | "Conformational changes in nitric oxide synthases induced by chlorzoxazone and nitroindazoles: crystallographic and computational analyses of inhibitor potency." Rosenfeld R.J., Garcin E.D., Panda K., Andersson G., Aberg A., Wallace A.V., Morris G.M., Olson A.J., Stuehr D.J., Tainer J.A., Getzoff E.D. Biochemistry 41:13915-13925(2002) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.96 ANGSTROMS) OF 67-480. |
| [28] | "Anchored plasticity opens doors for selective inhibitor design in nitric oxide synthase." Garcin E.D., Arvai A.S., Rosenfeld R.J., Kroeger M.D., Crane B.R., Andersson G., Andrews G., Hamley P.J., Mallinder P.R., Nicholls D.J., St-Gallay S.A., Tinker A.C., Gensmantel N.P., Mete A., Cheshire D.R., Connolly S., Stuehr D.J., Aberg A. Getzoff E.D.Nat. Chem. Biol. 4:700-707(2008) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.44 ANGSTROMS) OF 66-492. |
| [29] | "A missense Glu298Asp variant in the endothelial nitric oxide synthase gene is associated with coronary spasm in the Japanese." Yoshimura M., Yasue H., Nakayama M., Shimasaki Y., Sumida H., Sugiyama S., Kugiyama K., Ogawa H., Ogawa Y., Saito Y., Miyamoto Y., Nakao K. Hum. Genet. 103:65-69(1998) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT SUSCEPTIBILITY TO CORONARY SPASM ASP-298. |
| [30] | "In-vivo effects of Glu298Asp endothelial nitric oxide synthase polymorphism." Sofowora G., Dishy V., Xie H.G., Imamura H., Nishimi Y., Morales C.R., Morrow J.D., Kim R.B., Stein C.M., Wood A.J. Pharmacogenetics 11:809-814(2001) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT SUSCEPTIBILITY TO CORONARY SPASM ASP-298. |
| [31] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] CYS-474 AND GLN-602. |
| + | Additional computationally mapped references. |
Web resources
| Wikipedia Nitric oxide synthase entry |
| GeneReviews |
| SeattleSNPs |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | M93718 mRNA. Translation: AAA36364.1. M95296 mRNA. Translation: AAA36372.1. L10709 L10708 Genomic DNA. Translation: AAA36365.1.X76303 X76316 Genomic DNA. Translation: CAA53950.1.D26607 Genomic DNA. Translation: BAA05652.1. DQ256130 mRNA. Translation: ABB79839.1. DQ256131 mRNA. Translation: ABB79840.1. L26914 Genomic DNA. Translation: AAA36374.1. AF400594 mRNA. Translation: AAK83389.1. AK292928 mRNA. Translation: BAF85617.1. AK315213 mRNA. Translation: BAG37648.1. AK223636 mRNA. Translation: BAD97356.1. AF519768 Genomic DNA. Translation: AAM74944.1. EU332855 Genomic DNA. Translation: ABY87544.1. AC010973 Genomic DNA. No translation available. CH471173 Genomic DNA. Translation: EAW54069.1. BC063294 mRNA. Translation: AAH63294.1. BC069465 mRNA. Translation: AAH69465.1. L23210 Genomic DNA. Translation: AAA36373.1. S80791 mRNA. Translation: AAD14336.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00218845. IPI00930257. IPI00930307. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | A47501. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_000594.2. NM_000603.4. NP_001153581.1. NM_001160109.1. NP_001153582.1. NM_001160110.1. NP_001153583.1. NM_001160111.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.647092. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | P29474. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DIP | DIP-38479N. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | P29474. 27 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-106980. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | P29474. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DMDM | 266648. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PaxDb | P29474. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | P29474. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DNASU | 4846. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000297494; ENSP00000297494; ENSG00000164867. ENST00000484524; ENSP00000420215; ENSG00000164867. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 4846. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:4846. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc003wif.3. human. uc011kuz.2. human. uc011kva.2. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 4846. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC07P150688. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| H-InvDB | HIX0033558. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:7876. NOS3. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB002168. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 163729. gene+phenotype. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_P29474. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA254. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | COG4362. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOGENOM | HOG000111088. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG000159. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InParanoid | P29474. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KO | K13242. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG4ZS92B. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| BioCyc | MetaCyc:HS09149-MONOMER. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | angiopoietinreceptor_pathway. Angiopoietin receptor Tie2-mediated signaling. er_nongenomic_pathway. Plasma membrane estrogen receptor signaling. vegfr1_2_pathway. Signaling events mediated by VEGFR1 and VEGFR2. txa2pathway. Thromboxane A2 receptor signaling. vegfr1_pathway. VEGFR1 specific signals. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_111217. Metabolism. REACT_116125. Disease. REACT_604. Hemostasis. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SignaLink | P29474. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | P29474. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | P29474. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_NOS3. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | P29474. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000164867. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene3D | 1.20.990.10. 1 hit. 3.90.340.10. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR003097. FAD-binding_1. IPR017927. Fd_Rdtase_FAD-bd. IPR001094. Flavdoxin. IPR008254. Flavodoxin/NO_synth. IPR001709. Flavoprot_Pyr_Nucl_cyt_Rdtase. IPR023173. NADPH_Cyt_P450_Rdtase_dom3. IPR004030. NO_synthase_oxygenase_dom. IPR026009. NOS. IPR012144. NOS_met. IPR001433. OxRdtase_FAD/NAD-bd. IPR017938. Riboflavin_synthase-like_b-brl. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PANTHER | PTHR19384:SF5. PTHR19384:SF5. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00667. FAD_binding_1. 1 hit. PF00258. Flavodoxin_1. 1 hit. PF00175. NAD_binding_1. 1 hit. PF02898. NO_synthase. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIRSF | PIRSF000333. NOS. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRINTS | PR00369. FLAVODOXIN. PR00371. FPNCR. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF56512. NO_synthase_oxygenase_reg. 1 hit. SSF63380. Riboflavin_synthase_like_b-brl. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS51384. FAD_FR. 1 hit. PS50902. FLAVODOXIN_LIKE. 1 hit. PS60001. NOS. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| BindingDB | P29474. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ChEMBL | CHEMBL4803. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ChiTaRS | NOS3. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DrugBank | DB00125. L-Arginine. DB00155. L-Citrulline. DB01098. Rosuvastatin. DB00360. Tetrahydrobiopterin. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | P29474. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 4846. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 18666. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | NOS3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P29474 Secondary accession number(s): A0S0A7 Q9UDC6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
